Systematizing in vivo modeling of pediatric disorders
|
|
- Iris Gibson
- 6 years ago
- Views:
Transcription
1 Systematizing in vivo modeling of pediatric disorders Nicholas Katsanis, Ph.D. Duke University Medical Center Center for Human Disease Modeling Rescindo Therapeutics
2
3
4 Task Force for Neonatal Genomics A hybrid structure at Duke Clinical Management & Patient Interaction In vivo/in vitro assay of allele function Genetics/ Genomics Policy Genome-wide sequencing & analysis
5 Our biggest Challenge Our current ability to interpret genetic variation accurately 1. Is the gene relevant to a disease state 2. Is a DNA variant within a gene altering the function of the encoded protein? 3. How do we answer these questions?
6 In vivo assays to model human genetic disease Assays for >750 human disease genes: Nervous system Macro/Microcephaly Optic nerve atrophy Gut motility Carnes et al, PLoS Genet 10:e (2014) Golzio et al, Nature 485: (2012) Cerebellar hypoplasia Peripheral neuropathy Bernier et al, Cell 158: (2014) Margolin et al, N Engl J Med 368: (2013) Gonzaga-Jeugegui et al, Cell Rep2015
7 In vivo assays to model human genetic disease Major organ systems Craniofacial anomalies Vascular integrity Renal atrophy/cysts Chassaing et al, J Med Genet 49: (2012) Lee et al, Mol Biol Cell 23: (2012) Lindstrand et al, Am J Hum Genet 94: (2014) cmlc2:egfp Cardiac malformations Muscular dystrophy R L R L R Hjeij et al, Am J Hum Genet. 93: (2013) L Sarparanta et al, Nat Genet 44: (2012)
8 Systematic Discovery of New Disease Genes Recruit ~50 families/year >10-20 new disease genes/year Phenotypic expansions Complex inheritance CNV dissection Opportunistic Drug Discovery
9 Vignette 1: A novel disease gene in an uncharacterized syndrome DM Proband clinical features Microcephaly Hypotonia Post axial polydactyly bilateral on the feet Severe developmental delay Strabismus Scoliosis Absent clitoris Bilateral vesicoureteral reflux Right complete ureteral duplication Proband: 6 years, 2 months at consent Ethnicity: European American Clinical testing Microarray: NPHP1 deletion (het) Referring clinician (Gallentine) Pediatric Neurology
10 Exome sequencing reveals three candidate genes DM Filter data to identify variants that are: Rare in the general population (<1%) Predicted to alter protein function Inherited from the parents or new from the child Make biological sense DM074 Final candidates Gene Inheritance/segregation Disease association NCAPG2 compound het missense na TTN compound het Cardiomyopathy, Muscular dystrophy GLRA3 de novo missense na
11 A phenotype match Clinical exome sequencing identified NCAPG2 p.t850p mutation in patient 2 Eye anomalies Limb anomalies Brain anomalies Renal/urogenital anomalies Growth defects Spinal anomalies Other anomalies DM074 Strabismus, nystagmus, pigmentary retinopathy, epiblepharon Post axial bilateral polydactyly on feet Microcephaly; dilated cerebral ventricles (prenatally) Small right kidney; kidney cysts (prenatally); vesicoureteral reflux, right complete ureteral duplication Growth failure; hormone treatments recommended Sacral dimple; tethered cord; scoliosis Absent clitoris, craniofacial anomalies DM516 Peter's anomaly, left sided coloboma, glaucoma Clinodactyly; Missing digits on feet Microcephaly History of hydronephrosis Intrauterine growth restriction; failure to thrive Sacral dimple; low lying conus medullaris (tethered cord?) Hearing loss, cardiac defects, neutropenia
12 Suppression of ncapg2 results in microcephaly... Control MO MO+WT MO+p.794 MO+p.609 MO+p.693 MO+p dpf 655 Head size (um) **** **** **** * ** ** **** * p vs MO p vs MO+WT
13 CRISPR-Cas9 editing of ncapg2 results in microcephaly... Control sgrna sgrna+cas9 3 dpf p=< p=< Head size (um) Head size (um) Control sgrna1 sgrna1+cas9
14 Vignette 2: Rare alleles that rescue rare alleles in cis Clinical features Global developmental delay microcephaly feeding issues failure to thrive abnormal muscle tone low immunoglobulins frequent respiratory infections Clinical testing normal female microarray metabolic testing negative extensive genetic testing negative BTG2: Involved in the G1/S transition of the cell cycle NOS2: Nitric oxide synthase 2, inducible TTN: Titin
15 BTG2 is the disease driver Microcephaly Neuronal expr. cell proliferation
16 Conservation of BTG2 141M in multiple species
17 Compensatory Mutations Secondary mutations that alleviate deleterious effect of primary mutations Functional wild-type protein Primary mutation (U) disrupts protein structure/function Compensatory mutation (V) restores structure/function Sayuri & Tetsuro, Frontiers in Microbiology, Vol 2, #267, 2012
18 Finding Potential Compensatory Mutations Human Protein Mutated to -A- in human disease IYKQALIFRLEGNIPESLELFQTCAVLSPQSNDNLKQVARSLFLLGIHKA --V------F----Q------P A A-----K--- --V---Q Q T-----A A-----K--- --V---Q Q---H A----I K--- --V Q Y A K N E---K--- N D N K--- N D N K--- N-----Q N Q D N K Q D N K---
19 BTG2 has two compensatory mutations Number of cells/embryo UI Ctrl Mo Mo + WT Mo + V141M *P<0.01 vs V141M rescue alone Number of cells stained with phospho Histone H3 Mo + G6R Mo + G40R Injection * * Mo + R80K Mo + Q94R Mo + S98R Mo + L128V Mo + A130T Mo + C132Y Mo + L142M Jordan, Frangakis et al, Nature 2015
20 TFNG Discovery Rate Data from 238 families Inconclusive Genes not associated with disease and unable to test functionally 12% Probably causal Known gene and known mutation Maybe causal Novel disease genes harboring candidate pathogenic alleles; no direct functional assay 16% 72% Known gene and novel functional variants Known CNV New gene with strong functional evidence
21 The Big Picture Collaboration and data sharing are key Community engagement is necessary Strong genetics and biochemistry You never know where your winners come from
22
23 Thank you
The Complexity of Simple Genetics
The Complexity of Simple Genetics? The ciliopathies: a journey into variable penetrance and expressivity Bardet-Biedl Syndrome Allelism at a single locus is insufficient to explain phenotypic variability
More informationCURRENT GENETIC TESTING TOOLS IN NEONATAL MEDICINE. Dr. Bahar Naghavi
2 CURRENT GENETIC TESTING TOOLS IN NEONATAL MEDICINE Dr. Bahar Naghavi Assistant professor of Basic Science Department, Shahid Beheshti University of Medical Sciences, Tehran,Iran 3 Introduction Over 4000
More informationExploding Genetic Knowledge in Developmental Disabilities. Disclosures. The Genetic Principle
Exploding Genetic Knowledge in Developmental Disabilities How to acquire the data and how to make use of it Elliott H. Sherr MD PhD Professor of Neurology & Pediatrics UCSF Disclosures InVitae: clinical
More informationvariant led to a premature stop codon p.k316* which resulted in nonsense-mediated mrna decay. Although the exact function of the C19L1 is still
157 Neurological disorders primarily affect and impair the functioning of the brain and/or neurological system. Structural, electrical or metabolic abnormalities in the brain or neurological system can
More information22q11.2 DELETION SYNDROME. Anna Mª Cueto González Clinical Geneticist Programa de Medicina Molecular y Genética Hospital Vall d Hebrón (Barcelona)
22q11.2 DELETION SYNDROME Anna Mª Cueto González Clinical Geneticist Programa de Medicina Molecular y Genética Hospital Vall d Hebrón (Barcelona) Genomic disorders GENOMICS DISORDERS refers to those diseases
More informationEvolution of Genetic Testing. Joan Pellegrino MD Associate Professor of Pediatrics SUNY Upstate Medical University
Evolution of Genetic Testing Joan Pellegrino MD Associate Professor of Pediatrics SUNY Upstate Medical University Genetic Testing Chromosomal analysis Flourescent in situ hybridization (FISH) Chromosome
More informationDysmorphology And The Paediatric Eye. Jill Clayton-Smith Manchester Centre For Genomic Medicine
Dysmorphology And The Paediatric Eye Jill Clayton-Smith Manchester Centre For Genomic Medicine Why Make A Syndrome Diagnosis? Why did it happen? What does the future hold? How can you treat/manage it?
More informationUAB P30 CORE A: The Hepato-Renal Fibrocystic Diseases Translational Resource
PKD Foundation UAB P30 CORE A: The Hepato-Renal Fibrocystic Diseases Translational Resource http://www.arpkdstudies.uab.edu/ Director: Co-Director: Lisa M. Guay-Woodford, MD William E. Grizzle, MD, PhD
More informationProximal 18q- Treatment and Surveillance ICD-10 = Q99.9 or Q93.89
Proximal 18q- Treatment and Surveillance ICD-10 = Q99.9 or Q93.89 These recommendations are inclusive of the entire population of people with Proximal 18q deletions even though each person has a unique
More informationCentoXome FUTURE'S KNOWLEDGE APPLIED TODAY
CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY More genetic information requires cutting-edge interpretation techniques Whole Exome Sequencing For certain patients the combination of symptoms does not allow
More informationNature Genetics: doi: /ng Supplementary Figure 1. PCA for ancestry in SNV data.
Supplementary Figure 1 PCA for ancestry in SNV data. (a) EIGENSTRAT principal-component analysis (PCA) of SNV genotype data on all samples. (b) PCA of only proband SNV genotype data. (c) PCA of SNV genotype
More informationCentoXome FUTURE'S KNOWLEDGE APPLIED TODAY
CentoXome FUTURE'S KNOWLEDGE APPLIED TODAY More genetic information requires cutting-edge interpretation techniques Whole Exome Sequencing For some patients, the combination of symptoms does not allow
More informationNeonatal Hypotonia Guideline Prepared by Dan Birnbaum MD August 27, 2012
Neonatal Hypotonia Guideline Prepared by Dan Birnbaum MD August 27, 2012 Hypotonia: reduced tension or resistance to range of motion Localization can be central (brain), peripheral (spinal cord, nerve,
More informationChallenges of CGH array testing in children with developmental delay. Dr Sally Davies 17 th September 2014
Challenges of CGH array testing in children with developmental delay Dr Sally Davies 17 th September 2014 CGH array What is CGH array? Understanding the test Benefits Results to expect Consent issues Ethical
More informationGenetic mates SNPedia write-ups Final Next-gen sequencing Mike Snyder QA: new technology and the future
Genetic mates SNPedia write-ups Final Next-gen sequencing Mike Snyder QA: new technology and the future Genetic Mates Jonathan Mortensen/Francisco Gimenez Will need class to upload data Tuesday night Analyze
More informationAssessing Laboratory Performance for Next Generation Sequencing Based Detection of Germline Variants through Proficiency Testing
Assessing Laboratory Performance for Next Generation Sequencing Based Detection of Germline Variants through Proficiency Testing Karl V. Voelkerding, MD Professor of Pathology University of Utah Medical
More informationSMA IS A SEVERE NEUROLOGICAL DISORDER [1]
SMA OVERVIEW SMA IS A SEVERE NEUROLOGICAL DISORDER [1] Autosomal recessive genetic inheritance 1 in 50 people (approximately 6 million Americans) are carriers [2] 1 in 6,000 to 1 in 10,000 children born
More informationCerebral Malformation gene panel
Cerebral Malformation gene panel Dr John Livingston Consultant Paediatric Neurologist Leeds Teaching Hospitals NHS Trust on behalf of Yorkshire Regional Genetics Service Leeds UK Cerebral Malformation
More informationNYEIS Version 4.3 (ICD) ICD - 10 Codes Available in NYEIS at time of version launch (9/23/2015)
D82.1 Di George's syndrome E63.9 Nutritional deficiency, unspecified E70.21 Tyrosinemia E70.29 Other disorders of tyrosine metabolism E70.30 Albinism, unspecified E70.5 Disorders of tryptophan metabolism
More informationNicholas Katsanis, Ph.D.
Ciliopathies and Oligogenic Phenomena Prof. Center for Human Disease Modeling Duke University 1 Some key questions in human genetics What variants cause disease? What variants are associated with disease
More informationMedical Conditions Resulting in High Probability of Developmental Delay and DSCC Screening Information
Jame5. L.Jma5, ~reuiry Medical Conditions Medical Conditions Resulting in High Probability of Developmental Delay and DSCC Screening Information I Not Listed later Children with medical conditions which
More informationCopy Number Variants of Uncertain Significance in Prenatal diagnosis Are the Goalposts Moving? Lisa Burvill-Holmes Bristol Genetics Laboratory
Copy Number Variants of Uncertain Significance in Prenatal diagnosis Are the Goalposts Moving? Lisa Burvill-Holmes Bristol Genetics Laboratory http://www.nbt.nhs.uk/genetics Microarray CGH in Prenatal
More informationMultiple Copy Number Variations in a Patient with Developmental Delay ASCLS- March 31, 2016
Multiple Copy Number Variations in a Patient with Developmental Delay ASCLS- March 31, 2016 Marwan Tayeh, PhD, FACMG Director, MMGL Molecular Genetics Assistant Professor of Pediatrics Department of Pediatrics
More informationMuscular Dystrophy. Biol 405 Molecular Medicine
Muscular Dystrophy Biol 405 Molecular Medicine Duchenne muscular dystrophy Duchenne muscular dystrophy is a neuromuscular disease that occurs in ~ 1/3,500 male births. The disease causes developmental
More information04/ p. 18p deletions. 18p Critical Regions
18p 04/2017 18p deletions 18p Critical Regions 18p (cen) Newborn Physical Findings (N=31) Neonatal complications 74% Feeding Difficulties 42% Respiratory Difficulties 29% Jaundice 29% Hypoglycemia 10%
More information18p- Treatment and Surveillance ICD-10 = Q99.9 or Q93.89
18p- Treatment and Surveillance ICD-10 = Q99.9 or Q93.89 These recommendations are inclusive of the entire population of people with 18p deletions. Even though about half of this group have deletions of
More informationEvaluation of the Hypotonic Infant and Child
Evaluation of the Hypotonic Infant and Child Basil T. Darras, M.D. Neuromuscular Program Boston Children s Hospital Harvard Medical School Boston, MA, USA Classification and General Clinical Evaluation
More informationNeuropathology Specialty Conference
Neuropathology Specialty Conference March 22, 2010 Case 2 Rebecca Folkerth, MD Brigham and Women s Hospital Children s Hospital Harvard Medical School Clinical History 18-gestational-week fetus found on
More informationFrontiers in Personalized Medicine. PW-GW-AS DNA sequencing Reverse human genetics
Frontiers in Personalized Medicine PW-GW-AS DNA sequencing Reverse human genetics Published Genome-Wide Associations through 06/2011, 1,449 published GWA at p 5x10-8 for 237 traits NHGRI GWA Catalog www.genome.gov/gwastudies
More informationChromosome Microarray Analysis (CMA)
Chromosome Microarray Analysis (CMA) Ina E. Amarillo, PhD FACMG Cytogenomics Lab (Associate Medical Director) Pathology (Assistant Professor) OUTLINE Clinical Indications for Cytogenomics Testing Cytogenomics
More informationPractical challenges that copy number variation and whole genome sequencing create for genetic diagnostic labs
Practical challenges that copy number variation and whole genome sequencing create for genetic diagnostic labs Joris Vermeesch, Center for Human Genetics K.U.Leuven, Belgium ESHG June 11, 2010 When and
More informationFaravareh Khordadpoor (PhD in molecular genetics) 1- Tehran Medical Genetics Laboratory 2- Science and research branch, Islamic Azad University
Faravareh Khordadpoor (PhD in molecular genetics) 1- Tehran Medical Genetics Laboratory 2- Science and research branch, Islamic Azad University 1395 21 مشاوره ژنتیک و نقش آن در پیش گیری از معلولیت ها 20
More informationNon-Mendelian inheritance
Non-Mendelian inheritance Focus on Human Disorders Peter K. Rogan, Ph.D. Laboratory of Human Molecular Genetics Children s Mercy Hospital Schools of Medicine & Computer Science and Engineering University
More informationMRC-Holland MLPA. Description version 12; 13 January 2017
SALSA MLPA probemix P219-B3 PAX6 Lot B3-0915: Compared to version B2 (lot B2-1111) two reference probes have been replaced and one additional reference probe has been added. In addition, one flanking probe
More informationSyndromic X Linked Mental Retardation
Syndromic X Linked Mental Retardation Introduction : Dr. Yousef.A. Assaleh Dept. of Pediatric - faculty of medicine Zawia University Mental retardation is defined as incomplete or insufficient general
More informationPostnatal Exome Sequencing
Postnatal Exome Sequencing Ata Bushehri, MD, PhD candidate Genetics Research Center, University of Social Welfare and Rehabilitation Sciences, Tehran, Iran Genetic Counseling Overview Pattern of Inheritance
More informationGenetics and Genomics: Applications to Developmental Disability
Tuesday, 12:30 2:00, B1 Objective: Genetics and Genomics: Applications to Developmental Disability Helga Toriello 616-234-2712 toriello@msu.edu Identify advances in clinical assessment and management of
More informationApproach to the Genetic Diagnosis of Neurological Disorders
Approach to the Genetic Diagnosis of Neurological Disorders Dr Wendy Jones MBBS MRCP Great Ormond Street Hospital for Children National Hospital for Neurology and Neurosurgery What is a genetic diagnosis?
More information5/2/18. After this class students should be able to: Stephanie Moon, Ph.D. - GWAS. How do we distinguish Mendelian from non-mendelian traits?
corebio II - genetics: WED 25 April 2018. 2018 Stephanie Moon, Ph.D. - GWAS After this class students should be able to: 1. Compare and contrast methods used to discover the genetic basis of traits or
More informationCase 1B. 46,XY,-14,+t(14;21)
Case 1B 46,XY,-14,+t(14;21) G-banded Chromosome telomere centromere G-dark bands AT-rich few genes G-pale bands GC-rich many genes telomere ideograms ideograms Conventional (light microscopy) p = short
More informationGenetic test for Bilateral frontoparietal polymicrogyria
Genetic test for Bilateral frontoparietal polymicrogyria Daniela Pilz, Cardiff UKGTN Genetic testing for neurological conditions; London February 26 th 2013 Region-specific Polymicrogyria (PMG) bilateral
More informationThe Deciphering Development Disorders (DDD) project: What a genomic approach can achieve
The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve RCP ADVANCED MEDICINE, LONDON FEB 5 TH 2018 HELEN FIRTH DM FRCP DCH, SANGER INSTITUTE 3,000,000,000 bases in each
More informationAdvances in genetic diagnosis of neurological disorders
Acta Neurol Scand 2014: 129 (Suppl. 198): 20 25 DOI: 10.1111/ane.12232 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd ACTA NEUROLOGICA SCANDINAVICA Review Article Advances in genetic diagnosis
More informationNGS panels in clinical diagnostics: Utrecht experience. Van Gijn ME PhD Genome Diagnostics UMCUtrecht
NGS panels in clinical diagnostics: Utrecht experience Van Gijn ME PhD Genome Diagnostics UMCUtrecht 93 Gene panels UMC Utrecht Cardiovascular disease (CAR) (5 panels) Epilepsy (EPI) (11 panels) Hereditary
More informationSupplementary Online Content
Supplementary Online Content Honein MA, Dawson AL, Petersen E, et al; US Zika Pregnancy Registry Collaboration. Birth Defects Among Fetuses and Infants of US Women With Laboratory Evidence of Possible
More informationThe Genetics of VHL. Proper tissue growth - controlled traffic. How human cells and tissue grow and die?
How human cells and tissue grow and die? The Genetics of VHL Xia Wang MD PhD Oct, 2017 Proper tissue growth - controlled traffic Normal tissue growth is regulated by many genetic factors Safe traffic is
More informationSorsby syndrome: a report on further generations of the original family
Journal of Medical Genetics 1988, 25, 313-321 Sorsby syndrome: a report on further generations of the original family E M THOMPSON AND M BARAITSER From the Clinical Genetics Unit, The Hospitals for Sick
More informationInterpretation can t happen in isolation. Jonathan S. Berg, MD/PhD Assistant Professor Department of Genetics UNC Chapel Hill
Interpretation can t happen in isolation Jonathan S. Berg, MD/PhD Assistant Professor Department of Genetics UNC Chapel Hill With the advent of genome-scale sequencing, variant interpretation is increasingly
More informationCongenital Heart Disease How much of it is genetic?
Congenital Heart Disease How much of it is genetic? Stephen Robertson Curekids Professor of Paediatric Genetics Dunedin School of Medicine University of Otago Congenital Heart Disease The most common survivable
More informationInvestigating rare diseases with Agilent NGS solutions
Investigating rare diseases with Agilent NGS solutions Chitra Kotwaliwale, Ph.D. 1 Rare diseases affect 350 million people worldwide 7,000 rare diseases 80% are genetic 60 million affected in the US, Europe
More informationClinical Genetics in Cardiomyopathies
Clinical Genetics in Cardiomyopathies Γεώργιος Κ Ευθυμιάδης Αναπληρωτής Καθηγητής Καρδιολογίας ΑΠΘ No conflict of interest Genetic terms Proband: The first individual diagnosed in a family Mutation: A
More informationGenetic Discovery for Congenital Heart
Genetic Discovery for Congenital Heart 51 Defects Bruce D. Gelb Abstract Congenital heart disease (CHD) behaves like a complex genetic trait in most instances. Recent advances in genomics have provided
More informationOrdering Physician Information Additional Report Recipient 1
Test Selection Targeted Whole Exome Sequencing - Proband Only Targeted Whole Exome Sequencing - Trio Confirmatory Sanger sequencing validation Re-analysis (at least one year after initial analysis) Specimen
More informationNIH Public Access Author Manuscript Kidney Int. Author manuscript; available in PMC 2011 September 1.
NIH Public Access Author Manuscript Published in final edited form as: Kidney Int. 2011 March ; 79(6): 691 692. doi:10.1038/ki.2010.514. The case: Familial occurrence of retinitis pigmentosa, deafness
More informationHereditary disorders of peroxisomal metabolism.
Hereditary disorders of peroxisomal metabolism http://www.cytochemistry.net/cell-biology/perox.jpg Peroxisomes single membrane organelles from less than 100 to more than 1000 per eukaryotic cell more than
More informationNational Disease Research Interchange Annual Progress Report: 2010 Formula Grant
National Disease Research Interchange Annual Progress Report: 2010 Formula Grant Reporting Period July 1, 2011 June 30, 2012 Formula Grant Overview The National Disease Research Interchange received $62,393
More informationFEP Medical Policy Manual
FEP Medical Policy Manual FEP 2.04.102 Whole Exome and Whole Genome Sequencing for Diagnosis of Genetic Disorders Effective Date: April 15, 2017 Related Policies: 2.04.59 Genetic Testing for Developmental
More informationPresentation and investigation of mitochondrial disease in children
Presentation and investigation of mitochondrial disease in children Andrew Morris Willink Unit, Manchester Mitochondrial function Carbohydrate Fat Respiratory chain Energy Mitochondria are the product
More informationGenetic Counselling in relation to genetic testing
Genetic Counselling in relation to genetic testing Dr Julie Vogt Consultant Geneticist West Midlands Regional Genetics Service September 2016 Disclosures for Research Support/P.I. Employee Consultant Major
More informationCorporate Medical Policy
Corporate Medical Policy Invasive Prenatal (Fetal) Diagnostic Testing File Name: Origination: Last CAP Review: Next CAP Review: Last Review: invasive_prenatal_(fetal)_diagnostic_testing 12/2014 3/2018
More informationSpinal Muscular Atrophy as a Focus Indication for Biomarker Development. Meg Winberg, PhD Spinal Muscular Atrophy Foundation February 26, 2007
Spinal Muscular Atrophy as a Focus Indication for Biomarker Development Meg Winberg, PhD Spinal Muscular Atrophy Foundation February 26, 2007 Why SMA? p Low incidence, but a large orphan indication p Scientifically
More informationMedical Genetics. Consult and Referral Guidelines
Medical Genetics Consult and Referral Guidelines HDVCH has developed these consult and referral guidelines as a general reference tool to assist referring physicians with the specialty referral process.
More informationSharan Goobie, MD, MSc, FRCPC
Sharan Goobie, MD, MSc, FRCPC Chromosome testing in 2014 Presenter Disclosure: Sharan Goobie has no potential for conflict of interest with this presentation Objectives Review of standard genetic investigations
More informationHereditary disorders of peroxisomal metabolism.
Hereditary disorders of peroxisomal metabolism http://www.cytochemistry.net/cell-biology/perox.jpg Peroxisomes single membrane organelles from less than 100 to more than 1000 per eucaryotic cell more than
More informationGenetics in Nephrology. Saeid Morovvati Associate Professor of BMSU Director of Biogene Laboratory
Genetics in Nephrology Saeid Morovvati Associate Professor of BMSU Director of Biogene Laboratory Genetics in: A. Congenital Anomalies of the Kidney and Urinary Tract B. Cystic Diseases of the Kidney C.
More informationChapter 26. Newborn Screening
Chapter 26 Newborn Screening Severe Combined Immune Deficiency (SCID) leads to life-threatening infections unless the immune system can be restored through a bone marrow transplant, enzyme replacement
More informationMiller-Dieker syndrome. William B Dobyns, MD
Miller-Dieker syndrome William B Dobyns, MD MDS phenotype Early clinical course Prenatal Prenatal growth DEF 11/26 Polyhydramnios 13/24 Neonatal Neonatal resuscitation 06/20 Neonatal jaundice 08/21 Growth
More informationClinical evaluation of microarray data
Clinical evaluation of microarray data David Amor 19 th June 2011 Single base change Microarrays 3-4Mb What is a microarray? Up to 10 6 bits of Information!! Highly multiplexed FISH hybridisations. Microarray
More informationWhat s the Human Genome Project Got to Do with Developmental Disabilities?
What s the Human Genome Project Got to Do with Developmental Disabilities? Disclosures Neither speaker has anything to disclose. Phase Two: Interpretation Officially started in October 1990 Goals of the
More informationSupplemental Information
ARTICLE Supplemental Information SUPPLEMENTAL TABLE 6 Mosaic and Partial Trisomies Thirty-eight VLBW infants were identified with T13, of whom 2 had mosaic T13. T18 was reported for 128 infants, of whom
More informationHypotonia Care Pathway Update: Diagnosis Garey Noritz, MD...
Hypotonia Care Pathway Update: Diagnosis Garey Noritz, MD Disclosure Information- AACPDM 72 nd Annual Meeting October 9-13, 2018 Speaker Name: Garey Noritz, MD Disclosure of Relevant Financial Relationships
More informationBench to Bassinet Pediatric Cardiac Genomics Consortium: CHD GENES Form 105: Congenital Extracardiac Findings Version: B - 11/01/2010
Bench to Bassinet Pediatric Cardiac Genomics Consortium: CHD GENES Form 105: Congenital Extracardiac Findings Version: B - 11/01/2010 SECTION A: ADMINISTRATIVE INFORMATION A1. Study Identification Number:
More informationMYOCLONIC EPILEPSY WITH RAGGED RED FIBERS (MERRF) By- Promie Faruque
MYOCLONIC EPILEPSY WITH RAGGED RED FIBERS (MERRF) By- Promie Faruque PHYSIOLOGY -MERRF is a rare panethnic mitochondrial disease which is caused by mutations in the mtdna -It mainly affects the muscle
More informationMOLECULAR DIAGNOSIS for X-LINKED INTELLECTUAL DISABILITY
MOLECULAR DIAGNOSIS for X-LINKED INTELLECTUAL DISABILITY Intellectual disability (ID) or mental retardation is characterized by significant limitations in cognitive abilities and social/behavioral adaptive
More informationPosterior fossa malformations
ANDREA ROSSI, MD Head, Department of Pediatric Neuroradiology G. Gaslini Children s Research Hospital Genoa Italy andrearossi@ospedale-gaslini.ge.it Posterior fossa malformations Cerebellar ataxia Hypotonia
More informationAPNA 28th Annual Conference Session 1043: October 22, 2014
Kathleen Gaffney, PMHCNS, CPNP, PMHS BC Dr. Joy A. Lauerer, DNP, PMHCNS BC, RN Dr. Colleen C. Williams, DNP, FPMHNP BC National Scientific Council on the Developing Child (2010). Early experiences can
More informationCorporate Medical Policy
Corporate Medical Policy File Name: Origination: Last CAP Review: Next CAP Review: Last Review: nusinersen_spinraza 03/2017 10/2018 10/2019 10/2018 Description of Procedure or Service Spinal muscular atrophy
More informationExon skipping in a DCM mouse model mimicking a human mutation in titin
Exon skipping in a DCM mouse model mimicking a human mutation in titin Dr. Michael Gramlich Department of Cardiology, University of Tuebingen, Germany I do not have a financial interest/arrangement or
More informationProgram SPECIFICATION FOR PhD Degree in Human Genetics. Code: A- Basic information. B- Professional Information
Program SPECIFICATION FOR PhD Degree in Human Genetics Code: 73800 University: Alexandria Faculty: Medical Research Institute Program Specification A- Basic information - Program title : PhD in Human Genetics
More informationCongenital Pediatric Anomalies: A Collection of Abdominal Scintigraphy Findings: An Imaging Atlas
ISPUB.COM The Internet Journal of Nuclear Medicine Volume 5 Number 1 Congenital Pediatric Anomalies: A Collection of Abdominal Scintigraphy Findings: An Imaging Atlas V Vijayakumar, T Nishino Citation
More informationGenetic Conditions and Services: An Introduction
Genetic Conditions and Services: An Introduction Jennifer Roberts, MC, MS, CGC Laboratory Genetics Counselor The Children s Mercy Hospital, 2017 Goals Determine which children/families may benefit from
More informationVACTERL association: A Case Report of a congenital malformations Dr. Rinku Saini 1, Dr. Lovesh Saini 2, Dr. Priti Saini 3, Dr. R. N.
VACTERL association: A Case Report of a congenital malformations Dr. Rinku Saini 1, Dr. Lovesh Saini 2, Dr. Priti Saini 3, Dr. R. N. Sehra 4 1 Assistant Professor, Department of Pediatric Medicine, S.M.S
More informationVesicoureteral Reflux (VUR) New
Vesicoureteral Reflux (VUR) New What is vesicoureteral reflux? Vesicoureteral reflux is the abnormal backflow of urine from the bladder into the ureter and up to the kidney. The majority of the time this
More informationNewborn Screen & Development Facts about the genetic diseases new since March 2006 (Excluding Cystic Fibrosis)
Newborn Screen & Development Facts about the genetic diseases new since March 2006 (Excluding Cystic Fibrosis) 1) Argininosuccinic acidemia (ASA) a) Incidence: ~1 in 70,000 b) Deficiency in an enzyme of
More informationEarly Embryonic Development
Early Embryonic Development Maternal effect gene products set the stage by controlling the expression of the first embryonic genes. 1. Transcription factors 2. Receptors 3. Regulatory proteins Maternal
More informationHow many disease-causing variants in a normal person? Matthew Hurles
How many disease-causing variants in a normal person? Matthew Hurles Summary What is in a genome? What is normal? Depends on age What is a disease-causing variant? Different classes of variation Final
More informationMalformations of the Nervous System November 10, Dr. Peter Ostrow
Malformations of the Nervous System November 10, 2016 Dr. Peter Ostrow Malformations of the Nervous System 1. Abnormal closure of the neural tube 1. Disorders of forebrain formation 1. Cortical anomalies
More informationIntellectual Disability Exome Panel Requisition Form
Intellectual Disability Exome Panel Requisition Form The University of Chicago Genetic Services Laboratories 5841 South Maryland Avenue, Room G701/MC0077, Chicago, IL 60637 Toll Free: 888.824.3637 Local:
More informationA Deficit of ATP-ase Subunit 8: with Contribution for Two New Cases
A Deficit of ATP-ase Subunit 8: with Contribution for Two New Cases Stancheva M. 1*, Radeva B. 2, Naumova E. 3, Mihailova S. 3 1 University Children s Hospital Alexandrovska, Sofia, Bulgaria 2 University
More informationWhole Exome Sequencing (WES) Whole Exome Sequencing. What Is Whole Exome Sequencing?
Whole Exome Sequencing (WES) Procedure(s) addressed by this policy: Exome (e.g., unexplained constitutional or heritable disorder or syndrome); sequence analysis Sequence analysis, each comparator exome
More informationCase Report Severe Psychomotor Delay in a Severe Presentation of Cat-Eye Syndrome
Case Reports in Genetics Volume 2015, Article ID 943905, 4 pages http://dx.doi.org/10.1155/2015/943905 Case Report Severe Psychomotor Delay in a Severe Presentation of Cat-Eye Syndrome Guillaume Jedraszak,
More informationSNP Array NOTE: THIS IS A SAMPLE REPORT AND MAY NOT REFLECT ACTUAL PATIENT DATA. FORMAT AND/OR CONTENT MAY BE UPDATED PERIODICALLY.
SAMPLE REPORT SNP Array NOTE: THIS IS A SAMPLE REPORT AND MAY NOT REFLECT ACTUAL PATIENT DATA. FORMAT AND/OR CONTENT MAY BE UPDATED PERIODICALLY. RESULTS SNP Array Copy Number Variations Result: GAIN,
More informationScoliosis: Orthopaedic Perspectives
Scoliosis: Orthopaedic Perspectives Scott B. Rosenfeld, MD Division of Pediatric Orthopaedic Surgery Texas Children s Hospital Page 0 xxx00.#####.ppt 9/23/2012 8:26:24 AM I have no disclosures Disclosures
More informationFunctional validation of cancer susceptibility genes using gene editing
Functional validation of cancer susceptibility genes using gene editing 2-22-2017 Sabine Topka Research Fellow Niehaus Center for Inherited Cancer Genomics www.mskcc.org Inherited Predisposition to Cancer
More informationFetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management
Fetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management 12 weeks Alfred Abuhamad, M.D. Eastern Virginia Medical School 13 weeks 2nd trimester Medullary pyramids Renal Sinus Cortex 2nd
More informationAssociation for Molecular Pathology Promoting Clinical Practice, Basic Research, and Education in Molecular Pathology
Association for Molecular Pathology Promoting Clinical Practice, Basic Research, and Education in Molecular Pathology 9650 Rockville Pike, Bethesda, Maryland 20814 Tel: 301-634-7939 Fax: 301-634-7990 Email:
More informationAutosomal Dominant Polycystic Kidney Disease. Dr. Sameena Iqbal Nephrologist CIUSSS West Island
Autosomal Dominant Polycystic Kidney Disease Dr. Sameena Iqbal Nephrologist CIUSSS West Island Disclosure Honorarium for Consulting on the Reprise trial from Otsuka Mayo clinic preceptorship for PKD with
More informationA CASE OF GIANT AXONAL NEUROPATHY HEMANANTH T SECOND YEAR POST GRADUATE IN PAEDIATRICS INSTITUTE OF SOCIAL PAEDIATRICS GOVERNMENT STANLEY HOSPITAL
A CASE OF GIANT AXONAL NEUROPATHY HEMANANTH T SECOND YEAR POST GRADUATE IN PAEDIATRICS INSTITUTE OF SOCIAL PAEDIATRICS GOVERNMENT STANLEY HOSPITAL CASE HISTORY Nine year old male child Second born Born
More informationCorporate Medical Policy
Corporate Medical Policy File Name: Origination: Last CAP Review: Next CAP Review: Last Review: nusinersen_spinraza 03/2017 10/2017 10/2018 10/2017 Description of Procedure or Service Spinal muscular atrophy
More information