Systematizing in vivo modeling of pediatric disorders

Save this PDF as:

Size: px
Start display at page:

Download "Systematizing in vivo modeling of pediatric disorders"


1 Systematizing in vivo modeling of pediatric disorders Nicholas Katsanis, Ph.D. Duke University Medical Center Center for Human Disease Modeling Rescindo Therapeutics



4 Task Force for Neonatal Genomics A hybrid structure at Duke Clinical Management & Patient Interaction In vivo/in vitro assay of allele function Genetics/ Genomics Policy Genome-wide sequencing & analysis

5 Our biggest Challenge Our current ability to interpret genetic variation accurately 1. Is the gene relevant to a disease state 2. Is a DNA variant within a gene altering the function of the encoded protein? 3. How do we answer these questions?

6 In vivo assays to model human genetic disease Assays for >750 human disease genes: Nervous system Macro/Microcephaly Optic nerve atrophy Gut motility Carnes et al, PLoS Genet 10:e (2014) Golzio et al, Nature 485: (2012) Cerebellar hypoplasia Peripheral neuropathy Bernier et al, Cell 158: (2014) Margolin et al, N Engl J Med 368: (2013) Gonzaga-Jeugegui et al, Cell Rep2015

7 In vivo assays to model human genetic disease Major organ systems Craniofacial anomalies Vascular integrity Renal atrophy/cysts Chassaing et al, J Med Genet 49: (2012) Lee et al, Mol Biol Cell 23: (2012) Lindstrand et al, Am J Hum Genet 94: (2014) cmlc2:egfp Cardiac malformations Muscular dystrophy R L R L R Hjeij et al, Am J Hum Genet. 93: (2013) L Sarparanta et al, Nat Genet 44: (2012)

8 Systematic Discovery of New Disease Genes Recruit ~50 families/year >10-20 new disease genes/year Phenotypic expansions Complex inheritance CNV dissection Opportunistic Drug Discovery

9 Vignette 1: A novel disease gene in an uncharacterized syndrome DM Proband clinical features Microcephaly Hypotonia Post axial polydactyly bilateral on the feet Severe developmental delay Strabismus Scoliosis Absent clitoris Bilateral vesicoureteral reflux Right complete ureteral duplication Proband: 6 years, 2 months at consent Ethnicity: European American Clinical testing Microarray: NPHP1 deletion (het) Referring clinician (Gallentine) Pediatric Neurology

10 Exome sequencing reveals three candidate genes DM Filter data to identify variants that are: Rare in the general population (<1%) Predicted to alter protein function Inherited from the parents or new from the child Make biological sense DM074 Final candidates Gene Inheritance/segregation Disease association NCAPG2 compound het missense na TTN compound het Cardiomyopathy, Muscular dystrophy GLRA3 de novo missense na

11 A phenotype match Clinical exome sequencing identified NCAPG2 p.t850p mutation in patient 2 Eye anomalies Limb anomalies Brain anomalies Renal/urogenital anomalies Growth defects Spinal anomalies Other anomalies DM074 Strabismus, nystagmus, pigmentary retinopathy, epiblepharon Post axial bilateral polydactyly on feet Microcephaly; dilated cerebral ventricles (prenatally) Small right kidney; kidney cysts (prenatally); vesicoureteral reflux, right complete ureteral duplication Growth failure; hormone treatments recommended Sacral dimple; tethered cord; scoliosis Absent clitoris, craniofacial anomalies DM516 Peter's anomaly, left sided coloboma, glaucoma Clinodactyly; Missing digits on feet Microcephaly History of hydronephrosis Intrauterine growth restriction; failure to thrive Sacral dimple; low lying conus medullaris (tethered cord?) Hearing loss, cardiac defects, neutropenia

12 Suppression of ncapg2 results in microcephaly... Control MO MO+WT MO+p.794 MO+p.609 MO+p.693 MO+p dpf 655 Head size (um) **** **** **** * ** ** **** * p vs MO p vs MO+WT

13 CRISPR-Cas9 editing of ncapg2 results in microcephaly... Control sgrna sgrna+cas9 3 dpf p=< p=< Head size (um) Head size (um) Control sgrna1 sgrna1+cas9

14 Vignette 2: Rare alleles that rescue rare alleles in cis Clinical features Global developmental delay microcephaly feeding issues failure to thrive abnormal muscle tone low immunoglobulins frequent respiratory infections Clinical testing normal female microarray metabolic testing negative extensive genetic testing negative BTG2: Involved in the G1/S transition of the cell cycle NOS2: Nitric oxide synthase 2, inducible TTN: Titin

15 BTG2 is the disease driver Microcephaly Neuronal expr. cell proliferation

16 Conservation of BTG2 141M in multiple species

17 Compensatory Mutations Secondary mutations that alleviate deleterious effect of primary mutations Functional wild-type protein Primary mutation (U) disrupts protein structure/function Compensatory mutation (V) restores structure/function Sayuri & Tetsuro, Frontiers in Microbiology, Vol 2, #267, 2012

18 Finding Potential Compensatory Mutations Human Protein Mutated to -A- in human disease IYKQALIFRLEGNIPESLELFQTCAVLSPQSNDNLKQVARSLFLLGIHKA --V------F----Q------P A A-----K--- --V---Q Q T-----A A-----K--- --V---Q Q---H A----I K--- --V Q Y A K N E---K--- N D N K--- N D N K--- N-----Q N Q D N K Q D N K---

19 BTG2 has two compensatory mutations Number of cells/embryo UI Ctrl Mo Mo + WT Mo + V141M *P<0.01 vs V141M rescue alone Number of cells stained with phospho Histone H3 Mo + G6R Mo + G40R Injection * * Mo + R80K Mo + Q94R Mo + S98R Mo + L128V Mo + A130T Mo + C132Y Mo + L142M Jordan, Frangakis et al, Nature 2015

20 TFNG Discovery Rate Data from 238 families Inconclusive Genes not associated with disease and unable to test functionally 12% Probably causal Known gene and known mutation Maybe causal Novel disease genes harboring candidate pathogenic alleles; no direct functional assay 16% 72% Known gene and novel functional variants Known CNV New gene with strong functional evidence

21 The Big Picture Collaboration and data sharing are key Community engagement is necessary Strong genetics and biochemistry You never know where your winners come from


23 Thank you

Evolution of Genetic Testing. Joan Pellegrino MD Associate Professor of Pediatrics SUNY Upstate Medical University

Evolution of Genetic Testing. Joan Pellegrino MD Associate Professor of Pediatrics SUNY Upstate Medical University Evolution of Genetic Testing Joan Pellegrino MD Associate Professor of Pediatrics SUNY Upstate Medical University Genetic Testing Chromosomal analysis Flourescent in situ hybridization (FISH) Chromosome

More information

UAB P30 CORE A: The Hepato-Renal Fibrocystic Diseases Translational Resource

UAB P30 CORE A: The Hepato-Renal Fibrocystic Diseases Translational Resource PKD Foundation UAB P30 CORE A: The Hepato-Renal Fibrocystic Diseases Translational Resource Director: Co-Director: Lisa M. Guay-Woodford, MD William E. Grizzle, MD, PhD

More information


SMA IS A SEVERE NEUROLOGICAL DISORDER [1] SMA OVERVIEW SMA IS A SEVERE NEUROLOGICAL DISORDER [1] Autosomal recessive genetic inheritance 1 in 50 people (approximately 6 million Americans) are carriers [2] 1 in 6,000 to 1 in 10,000 children born

More information

Neuroimaging Findings in Congenital Zika Syndrome

Neuroimaging Findings in Congenital Zika Syndrome Neuroimaging Findings in Congenital Zika Syndrome Thierry A.G.M. Huisman and Andrea Poretti Disclosure We have nothing to disclose No relevant financial relations interfering with our presentation Division

More information

Practical challenges that copy number variation and whole genome sequencing create for genetic diagnostic labs

Practical challenges that copy number variation and whole genome sequencing create for genetic diagnostic labs Practical challenges that copy number variation and whole genome sequencing create for genetic diagnostic labs Joris Vermeesch, Center for Human Genetics K.U.Leuven, Belgium ESHG June 11, 2010 When and

More information

The Genetics of VHL. Proper tissue growth - controlled traffic. How human cells and tissue grow and die?

The Genetics of VHL. Proper tissue growth - controlled traffic. How human cells and tissue grow and die? How human cells and tissue grow and die? The Genetics of VHL Xia Wang MD PhD Oct, 2017 Proper tissue growth - controlled traffic Normal tissue growth is regulated by many genetic factors Safe traffic is

More information

NIH Public Access Author Manuscript Kidney Int. Author manuscript; available in PMC 2011 September 1.

NIH Public Access Author Manuscript Kidney Int. Author manuscript; available in PMC 2011 September 1. NIH Public Access Author Manuscript Published in final edited form as: Kidney Int. 2011 March ; 79(6): 691 692. doi:10.1038/ki.2010.514. The case: Familial occurrence of retinitis pigmentosa, deafness

More information

FEP Medical Policy Manual

FEP Medical Policy Manual FEP Medical Policy Manual FEP 2.04.102 Whole Exome and Whole Genome Sequencing for Diagnosis of Genetic Disorders Effective Date: April 15, 2017 Related Policies: 2.04.59 Genetic Testing for Developmental

More information

Medical Genetics. Consult and Referral Guidelines

Medical Genetics. Consult and Referral Guidelines Medical Genetics Consult and Referral Guidelines HDVCH has developed these consult and referral guidelines as a general reference tool to assist referring physicians with the specialty referral process.

More information

Intellectual Disability Exome Panel Requisition Form

Intellectual Disability Exome Panel Requisition Form Intellectual Disability Exome Panel Requisition Form The University of Chicago Genetic Services Laboratories 5841 South Maryland Avenue, Room G701/MC0077, Chicago, IL 60637 Toll Free: 888.824.3637 Local:

More information

Identification of a novel duplication mutation in the VHL gene in a large Chinese family with Von Hippel-Lindau (VHL) syndrome

Identification of a novel duplication mutation in the VHL gene in a large Chinese family with Von Hippel-Lindau (VHL) syndrome Identification of a novel duplication mutation in the VHL gene in a large Chinese family with Von Hippel-Lindau (VHL) syndrome L.H. Cao 1, B.H. Kuang 2, C. Chen 1, C. Hu 2, Z. Sun 1, H. Chen 2, S.S. Wang

More information

Vesicoureteral Reflux (VUR) New

Vesicoureteral Reflux (VUR) New Vesicoureteral Reflux (VUR) New What is vesicoureteral reflux? Vesicoureteral reflux is the abnormal backflow of urine from the bladder into the ureter and up to the kidney. The majority of the time this

More information



More information

Functional validation of cancer susceptibility genes using gene editing

Functional validation of cancer susceptibility genes using gene editing Functional validation of cancer susceptibility genes using gene editing 2-22-2017 Sabine Topka Research Fellow Niehaus Center for Inherited Cancer Genomics Inherited Predisposition to Cancer

More information

A Deficit of ATP-ase Subunit 8: with Contribution for Two New Cases

A Deficit of ATP-ase Subunit 8: with Contribution for Two New Cases A Deficit of ATP-ase Subunit 8: with Contribution for Two New Cases Stancheva M. 1*, Radeva B. 2, Naumova E. 3, Mihailova S. 3 1 University Children s Hospital Alexandrovska, Sofia, Bulgaria 2 University

More information

Fetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management

Fetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management Fetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management 12 weeks Alfred Abuhamad, M.D. Eastern Virginia Medical School 13 weeks 2nd trimester Medullary pyramids Renal Sinus Cortex 2nd

More information

GU Ultrasound in First Trimester

GU Ultrasound in First Trimester Fetal Renal Malformations: The Role of Ultrasound in Diagnosis & Management Outline 1. Renal Anomalies Urinary Tract Dilation Aberrant Early Development Defects Terminal Maturation Alfred Abuhamad, M.D.

More information

Generating Spontaneous Copy Number Variants (CNVs) Jennifer Freeman Assistant Professor of Toxicology School of Health Sciences Purdue University

Generating Spontaneous Copy Number Variants (CNVs) Jennifer Freeman Assistant Professor of Toxicology School of Health Sciences Purdue University Role of Chemical lexposure in Generating Spontaneous Copy Number Variants (CNVs) Jennifer Freeman Assistant Professor of Toxicology School of Health Sciences Purdue University CNV Discovery Reference Genetic

More information

Indications and effectiveness of the open surgery in vesicoureteral reflux

Indications and effectiveness of the open surgery in vesicoureteral reflux Indications and effectiveness of the open surgery in vesicoureteral reflux Suzi DEMIRBAG, MD Department of Pediatric Surgery, Gulhane Military Medical Academy, Ankara, TURKEY Vesicoureteral reflux (VUR)

More information

Fatty Acid Oxidation Disorders- an update. Fiona Carragher Biochemical Sciences, GSTS Pathology St Thomas Hospital, London

Fatty Acid Oxidation Disorders- an update. Fiona Carragher Biochemical Sciences, GSTS Pathology St Thomas Hospital, London Fatty Acid Oxidation Disorders- an update Fiona Carragher Biochemical Sciences, GSTS Pathology St Thomas Hospital, London An update. Overview of metabolism Clinical presentation and outcome Diagnostic

More information

Seven cases of intellectual disability analysed by genomewide SNP analysis. Rodney J. Scott

Seven cases of intellectual disability analysed by genomewide SNP analysis. Rodney J. Scott Seven cases of intellectual disability analysed by genomewide SNP analysis Rodney J. Scott Ability to interrogate Genomic Material ~1930 Crude analyses 2012 Highly precise analyses A (very) brief history

More information



More information

Chromosome 13. Introduction

Chromosome 13. Introduction Chromosome 13 Chromosome Disorder Outreach Inc. (CDO) Technical genetic content provided by Dr. Iosif Lurie, M.D. Ph.D Medical Geneticist and CDO Medical Consultant/Advisor. Ideogram courtesy of the University

More information

Whole Exome and Whole Genome Sequencing for Diagnosis of Genetic Disorders

Whole Exome and Whole Genome Sequencing for Diagnosis of Genetic Disorders Whole Exome and Whole Genome Sequencing for Diagnosis of Genetic Disorders Policy Number: 2.04.102 Last Review: 12/2017 Origination: 12/2015 Next Review: 12/2018 Policy Blue Cross and Blue Shield of Kansas

More information

Clinical Genomics Requisition Form

Clinical Genomics Requisition Form Clinical Genomics Requisition Form Please complete every field and tick box clearly. PATIENT INFORMATION Patient s First Name Patient s Last Name Biological Sex: Male Female Unknown Gender Identity (if

More information

DiGeorge Syndrome (DGS) Registry Data Collection Form_. Patient Identification: Patient Name (first, middle, last)

DiGeorge Syndrome (DGS) Registry Data Collection Form_. Patient Identification: Patient Name (first, middle, last) Patient Identification: Patient Name (first, middle, last) Patient s USIDNET Registry Number assigned after online enrollment Date of Birth / / (mm/dd/yyyy) or Year of Birth Gender: male [ ], female [

More information

CASE REPORT. Association of a Novel Nonsense Mutation in KIAA1279 with Goldberg-Shprintzen Syndrome

CASE REPORT. Association of a Novel Nonsense Mutation in KIAA1279 with Goldberg-Shprintzen Syndrome CASE REPORT Association of a Novel Nonsense Mutation in KIAA1279 with Goldberg-Shprintzen Syndrome How to Cite This Article: Salehpour Sh, Hashemi-Gorji F, Soltani Z, Ghafouri-Fard S, Miryounesi M. Association

More information

Neonatal Hypotonia. Encephalopathy acute No encephalopathy. Neurology Chapter of IAP

Neonatal Hypotonia. Encephalopathy acute No encephalopathy. Neurology Chapter of IAP The floppy infant assumes a frog legged position. On ventral suspension, the baby can not maintain limb posture against gravity and assumes the position of a rag doll. Encephalopathy acute No encephalopathy

More information

contact info. Course coordinator can be reached at

contact info. Course coordinator can be reached at Course Outline BGEN3020 Introduction to Human Genetics Course Coordinator: Dr. David Merz Department of Biochemistry and Medical Genetics Faculty of Health Sciences Rm 324 Basic Medical Sciences Building

More information

Emerging Treatment Strategies for FSHD

Emerging Treatment Strategies for FSHD Department of Pharmacology Emerging Treatment Strategies for FSHD Peter L. Jones, Ph.D. and Takako I. Jones, Ph.D. Co-Principal Investigators Department of Pharmacology Disclosures: Peter Jones and Takako

More information

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Test Disease Population Triad Disease name Leber congenital amaurosis OMIM number for disease 204000 Disease alternative

More information

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Test Disease Population Triad Disease name Loeys-Dietz Syndrome OMIM number for disease 609192; 608967; 610380; 610168 Disease

More information

Genetic Testing for CHARGE Syndrome. Description

Genetic Testing for CHARGE Syndrome. Description Subject: Genetic Testing for CHARGE Syndrome Page: 1 of 9 Last Review Status/Date: December 2014 Genetic Testing for CHARGE Syndrome Description CHARGE syndrome is a rare genetic condition associated with

More information

Case 1 A 65 year old college professor came to the neurology clinic referred by her family physician because of frequent falling. She had a history of

Case 1 A 65 year old college professor came to the neurology clinic referred by her family physician because of frequent falling. She had a history of Peripheral Nervous System Case 1 A 65 year old college professor came to the neurology clinic referred by her family physician because of frequent falling. She had a history of non-insulin dependent diabetes

More information

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier

Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Proposal form for the evaluation of a genetic test for NHS Service Gene Dossier Test Disease Population Triad Disease name Choroideremia OMIM number for disease 303100 Disease alternative names please

More information

CONV. TYPE Unspecified pervasive developmental disorder YES NO Approx. F84.9 Pervasive developmental disorder, unspecified YES YES 307.

CONV. TYPE Unspecified pervasive developmental disorder YES NO Approx. F84.9 Pervasive developmental disorder, unspecified YES YES 307. to Conversion Table Billing Code: Billable ICD-9/ -CM code that can be used to indicate a diagnosis for reimbursement purpose Eligibility Code: ICD-9/ associated with diagnosed conditions with a high probability

More information

Pediatric Genetic Conditions


More information

Approach to the Child with Developmental Delay

Approach to the Child with Developmental Delay Approach to the Child with Developmental Delay Arwa Nasir Department of Pediatrics University of Nebraska Medical Center DISCLOSURE DECLARATION Approach to the Child with Developmental Delay Arwa Nasir

More information

Chapter 6: Genitourinary and Gastrointestinal Systems 93

Chapter 6: Genitourinary and Gastrointestinal Systems 93 Chapter 6: Genitourinary and Gastrointestinal Systems 93 Chapter 6 Genitourinary and Gastrointestinal Systems Embryology Three sets of excretory organs or kidneys develop in human embryos: Pronephros:

More information

Rare Diseases Nomenclature and classification

Rare Diseases Nomenclature and classification Rare Diseases Nomenclature and classification Annie Olry ORPHANET - Inserm US14, Paris, France Using standards and embedding good practices to promote interoperable data sharing in

More information



More information

Exercise and Type 1 Diabetes

Exercise and Type 1 Diabetes Exercise and Type 1 Diabetes QuickTime and a decompressor are needed to see this picture. 1 Characteristics of Type 1 & Type 2 Diabetes Mellitus ACE Mtng 2011 Rate of New Cases of Type 1 & Type 2 Diabetes

More information

Personalized therapeutics in diabetes

Personalized therapeutics in diabetes Personalized therapeutics in diabetes Leen M. t Hart Molecular Cell Biology & Molecular Epidemiology Leiden University Medical Center Epidemiology & Biostatistics VU University Medical Center Diabetes

More information

The Chromosomal Basis Of Inheritance

The Chromosomal Basis Of Inheritance The Chromosomal Basis Of Inheritance Chapter 15 Objectives Explain the chromosomal theory of inheritance and its discovery. Explain why sex-linked diseases are more common in human males than females.

More information

This fact sheet describes the condition Fragile X and includes a discussion of the symptoms, causes and available testing.

This fact sheet describes the condition Fragile X and includes a discussion of the symptoms, causes and available testing. 11111 Fact Sheet 54 FRAGILE X SYNDROME This fact sheet describes the condition Fragile X and includes a discussion of the symptoms, causes and available testing. In summary Fragile X is a condition caused

More information

Chapter 14 Beckwith Wiedemann Syndrome

Chapter 14 Beckwith Wiedemann Syndrome Chapter 14 Beckwith Wiedemann Syndrome Michael DeBaun and Jennifer Horst Beckwith-Wiedemann syndrome (BWS) (OMIM 130650) is a disease of prenatal overgrowth, congenital malformations, and predisposition

More information

Global variation in copy number in the human genome

Global variation in copy number in the human genome Global variation in copy number in the human genome Redon et. al. Nature 444:444-454 (2006) 12.03.2007 Tarmo Puurand Study 270 individuals (HapMap collection) Affymetrix 500K Whole Genome TilePath (WGTP)

More information

The University of Arizona Pediatric Residency Program. Primary Goals for Rotation. Genetics

The University of Arizona Pediatric Residency Program. Primary Goals for Rotation. Genetics The University of Arizona Pediatric Residency Program Primary Goals for Rotation Genetics 1. GOAL: Understand the role of the pediatrician in preventing genetic disease, and in counseling and screening

More information

When bad things happen to good genes: mutation vs. selection

When bad things happen to good genes: mutation vs. selection When bad things happen to good genes: mutation vs. selection Selection tends to increase the frequencies of alleles with higher marginal fitnesses. Does this mean that genes are perfect? No, mutation can

More information

Neuromuscular in the Pediatric Clinic: Recognition and Referral

Neuromuscular in the Pediatric Clinic: Recognition and Referral Neuromuscular in the Pediatric Clinic: Recognition and Referral Matthew Harmelink, MD Assistant Professor, Pediatric Neurology Medical College of Wisconsin Objectives: 1. Understand common presentations

More information

Case A rare case of polycarpyly in a patient with Ellis - van Creveld syndrome: plain film findings and additional value of MRI.

Case A rare case of polycarpyly in a patient with Ellis - van Creveld syndrome: plain film findings and additional value of MRI. Case 12659 A rare case of polycarpyly in a patient with Ellis - van Creveld syndrome: plain film findings and additional value of MRI. M. Mespreuve 1, 2 F. Vanhoenacker 1, 2 F. Malfait 3 D. Mortier 4 G.

More information

Spinal cord. We have extension of the pia mater below L1-L2 called filum terminale

Spinal cord. We have extension of the pia mater below L1-L2 called filum terminale Spinal cord Part of the CNS extend from foramen magnum to the level of L1-L2 (it is shorter than the vertebral column) it is covered by spinal meninges. It is cylindrical in shape. It s lower end become

More information

Asingle inherited mutant gene may be enough to

Asingle inherited mutant gene may be enough to 396 Cancer Inheritance STEVEN A. FRANK Asingle inherited mutant gene may be enough to cause a very high cancer risk. Single-mutation cases have provided much insight into the genetic basis of carcinogenesis,

More information

SPLIT NOTOCHORD SYNDROME ASSOCIATION. DR. Hasan Nugud Consultant Paediatric Surgeon

SPLIT NOTOCHORD SYNDROME ASSOCIATION. DR. Hasan Nugud Consultant Paediatric Surgeon SPLIT NOTOCHORD SYNDROME ASSOCIATION DR. Hasan Nugud Consultant Paediatric Surgeon CASE PRESENTATION :- New born baby, boy, referred to the paediatric surgical team at the age of 14 hours. Birth History

More information

Reproductive options for patients with mitochondrial DNA disease: using mitochondrial donation to prevent disease transmission

Reproductive options for patients with mitochondrial DNA disease: using mitochondrial donation to prevent disease transmission Reproductive options for patients with mitochondrial DNA disease: using mitochondrial donation to prevent disease transmission Emma Watson Newcastle NHS Highly Specialised Service for Rare Mitochondrial

More information

Autonomic Nervous System Dr. Ali Ebneshahidi

Autonomic Nervous System Dr. Ali Ebneshahidi Autonomic Nervous System Dr. Ali Ebneshahidi Nervous System Divisions of the nervous system The human nervous system consists of the central nervous System (CNS) and the Peripheral Nervous System (PNS).

More information

Cells and the Human Body Vocabulary. By: Haylei Reynolds

Cells and the Human Body Vocabulary. By: Haylei Reynolds Cells and the Human Body Vocabulary By: Haylei Reynolds Tissue Definition: A group of similar cells that are organized to do a specific job. Sentence: Skin tissue make up an organ which is skin Organ Definition:

More information

Paediatric Clinical Chemistry

Paediatric Clinical Chemistry Paediatric Clinical Chemistry Dr N Oosthuizen Dept Chemical Pathology UP 2011 Paediatric biochemistry The child is not a miniature adult Physiological development Immature organ systems Growing individual

More information

Corporate Medical Policy

Corporate Medical Policy Corporate Medical Policy File Name: Origination: Last CAP Review: Next CAP Review: Last Review: genetic_testing_for_rett_syndrome 7/2012 3/2017 3/2018 5/2017 Description of Procedure or Service Rett syndrome

More information

SMA as a Whole Body Disease: Evidence from Patients

SMA as a Whole Body Disease: Evidence from Patients SMA as a Whole Body Disease: Evidence from Patients \\ Basil T. Darras, MD Director, Neuromuscular Center and SMA Program Boston Children s Hospital Harvard Medical School Boston, MA Spinal muscular atrophy

More information

RUNX1 and FPD/AML Translational Research. The Leukemia and Lymphoma Society / Babich Family Foundation Partnership. September 2016

RUNX1 and FPD/AML Translational Research. The Leukemia and Lymphoma Society / Babich Family Foundation Partnership. September 2016 RUNX1 and FPD/AML Translational Research The Leukemia and Lymphoma Society / Babich Family Foundation Partnership September 2016 Prepared by L. Greenberger, PhD Chief Scientific

More information

Science Vocabulary. Nicole sperow

Science Vocabulary. Nicole sperow Science Vocabulary Nicole sperow Tissue definition-a group of similar cells that perform a specific job. Picture- Example-Muscle tissue sentence- Nervous tissue send signals throughout the body. organ

More information

Genetic Testing for Single-Gene and Multifactorial Conditions

Genetic Testing for Single-Gene and Multifactorial Conditions Clinical Appropriateness Guidelines Genetic Testing for Single-Gene and Multifactorial Conditions EFFECTIVE DECEMBER 1, 2017 Appropriate.Safe.Affordable 2017 AIM Specialty Health 2069-1217 Table of Contents

More information

Purpose: To discuss the fatty filum terminale which is incidentally demonstrated on MRI concerning the causes of TCS

Purpose: To discuss the fatty filum terminale which is incidentally demonstrated on MRI concerning the causes of TCS ISPUB.COM The Internet Journal of Spine Surgery Volume 3 Number 1 T Iizuka Citation T Iizuka.. The Internet Journal of Spine Surgery. 2006 Volume 3 Number 1. Abstract Background: Fatty filum terminale

More information

Pathophysiology of the Phenylketonuria

Pathophysiology of the Phenylketonuria Problem 4. Pathophysiology of the Phenylketonuria Readings for this problem are found on pages: 79-82, 84, 85-6, 945-6 and 1019 of your Pathophysiology (5 th edition) textbook. (This problem was based

More information

79 HCCs CMS-HCC Risk Adjustment Model. ICD-10-CM to CMS-HCC Crosswalk. Over 9,500 ICD-10-CM codes map to one or more.

79 HCCs CMS-HCC Risk Adjustment Model. ICD-10-CM to CMS-HCC Crosswalk. Over 9,500 ICD-10-CM codes map to one or more. 2017 CMS-HCC Risk Adjustment Model Over 9,500 ICD-10-CM codes map to one or more 79 HCCs ICD-10-CM to CMS-HCC Crosswalk CMS-HCC Model On April 4, 2016, the Centers for Medicare & Medicaid Services (CMS)

More information


AMERICAN BOARD OF MEDICAL GENETICS AND GENOMICS AMERICAN BOARD OF MEDICAL GENETICS AND GENOMICS Logbook Guidelines for Certification in Clinical Genetics and Genomics for the 2017 Examination as of 10/5/2015 Purpose: The purpose of the logbook is to

More information

Physician Guide to Pediatric Surgery

Physician Guide to Pediatric Surgery Physician Guide to Pediatric Surgery Pediatric General and Thoracic Surgery Charles G. Howell, MD (706) 721-3941 Scheduling (706) 721-3941 Consultation Professor of Surgery (Pediatric Surgery) and Pediatrics,

More information

Polarity and Segmentation. Chapter Two

Polarity and Segmentation. Chapter Two Polarity and Segmentation Chapter Two Polarization Entire body plan is polarized One end is different than the other Head vs. Tail Anterior vs. Posterior Front vs. Back Ventral vs. Dorsal Majority of neural

More information

X-Linked Congenital Bilateral Absence of Vas Deferens

X-Linked Congenital Bilateral Absence of Vas Deferens The American Journal of Human Genetics, Volume 99 Supplemental Data Truncating Mutations in the Adhesion G Protein- Coupled Receptor G2 Gene ADGRG2 Cause an X-Linked Congenital Bilateral Absence of Vas

More information

Hereditary Cardiovascular Conditions. genetic testing for undiagnosed diseases

Hereditary Cardiovascular Conditions. genetic testing for undiagnosed diseases Hereditary Cardiovascular Conditions genetic testing for undiagnosed diseases What is Hypertrophic Cardiomyopathy (HCM)? normal heart heart with hcm Extra or thick heart muscle Typically in the left ventricle

More information

Corporate Medical Policy

Corporate Medical Policy Corporate Medical Policy Genetic Testing for Marfan Syndrome, Thoracic Aortic Aneurysms and File Name: Origination: Last CAP Review: Next CAP Review: Last Review: genetic_testing_for_marfan_syndrome_thoracic_aortic_aneurysms_and_dissections_and_relat

More information

Gliomas in the 2016 WHO Classification of CNS Tumors

Gliomas in the 2016 WHO Classification of CNS Tumors Gliomas in the 2016 WHO Classification of CNS Tumors Hindi N Al-Hindi, MD, FCAP Consultant Neuropathologist and Head Section of Anatomic Pathology Department of Pathology and Laboratory Medicine King Faisal

More information

A very simplified introduction to neuromuscular illnesses (NMIs) with a particular focus on the muscular dystrophies.

A very simplified introduction to neuromuscular illnesses (NMIs) with a particular focus on the muscular dystrophies. 1 A very simplified introduction to neuromuscular illnesses (NMIs) with a particular focus on the muscular dystrophies. Available on-line at: Bill Tillier Calgary Alberta September, 2008. Terminology.

More information

Pediatric Spinal Anomalies

Pediatric Spinal Anomalies Department of Radiology University of California San Diego Pediatric Spinal Anomalies John R. Hesselink, M.D. Spine Embryogenesis 1. Primitive streak 2. Proliferation of cells at primitive pit (Hensen's

More information

Neurofibromatosis (NF) Center

Neurofibromatosis (NF) Center Washington University Neurofibromatosis (NF) Center THE NF CENTER: EXCEPTIONAL CARE THROUGH GROUNDBREAKING RESEARCH An international leader in research and treatment of neurofibromatosis (NF), the Washington

More information

Spectrum of Cranio-facial anomalies during 2 Ultrasound. trimester on

Spectrum of Cranio-facial anomalies during 2 Ultrasound. trimester on Spectrum of Cranio-facial anomalies during 2 Ultrasound nd trimester on Poster No.: C-0378 Congress: ECR 2015 Type: Scientific Exhibit Authors: K. Dave, S. Solanki; Ahmedabad/IN Keywords: Obstetrics (Pregnancy

More information

Tumor responses (patients responding/ patients treated)

Tumor responses (patients responding/ patients treated) Table 1. ACT clinical trial tumor responses and toxicities. a Target antigen Cancer(s) Receptor type Tumor responses (patients responding/ patients treated) Immune-mediated toxicities (patients experiencing

More information

Neonatology ICD-10 documentation

Neonatology ICD-10 documentation Neonatology documentation Seven key impacts to documentation 1. Disease or disorder site 2. Acuity and/or encounter status of treatment 3. Etiology, causative agent, or disease type and injury/ poisoning

More information