Supporting Information

Size: px
Start display at page:

Download "Supporting Information"

Transcription

1 Supporting Information Rock et al /pnas Fig. S1. Heterogeneity of stromal cells in normal and fibrotic mouse lungs. Sections of normal mouse lungs (A and D) and fibrotic lungs collected (B and E) 14 or (C and F) 21 d after the intratracheal administration of 1.25 U/kg bleomycin were stained with antibodies against stromal cell markers. One marker (noted in parentheses) is omitted from high-magnification Insets for clarity. Representative images from confocal stacks from three mice are shown for each treatment. (A C) Vimentin (red), S100a4 (green), and asma (purple). (A) Note that asma-positive cells are not present within the interstitium of control lungs, and asmapositive myofibroblasts are more abundant at (B) 14 than (C) 21 d postbleomycin. (D F) asma (red), NG2 (green), and Pdgfrb (purple). NG2-positive, Pdgfrbpositive pericyte-like cells, abundant within the interstitium of control and fibrotic lungs, do not express asma. Dashed boxed region of each image is shown at higher magnification in Insets. (Scale bars: A and D, 50 μm; Insets, 20 μm.) 1of6

2 Fig. S2. Heterogeneity of stromal cells in UIP/IPF. Frozen sections of normal lung or UIP were stained with hematoxylin and eosin or antibodies against asma and NG2. Representative images are shown. (A) Some perivascular cells in normal lungs express both NG2 (red) and asma (green). A population of interstitial pericytes expresses NG2 but not asma. (A ) H&E stained section adjacent to the section shown in A. (A ) Red and green channels and (A ) red channel only from the boxed region in A. (B) Representative image of NG2 (red) and asma (green) in a fibrotic lung. Some cells, usually associated with vasculature, express both markers. (B ) H&E stained section adjacent to section shown in B. Note that cells within classic fibroblast foci (arrow) do not express high levels of NG2 or asma. (C) NG2 (red) and asma (green) in a fibrotic lung from Imaris colocalization analysis. (C ) Voxels demonstrating colocalization (white). The numeric value is the percentage of NG2 positive volume above the threshold (% red voxels) that is colocalized with asma (green) above the threshold. Most colocalization in control and fibrotic lungs is in cells associated with vasculature. Scale bars: A and B, 200 μm; A and A, 50μm; C and C, 100 μm. Fig. S3. FoxJ1-CreER labels pericyte-like cells that expand in fibrotic regions. FoxJ1-CreER;ROSA-farnesylated GFP (fgfp) double heterozygous mice were given four doses of tamoxifen followed 4 d later by intratracheal (A and B) salineor(c and D) 5 U/kg bleomycin. (A and B) FoxJ1-CreER labels asma-positive, NG2- positive perivascular cells as well as asma-negative, NG2-positive pericyte-like interstitial cells. (C and D) After bleomycin, FoxJ1-CreER lineage-labeled pericytelike cells expand and make up a large proportion of cells in fibrotic regions. These regions remain NG2-positive, and most lineage-labeled cells do not express high levels of asma. Images shown are maximum projections (merged images) of optical sections through the tissue thickness. (Scale bars: 50 μm.) 2of6

3 Fig. S4. Resident fibroblasts proliferate in response to bleomycin. (A) A Pdgfra-H2B:GFP knock-in allele reports expression of Pdgfra in some asma-positive peribronchiolar and perivascular smooth muscle cells and (C) Pdgfrb-positive stromal cells near airways and vessels. (A C) Interstitial Pdgfra-H2B:GFP-positive interstitial fibroblasts do not express Pdgfrb or asma. (D) Pdgfra-H2B:GFP heterozygotes were given 1.25 U/kg intratracheal bleomycin. BrdU was administered 3 h before animals were killed for histology 6 d later. Sections were stained with antibodies against BrdU (red, proliferative cells) and GFP. Arrows show Pdgfra- H2B:GFP-positive cells that have incorporated BrdU. br, bronchiole; bv, blood vessel; ven, venule. (Scale bars: A D, 50μm.) Fig. S5. The proportion of Sftpc-CreERT2 lineage-labeled type 2 alveolar epithelial cells (AEC2) cells is decreased in fibrotic regions. Adult SftpcCreER T2 ;ROSA- Tomato mice were given four doses of tamoxifen to label AEC2 followed 4 d later with 1.25 U/kg intratracheal bleomycin. After 21 d, we imaged endogenous Tomato lineage label and immunofluorescence against Sftpc (green, AEC2 cells). Note that many Sftpc-positive cells are not lineage labeled, especially in fibrotic regions, suggesting that they are derived from an unlabeled progenitor. (Scale bar: 100 μm.) 3of6

4 Fig. S6. AEC2 cells do not directly contribute to pulmonary fibrosis by epithelial to mesenchymal transition (EMT). Sftpc-CreER T2 ;ROSA-Tomato double heterozygous mice were given four doses of tamoxifen followed 4 10 d later with 1.25 U/kg intratracheal bleomycin. After (A and C) 10, (B) 14, or (D) 21d,we imaged endogenous Tomato lineage label and immunofluorescence against (A and B) vimentin (green) and asma (purple) or (C and D) S100a4 (green). Note that more asma-positive cells are present within fibrotic regions at 10 and 14 d postbleomycin than at 21 d postbleomycin (Fig. 1 and Fig. S1). Similarly, many more S100a4-positive cells, with morphology and distribution consistent with immune cells, are present within fibrotic regions (C) 10 d postbleomycin compared with (D) 21 d postbleomycin. The Tomato lineage label never colocalizes with markers of stromal cells. Dashed boxed regions in A and B are shown at higher magnification in Insets. C Inset shows Tomato and S100a4 staining in another region of the lung at higher magnification and without DAPI for clarity. (Scale bars: A, B, and C Inset, 50μm; A and B Insets, 20μm; C and D, 200μm.) 4of6

5 Fig. S7. Colocalization analysis of Tomato lineage label with stromal cell markers. Confocal stacks were analyzed with Imaris software to quantify the colocalization of Tomato (red, Sftpc lineage label) with (A) S100a4, (B) vimentin, (C) asma, and (D) Sftpc as a positive control. Images were acquired on a Zeiss 710 confocal microscope (A and B) 21 d postbleomycin, (C) 10 d postbleomycin, or (D) 21 d postsaline. Voxels (i.e., volumetric pixels) showing colocalization (white) are shown in A D. The numeric value is the percentage of red voxels that colocalize with green voxels. Note that this numeric value does not represent the percentage of red cells that colocalize with green cells. The areas of colocalization are typically observed to occur at the interface between red cells and neighboring green cells, an interface that the software cannot clearly distinguish given limitations of image resolution. (Scale bars: A and B, 20μm; C and D, 40 μm.) This analysis shows that 62.6% of Tomato-positive voxels are also Sftpc-positive. However, only 1.15%, 0.94%, and 0.56% of Tomato-positive voxels express S100a4, vimentin, or asma, respectively. Table S1. Patient data for biopsy sample donors Pathological diagnosis Clinical diagnosis Sex Age (y) Smoking history UIP IPF Male 66 Never UIP RA-ILD Male 48 Former UIP? CTD Male 54 Former UIP IPF Male 68 Former UIP RA-ILD Female 59 Never UIP IPF Male 64 Former UIP? CTD Male 61 Former UIP IPF Male 75 Never CTD, connective tissue disease related; IPF, idiopathic pulmonary fibrosis, RA-ILD, rheumatoid arthritis-associated interstitial lung disease; UIP, usual interstitial pneumonia. 5of6

6 Table S2. Primers used for quantitative PCR Gene Forward Reverse Gapdh 5 -AGGTCGGTGTGAACGGATTTG-3 5 -TGTAGACCATGTAGTTGAGGTCA-3 Tbp 5 -AGAACAATCCAGACTAGCAGCA-3 5 -GGGAACTTCACATCACAGCTC-3 Sftpc 5 -CAAACGCCTTCTCATCGTGGTTGT-3 5 -TTTCTGAGTTTCCGGTGCTCCGAT-3 Pdpn 5 -ACCGTGCCAGTGTTGTTCTG-3 5 -AGCACCTGTGGTTGTTATTTTGT-3 asma 5 -ATTGTGCTGGACTCTGGAGATGGT-3 5 -TGATGTCACGGACAATCTCACGCT-3 Col1a1 5 -GCTCCTCTTAGGGGCCACT-3 5 -ATTGGGGACCCTTAGGCCAT-3 Vimentin 5 -CGGCTGCGAGAGAAATTGC-3 5 -CCACTTTCCGTTCAAGGTCAAG-3 Versican 5 -TTTTACCCGAGTTACCAGACTCA-3 5 -GGAGTAGTTGTTACATCCGTTGC-3 S100a4 5 -TGAGCAACTTGGACAGCAACA-3 5 -CTTCTTCCGGGGCTCCTTATC-3 NG2 5 -ACCATGCTACTCCGCAACAG-3 5 -CCGGTGAACATCTATGTGTACG-3 6of6

Type 2 alveolar cells are stem cells in adult lung

Type 2 alveolar cells are stem cells in adult lung Type 2 alveolar cells are stem cells in adult lung Christina E. Barkauskas,, Paul W. Noble, Brigid L.M. Hogan J Clin Invest. 2013;123(7):3025-3036. https://doi.org/10.1172/jci68782. Research Article Pulmonology

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

COI: no conflicts of interest to declare

COI: no conflicts of interest to declare Idiopathic versus secondary Usual Interstitial Pneumonia (UIP) pattern in a series of 96 consecutive surgical lung biopsies: The value of histologic ancillary findings in a multidisciplinary discussion

More information

Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse

Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic

More information

Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or

Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette

More information

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1 PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:

More information

11/10/2014. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. Radiology

11/10/2014. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. Radiology Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective Radiology Pathology Clinical 1 Role of HRCT Diagnosis Fibrosis vs. inflammation Next step in management Response to treatment

More information

Case 4 History. 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar

Case 4 History. 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar Case 4 History 58 yo man presented with prox IP joint swelling 2 months later pain and swelling in multiple joints Chest radiograph: bi-basilar basilar infiltrates suggestive of pulmonary fibrosis Open

More information

Supplementary Information

Supplementary Information Supplementary Information Title Degeneration and impaired regeneration of gray matter oligodendrocytes in amyotrophic lateral sclerosis Authors Shin H. Kang, Ying Li, Masahiro Fukaya, Ileana Lorenzini,

More information

CTD-related Lung Disease

CTD-related Lung Disease 13 th Cambridge Chest Meeting King s College, Cambridge April 2015 Imaging of CTD-related Lung Disease Dr Sujal R Desai King s College Hospital, London Disclosure Statement No Disclosures / Conflicts of

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β

More information

5/9/2015. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. No, I am not a pulmonologist! Radiology

5/9/2015. Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective. No, I am not a pulmonologist! Radiology Multi-disciplinary Approach to Diffuse Lung Disease: The Imager s Perspective No, I am not a pulmonologist! Radiology Pathology Clinical 1 Everyone needs a CT Confidence in diagnosis Definitive HRCT +

More information

Specimen. Humeral Head. Femoral Head. Objective. Femoral Condyle (medial) Supplementary Figure 1

Specimen. Humeral Head. Femoral Head. Objective. Femoral Condyle (medial) Supplementary Figure 1 A B Specimen Humeral Head 2 1 µm 76 µm Femoral Head Objective Femoral Condyle (medial) Supplementary Figure 1 A Femoral Head Global Cell Density Superficial Cell Density Cell Number at 1 µm Nuclei /.1

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2697 Figure S1 Cytokeratin 5 is a specific marker for basal and intermediate cells in all mouse prostate lobes. (a) Immunofluorescence staining showing co-localization of YFP with p63 in

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2610 Figure S1 FSMCs derived from MSLN CLN transgenic mice express smooth muscle-specific proteins. Beta-galactosidase is ubiquitously expressed within cultured FSMCs derived from MSLN

More information

Fig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4

Fig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4 Fig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4 (n=3 independent differentiation experiments for each

More information

Overview of Idiopathic Pulmonary Fibrosis: Diagnosis and Therapy

Overview of Idiopathic Pulmonary Fibrosis: Diagnosis and Therapy Overview of Idiopathic Pulmonary Fibrosis: Diagnosis and Therapy Jeff Swigris, DO, MS Director, ILD Program National Jewish Health Disclosures Speaker - Boehringer Ingelheim and Genentech Objectives Describe

More information

Histopathologic Approach to Interstitial Lung Disease

Histopathologic Approach to Interstitial Lung Disease Histopathologic Approach to Interstitial Lung Disease Kirk D. Jones, MD UCSF Dept of Pathology kirk.jones@ucsf.edu Disclosures I have nothing to disclose 1 Why? Much of interstitial lung disease biopsies

More information

Moore-Morris et al. Supplemental Table 1.

Moore-Morris et al. Supplemental Table 1. Moore-Morris et al. Supplemental Table. In vivo echocardiographic assessment of cardiac size and function following transaortic constriction (T) at 7d and 8d. SHM 7d N=6 T 7d N=5 SHM 8d N= T 8d N=6 W,

More information

Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia. Nitra and the Gangs.

Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia. Nitra and the Gangs. Usual Interstitial pneumonia and Nonspecific Interstitial Pneumonia Nitra and the Gangs. บทน ำและบทท ๓, ๑๐, ๑๒, ๑๓, ๑๔, ๑๕, ๑๗ Usual Interstitial Pneumonia (UIP) Most common & basic pathologic pattern

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10188 Supplementary Figure 1. Embryonic epicardial genes are down-regulated from midgestation stages and barely detectable post-natally. Real time qrt-pcr revealed a significant down-regulation

More information

Hsp90 regulation of fibroblast activation in pulmonary fibrosis

Hsp90 regulation of fibroblast activation in pulmonary fibrosis Downloaded from http:// on January 22, 2018. Hsp90 regulation of fibroblast activation in pulmonary fibrosis Vishwaraj Sontake, 1,4 Yunguan Wang, 2 Rajesh K. Kasam, 1,4 Debora Sinner, 3 Geereddy B. Reddy,

More information

Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections

Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast

More information

Supplementary Figure 1. Nature Neuroscience: doi: /nn.4547

Supplementary Figure 1. Nature Neuroscience: doi: /nn.4547 Supplementary Figure 1 Characterization of the Microfetti mouse model. (a) Gating strategy for 8-color flow analysis of peripheral Ly-6C + monocytes from Microfetti mice 5-7 days after TAM treatment. Living

More information

NONE OVERVIEW FINANCIAL DISCLOSURES UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF (UIP) FOR PATHOLOGISTS. IPF = Idiopathic UIP Radiologic UIP Path UIP

NONE OVERVIEW FINANCIAL DISCLOSURES UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF (UIP) FOR PATHOLOGISTS. IPF = Idiopathic UIP Radiologic UIP Path UIP UPDATE ON IDIOPATHIC PULMONARY FIBROSIS/IPF () FOR PATHOLOGISTS Thomas V. Colby, M.D. Professor of Pathology (Emeritus) Mayo Clinic Arizona FINANCIAL DISCLOSURES NONE OVERVIEW IPF Radiologic Dx Pathologic

More information

Macrophages form functional vascular mimicry channels in vivo. SI Figures and Legend

Macrophages form functional vascular mimicry channels in vivo. SI Figures and Legend Macrophages form functional vascular mimicry channels in vivo Authors: *Faith H. Barnett, *Mauricio Rosenfeld, Malcolm Wood, William Kiosses, Yoshihiko Usui, Valentina Marchetti, Edith Aguilar, and Martin

More information

label the basement membrane). Different fixation methods of EB-perfused P8 mice to optimize the combination

label the basement membrane). Different fixation methods of EB-perfused P8 mice to optimize the combination Supplementary Figure 1 Optimization of the tissue fixation protocol to combine EB perfusion and IB4 endothelial tip cell staining in the postnatal mouse brain. a-l Labeling of EB-perfused P8 mice with

More information

Conditional Depletion of Airway Progenitor Cells Induces Peribronchiolar Fibrosis

Conditional Depletion of Airway Progenitor Cells Induces Peribronchiolar Fibrosis Conditional Depletion of Airway Progenitor Cells Induces Peribronchiolar Fibrosis Anne-Karina T. Perl 1, Dieter Riethmacher 2, and Jeffrey A. Whitsett 1 1 Division of Pulmonary Biology, Perinatal Institute,

More information

Santulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function

Santulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function ONLINE DATA SUPPLEMENTS Santulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function Supplementary Figures Figure S1 Effect of Ad-p27-126TS on the expression

More information

Immunological Lung Diseases

Immunological Lung Diseases Emphysema and Fibrosis Universitätsklinik für Pneumologie Prof. Thomas Geiser Head Div. of Pulmonary Medicine and Laboratory of Lung Research, MU50 thomas.geiser@insel.ch The healthy lung: The pathway

More information

Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at

Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).

More information

Ganesh Raghu, MD. Professor of Medicine and Laboratory Medicine (Adjunct) University of Washington, Seattle, WA, USA

Ganesh Raghu, MD. Professor of Medicine and Laboratory Medicine (Adjunct) University of Washington, Seattle, WA, USA Ganesh Raghu, MD. Professor of Medicine and Laboratory Medicine (Adjunct) University of Washington, Seattle, WA, USA Director, Interstitial Lung Disease, Sarcoid and Pulmonary Fibrosis Program Medical

More information

PREPARED FOR: U.S. Army Medical Research and Materiel Command Fort Detrick, Maryland

PREPARED FOR: U.S. Army Medical Research and Materiel Command Fort Detrick, Maryland AWARD NUMBER: W81XWH-13-1-0184 TITLE: In Vivo Tagging of Lung Epithelial Cells To Define the Early Steps of Tumor Cell Dissemination PRINCIPAL INVESTIGATOR: Hasmeena Kathuria, MD CONTRACTING ORGANIZATION:

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

CD4 and CD8 T cells show a similar accumulation in the tumor stroma.

CD4 and CD8 T cells show a similar accumulation in the tumor stroma. Fig S1 CD4 Fibronectin EpCM CD8 CD4 and CD8 T cells show a similar accumulation in the tumor stroma. Fluorescently-labeled CD4 (CMFD, green) and CD8 (Hoechst, yellow) T cells were added to a human lung

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/3/8/e1700521/dc1 Supplementary Materials for Functional vascularized lung grafts for lung bioengineering N. Valerio Dorrello, Brandon A. Guenthart, John D. O Neill,

More information

Inhibition of DYRK1A stimulates human beta-cell proliferation

Inhibition of DYRK1A stimulates human beta-cell proliferation Inhibition of DYRK1A stimulates human beta-cell proliferation Ercument Dirice 1,, Deepika Walpita 2,, Amedeo Vetere 2, Bennett C. Meier 2,5, Sevim Kahraman 1, Jiang Hu 1, Vlado Dančík 2, Sean M. Burns

More information

SHREE ET AL, SUPPLEMENTAL MATERIALS. (A) Workflow for tumor cell line derivation and orthotopic implantation.

SHREE ET AL, SUPPLEMENTAL MATERIALS. (A) Workflow for tumor cell line derivation and orthotopic implantation. SHREE ET AL, SUPPLEMENTAL MATERIALS SUPPLEMENTAL FIGURE AND TABLE LEGENDS Supplemental Figure 1. Derivation and characterization of TS1-TGL and TS2-TGL PyMT cell lines and development of an orthotopic

More information

Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition.

Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. Manuscript EMBO-2012-82682 Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. David Balli, Vladimir Ustiyan, Yufang Zhang, I-Ching Wang, Alex J. Masino,

More information

Restrictive lung diseases

Restrictive lung diseases Restrictive lung diseases Restrictive lung diseases are diseases that affect the interstitium of the lung. Interstitium of the lung is the very thin walls surrounding the alveoli, it s formed of epithelium

More information

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with

More information

Atg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1

Atg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1 Takamura_Fig. S1 brain heart lung spleen stomach colon kidney SM Supplemental Figure 1 Histological findings of tg5 flox/flox ;CG-Cre mouse tissues. H&E staining of the brain, heart, lung, spleen, stomach,

More information

Endogenous TNFα orchestrates the trafficking of neutrophils into and within lymphatic vessels during acute inflammation

Endogenous TNFα orchestrates the trafficking of neutrophils into and within lymphatic vessels during acute inflammation SUPPLEMENTARY INFORMATION Endogenous TNFα orchestrates the trafficking of neutrophils into and within lymphatic vessels during acute inflammation Samantha Arokiasamy 1,2, Christian Zakian 1, Jessica Dilliway

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

SOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al.

SOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al. s1 A Pten flox/flox () SOPten flox/flox () flox allele 6. kb B Pten flox/flox () SOPten flox/flox () Pten Actin! allele 2.3 kb Supplementary Figure S1. Yanagi, et al. A B BrdU BrdU positive cells ( ) 3

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein

More information

Non-neoplastic Lung Disease II

Non-neoplastic Lung Disease II Pathobasic Non-neoplastic Lung Disease II Spasenija Savic Prince Pathology Program Systematic approach to surgical lung biopsies with ILD Examples (chronic ILD): Idiopathic interstitial pneumonias: UIP,

More information

Supplementary Figure 1: Expression of Gli1-lacZ in E17.5 ovary and mesonephros. a,

Supplementary Figure 1: Expression of Gli1-lacZ in E17.5 ovary and mesonephros. a, Supplementary Figure 1: Expression of Gli1-lacZ in E17.5 ovary and mesonephros. a, Transverse sections of E17.5 ovary and mesonephros from Gli1-LacZ reporter embryos (n=3) after LacZ staining (blue). The

More information

Supplemental Table S1

Supplemental Table S1 Supplemental Table S. Tumorigenicity and metastatic potential of 44SQ cell subpopulations a Tumorigenicity b Average tumor volume (mm ) c Lung metastasis d CD high /4 8. 8/ CD low /4 6./ a Mice were injected

More information

Disclosures. Fibrotic lung diseases: Basic Principles, Common Problems, and Reporting. Relevant financial relationships: None. Off-label usage: None

Disclosures. Fibrotic lung diseases: Basic Principles, Common Problems, and Reporting. Relevant financial relationships: None. Off-label usage: None Fibrotic lung diseases: Basic Principles, Common Problems, and Reporting Brandon T. Larsen, MD, PhD Senior Associate Consultant Department of Laboratory Medicine and Pathology Mayo Clinic Arizona Arizona

More information

Supplemental Figure 1: Leydig cells are reduced at multiple stages in both male sterile mutants

Supplemental Figure 1: Leydig cells are reduced at multiple stages in both male sterile mutants SUPPLEMENTAL FIGURE LEGENDS: Supplemental Figure 1: Leydig cells are reduced at multiple stages in both male sterile mutants (Sgpl1 -/- and Plekha1 -/- ). Using an antibody against CYP11a1 to label Leydig

More information

Supplementary Materials for

Supplementary Materials for www.sciencetranslationalmedicine.org/cgi/content/full/4/117/117ra8/dc1 Supplementary Materials for Notch4 Normalization Reduces Blood Vessel Size in Arteriovenous Malformations Patrick A. Murphy, Tyson

More information

Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC

Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA

More information

Acute and Chronic Lung Disease

Acute and Chronic Lung Disease KATHOLIEKE UNIVERSITEIT LEUVEN Faculty of Medicine Acute and Chronic Lung Disease W De Wever, JA Verschakelen Department of Radiology, University Hospitals Leuven, Belgium Clinical utility of HRCT To detect

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION b 350 300 250 200 150 100 50 0 E0 E10 E50 E0 E10 E50 E0 E10 E50 E0 E10 E50 Number of organoids per well 350 300 250 200 150 100 50 0 R0 R50 R100 R500 1st 2nd 3rd Noggin 100 ng/ml Noggin 10 ng/ml Noggin

More information

Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin

Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin sections from sham-operated adult hearts (a and i) and

More information

Financial disclosure COMMON DIAGNOSES IN HRCT. High Res Chest HRCT. HRCT Pre test. I have no financial relationships to disclose. Anatomy Nomenclature

Financial disclosure COMMON DIAGNOSES IN HRCT. High Res Chest HRCT. HRCT Pre test. I have no financial relationships to disclose. Anatomy Nomenclature Financial disclosure I have no financial relationships to disclose. Douglas Johnson D.O. Cardiothoracic Imaging Gaston Radiology COMMON DIAGNOSES IN HRCT High Res Chest Anatomy Nomenclature HRCT Sampling

More information

Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted

Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted Ctns -/- mice. Cells immunolabeled for the proliferation marker (Ki-67) were counted in sections (n=3 WT, n=4

More information

Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )

Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) 770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG

More information

SUPPLEMENTARY FIGURES AND TABLE

SUPPLEMENTARY FIGURES AND TABLE SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).

More information

Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is

Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is not co-expressed in DCLK1-positive tuft cells. Scale

More information

Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis

Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis Hong Xia,, Peter B. Bitterman, Craig A. Henke J Clin Invest. 2017;127(7):2586-2597. https://doi.org/10.1172/jci90832.

More information

Differential diagnosis

Differential diagnosis Differential diagnosis Idiopathic pulmonary fibrosis (IPF) is part of a large family of idiopathic interstitial pneumonias (IIP), one of four subgroups of interstitial lung disease (ILD). Differential

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±

More information

Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses

Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses using an anti-cre antibody; testes at 1 week (left panel),

More information

Pulmonary manifestations of CTDs Diagnosis, differential diagnosis and treatment

Pulmonary manifestations of CTDs Diagnosis, differential diagnosis and treatment Prague, June 2014 Pulmonary manifestations of CTDs Diagnosis, differential diagnosis and treatment Katerina M. Antoniou, MD, PhD As. Professor in Thoracic Medicine ERS ILD Group Secretary Medical School,

More information

activation with anti-cd3/cd28 beads and 3d following transduction. Supplemental Figure 2 shows

activation with anti-cd3/cd28 beads and 3d following transduction. Supplemental Figure 2 shows Supplemental Data Supplemental Figure 1 compares CXCR4 expression in untreated CD8 + T cells, following activation with anti-cd3/cd28 beads and 3d following transduction. Supplemental Figure 2 shows the

More information

Impact of Sox9 Dosage and Hes1-mediated Notch Signaling in Controlling the Plasticity of Adult Pancreatic Duct Cells in Mice

Impact of Sox9 Dosage and Hes1-mediated Notch Signaling in Controlling the Plasticity of Adult Pancreatic Duct Cells in Mice Impact of Sox9 Dosage and Hes1-mediated Notch Signaling in Controlling the Plasticity of Adult Pancreatic Duct Cells in Mice Shinichi Hosokawa 1,3,Kenichiro Furuyama 1,3, Masashi Horiguchi 1,3,Yoshiki

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

In Vivo Models and Cell Delivery for Lung Indications NO DISCLOSURES

In Vivo Models and Cell Delivery for Lung Indications NO DISCLOSURES In Vivo Models and Cell Delivery for Lung Indications Marlowe Eldridge MD Department of Pediatrics and Biomedical Engineering University of Wisconsin School of Medicine and Public Health NO DISCLOSURES

More information

Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from

Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from germ cell mutants (dnrar flox/flox, Stra8-Cre +, RARElacZ) (A ), controls (dnrar flox/flox, RARElacZ) (B ),

More information

SUPPLEMENTARY FIG. S2. Representative counting fields used in quantification of the in vitro neural differentiation of pattern of dnscs.

SUPPLEMENTARY FIG. S2. Representative counting fields used in quantification of the in vitro neural differentiation of pattern of dnscs. Supplementary Data SUPPLEMENTARY FIG. S1. Representative counting fields used in quantification of the in vitro neural differentiation of pattern of anpcs. A panel of lineage-specific markers were used

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged

More information

McWilliams et al., http :// /cgi /content /full /jcb /DC1

McWilliams et al., http ://  /cgi /content /full /jcb /DC1 Supplemental material JCB McWilliams et al., http ://www.jcb.org /cgi /content /full /jcb.201603039 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. In vitro characterization of mito-qc. (A and B) Analysis

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm

More information

Definition, classification and epidemiology

Definition, classification and epidemiology Interstitial Lung Diseases Definition, classification and epidemiology Haluk Türktaş Professor of Pulmonary Medicine Gazi University Ankara Interstitial Lung Diseases Definition of ILD A diverse group

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2638 Figure S1 Morphological characteristics of fetal testes and ovaries from 6.5-20 developmental weeks. Representative images of Hematoxylin and Eosin staining of testes and ovaries over

More information

Supporting Information. Calculation of the relative contributions of myocyte proliferation, stem cell. Supporting Information Fig 1 (page 9)

Supporting Information. Calculation of the relative contributions of myocyte proliferation, stem cell. Supporting Information Fig 1 (page 9) Supporting Information Table of contents Calculation of the relative contributions of myocyte proliferation, stem cell differentiation and cardioprotection (page 2) Supporting Information Fig 1 (page 9)

More information

CLARITY reveals dynamics of ovarian follicular architecture and vasculature in three-dimensions

CLARITY reveals dynamics of ovarian follicular architecture and vasculature in three-dimensions CLARITY reveals dynamics of ovarian follicular architecture and vasculature in three-dimensions Yi Feng, Peng Cui, Xiaowei Lu, Brian Hsueh, Fredrik Möller Billig, Livia Zarnescu Yanez, Raju Tomer, Derek

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Suppl. Fig. 1 in vivo expression of ISL1 in the human fetal heart. a, Hematoxylin eosin staining showing structures of left atrium and left atrium appendage (*) of a human fetal heart at 11 weeks of gestation.

More information

Supplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome

Supplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome Page 1 Supplemental Data Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in Hermansky-Pudlak Syndrome Lisa R. Young, Peter M. Gulleman, Chelsi W. Short, Harikrishna Tanjore,

More information

Myofibroblasts and S-100 protein positive cells in idiopathic pulmonary fibrosis and rheumatoid arthritis-associated interstitial pneumonia

Myofibroblasts and S-100 protein positive cells in idiopathic pulmonary fibrosis and rheumatoid arthritis-associated interstitial pneumonia Eur Respir J 1999; 14: 579±584 Printed in UK ± all rights reserved Copyright #ERS Journals Ltd 1999 European Respiratory Journal ISSN 0903-1936 Myofibroblasts and S-100 protein positive cells in idiopathic

More information

Epidemiology and classification of smoking related interstitial lung diseases

Epidemiology and classification of smoking related interstitial lung diseases Epidemiology and classification of smoking related interstitial lung diseases Šterclová M. Department of Respiratory Diseases, Thomayer Hospital, Prague, Czech Republic Supported by an IGA Grant No G 1207

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Genetic labeling of microglia Male and female 2-3 month-old CreERT2;R26-tdTomato mice or CreERT2;R26-tdTomato;Iba1-eGFP transgenic mice were treated with 1x, 2x (48 h apart), or

More information

Unpaid scientific collaborator & advisor with Veracyte, Inc.

Unpaid scientific collaborator & advisor with Veracyte, Inc. Diagnosis and Classification of Idiopathic Interstitial Pneumonias: Role of Histopathology in the Golden Age of Consensus Jeffrey L. Myers, M.D. A. James French Professor of Diagnostic Pathology Vice Chair

More information

Supplementary Information

Supplementary Information Nature Immunology doi:1.138/ni.2477 Supplementary Information Capillary and arteriolar pericytes attract innate leukocytes exiting through venules and instruct them with pattern recognition and motility

More information

NOTICE OF SUBSTANTIAL AMENDMENT

NOTICE OF SUBSTANTIAL AMENDMENT NOTICE OF SUBSTANTIAL AMENDMENT For use in the case of all research other than clinical trials of investigational medicinal products (CTIMPs). For substantial amendments to CTIMPs, please use the EU-approved

More information

SUPPLEMENTAL INFORMATION FOR. PAX7 expression defines germline stem cells in the adult testis

SUPPLEMENTAL INFORMATION FOR. PAX7 expression defines germline stem cells in the adult testis SUPPLEMENTAL INFORMATION FOR PAX7 expression defines germline stem cells in the adult testis Gina M. Aloisio, Yuji Nakada, Hatice D. Saatcioglu, Christopher G. Peña, Michael D. Baker, Edward D. Tarnawa,

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces

More information

Ahtiainen et al., http :// /cgi /content /full /jcb /DC1

Ahtiainen et al., http ://  /cgi /content /full /jcb /DC1 Supplemental material JCB Ahtiainen et al., http ://www.jcb.org /cgi /content /full /jcb.201512074 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. Distinct distribution of different cell cycle phases in the

More information

DC were seeded into tissue culture dishes in IMDM 2% FCS, and added with PMN. (1:1; PMN: DC) for 16h also in the presence of DNAse (100 U/ml); DC were

DC were seeded into tissue culture dishes in IMDM 2% FCS, and added with PMN. (1:1; PMN: DC) for 16h also in the presence of DNAse (100 U/ml); DC were Supplementary methods Flow cytometric analysis of DCs. DC were seeded into tissue culture dishes in IMDM 2% FCS, and added with PMN (1:1; PMN: DC) for 16h also in the presence of DNAse (100 U/ml); DC were

More information

Supplemental Table S1. Primers used in qrt-pcr analyses. Supplemental Figure S1, related to Figure 4. Extracellular matrix proteins

Supplemental Table S1. Primers used in qrt-pcr analyses. Supplemental Figure S1, related to Figure 4. Extracellular matrix proteins Supplemental Material PDGFRb regulates craniofacial development through homodimers and functional heterodimers with PDGFRa Katherine A. Fantauzzo and Philippe Soriano Supplemental materials provided: Supplemental

More information

Real-time imaging reveals the single steps of brain metastasis fo mation r

Real-time imaging reveals the single steps of brain metastasis fo mation r Real-time imaging reveals the single steps of brain metastasis fo mation r Yvonne Kienast, Louisa von Baumgarten, Martin Fuhrmann, Wolfgang E.F. Klinkert, Roland Goldbrunner, Jochen Herms and Frank Winkler

More information

Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W

Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W A Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 Tcf21 MCM ; R26 mtmg TAC 2W Tcf21 MCM ; R26 mtmg TAC 8W B Postn MCM ; R26 mtmg Sham GFP Col 1/3 Postn MCM ; R26 mtmg TAC 2W Postn MCM ; R26 mtmg TAC 8W Supplementary

More information

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.

More information

Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow

Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow Primary Cilia are Expressed on a Small Fraction of Cells in Trabecular Bone and Marrow Thomas R. Coughlin 1, Muriel Voisin, Ph.D. 2, Glen L. Niebur, PhD 1, Laoise M. McNamara 2. 1 University of Notre Dame,

More information

Interstitial Lung Disease

Interstitial Lung Disease Interstitial Lung Disease Interstitial lung disease (ILD) is a broad category of lung diseases that includes more than 130 disorders which are characterized by scarring (i.e. fibrosis ) and/or inflammation

More information