Supplementary Figure 1. Lkb1-deficient lung ADC progressively transdifferentiates into SCC. (a) A scheme showing the progression pattern of atypical
|
|
- Cory George
- 5 years ago
- Views:
Transcription
1 Supplementary Figure 1. Lkb1-deficient lung ADC progressively transdifferentiates into SCC. (a) A scheme showing the progression pattern of atypical adenomatous hyperplasia/epithelial hyperplasia (AAH/EH), adenoma, ADC and SCC in Kras/Lkb1mice post Ad-Cre treatment. (b) H&E staining and p63 immunohistochemical staining on lung tissues from Kras/Lkb1 1
2 mice at indicated time points post Ad-Cre treatment. Scale bar: 150 μm. (c) Statistic analysis of p63 positive lesions in the lungs from Kras/Lkb1 mice at 2, 4, 6, 8, 10 weeks post Ad-Cre treatment (n=8 each group). Data were shown as mean ± s.e.m. t test, **P < (d) A scheme showing the strategy of serial transplantation of mouse lung ADC with Lkb1 deficiency in nude mice. (e) Representative histology, p63, Ttf1 immunohistochemical staining and collagen staining for tumor xenografts at different passages of serial transplantation in nude mice. Scale bar: 50 μm. (f) Statistic analysis of p63 positive cells on lung tumor sections at passage 1, 2 and 3 from the serial transplatation experiment in nude mice. 10 serial sections were statistically analyzed in each passage. Data were shown as mean ± s.e.m. t test, ***P < (g) Representative histology and immunohistochemical staining of p63 and SP-C on mad-sccs from Kras/Lkb1 mice at 8 and 12 weeks post Ad-Cre treatment. Scale bar: 50 μm. (h) Statistic analysis of SP-C + /p63 + cell ratio in the mad-sccs from Kras/Lkb1 mice at 8 (n=10) and 12 weeks (n=10) post Ad-Cre treatment. 2
3 Supplementary Figure 2. Type II pneumocyte lineage-derived lung ADC with Lkb1 deficiency transdifferentiates into SCC. (a) Representative immunofluorescent photoes for LacZ (Green) and Sox2 (Red) staining in cyro section of SP-C-CreERT2/Rosa26R-LacZ mouse at 2 weeks post tamoxifen administration. Scale bar: 150 μm. (b) Statistic analysis of the percentage of LacZ positive cells in both type II pneumocytes and basal cells. (c) Schematic model (upper panel) and representative histologies (lower panel) for AAH, adenoma, ADC and SCC from SKL mice at a serial of time points post 3
4 tamoxifen administration. Scale bar: 150 μm. (d) Immunohistochemical staining of SP-C on lung tissues containing AAH, adenoma and adenocarcinoma from SKL mice at 4-8 weeks post tamoxifen administration. Scale bar: 150 μm. (e) Statistic analysis of the ADC or SCC incidence in SKL mice at 7 weeks post tamoxifen administration. (f) Representative immunostaining of SP-C, p63 and X-gal staining in ADC and SCC from SRKL mouse at 9 weeks post tamoxifen administration. Scale bar: 150 μm. (g) Representative immunohistochemical staining for p63 and SP-C in lung mad-scc from SKL mice at 9 weeks post tamoxifen administration. Scale bar: 150 μm. (h) Quantification of tumor percentage for mixed mad-scc and typical SCC in SKL mice at indicated time points post tamoxifen administration. n=8 for each time point. (i) Representative histology, p63, SP-C immunohistochemical staining on mad-scc lesions in Kras/Lkb1 mice with 8 and 12 weeks Ad-Cre treatment. Scale bar: 50 μm. (j) Statistic analysis of SP-C+/p63+ cell ratio in the mice with 9-12 (n=8) and (n=10) weeks Ad-Cre treatment.. 4
5 Supplementary Figure 3. Validation of a serial of genes differentially expressed in ADC and SCC from Kras/Lkb1 mouse model. Real-time PCR validation of genes differentially expressed in ADC (n=5) and SCC (n=7) from Kras/Lkb1 mouse model according to microarray data analyses. Data were shown as mean ± s.e.m. t test, *P <0.05, **P < 0.01,***P<
6 Supplementary Figure 4. Detection of Lox expression and collagen deposition in human lung ADC and SCC samples. (a) Real-time analysis of Lox expression in human lung ADC (n=85) and SCC (n=85) samples. Data were shown as mean ± s.e.m. t test, *P<0.05. (b) Representative photos showing immunohistochemical staining for Lox in human lung ADC and SCC samples. (c) Statistic analysis of Lox expression in human lung ADC and SCC samples. Pearson χ2 test. (d) Representative photos showing Massons Trichrome staining of collagen in human lung ADC and SCC samples. (e) Statistic analysis of collagen deposition in human lung ADC and SCC samples. Pearson χ2 test. 6
7 Supplementary Figure 5. Lentivirus-mediated Gene Expression in Kras/Lkb1 Mice. (a) A scheme of lentivirus-mediated gene expression (Lenti-Cre and Lenti-Cre-MC) in Kras/Lkb1 mouse model. (b) Representative H&E staining, p63 and SP-C immunohistochemical staining of ADC and SCC from Kras/Lkb1 mice virally infected with Lenti-Cre. Scale bar: 150 μm. 7
8 Supplementary Figure 6. Lentivirus-mediated Lox expression in Kras/Lkb1 mice. Representative H&E staining as well as SP-C immunohistochemical staining in lung ADC from Kras/Lkb1 mice virally infected with Lenti-Cre or Lenti-Cre-Lox. Scale bar: 10 μm. 8
9 Supplementary Figure 7. Pharmacological inhibition of LOX enzymatic activity promotes ADC to SCC transdifferentiation. (a) Detection of Lox enzymatic activity in sera from Kras/Lkb1 mice treated with BAPN (n=12), DPA (n=10) or Saline (n=14). Data were shown as mean ± s.e.m. t test ***P < (b) Detection of collagen deposition by Massons Trichrome staining in lung tumors from Kras/Lkb1 9
10 mice treated with BAPN, DPA or saline. Scale bar: 10 μm. (c) Representative histology and immunohistochemical staining of p63 and SP-C on mad-sccs from Kras/Lkb1 mice with or without 4 weeks BAPN treatment after 4 weeks Ad-Cre treatment. Scale bar: 50 μm. (d) Statistic analysis of SP-C + /p63 + cell ratio in the mad-sccs from Kras/Lkb1 mice with or without 4 weeks BAPN treatment after 4 weeks Ad-Cre treatment (n=12 each group). (e) A scheme showing the BAPN treatment strategy in SKL mouse model. (f-g) Quantification of average tumor number per mouse for ADC and SCC (F) and mad-scc (G) from SKL mice treated with BAPN (n=14) or saline (n=18). Data were shown as mean ±s.e.m. t test, *P <0.05, **P < (h-i) Quantification of average tumor size per mouse for ADC and SCC (h) and individual tumor size for SCC (i) from SKL mice post BAPN (n=12) or saline (n=12) treatment. Scale bar: 150 μm. Data were shown as mean ± s.e.m. t test, *P <0.05. (j-k) Quantification of average tumor number per mouse for ADC and SCC (j) and mad-scc (k) from Kras/Lkb1 mice at 4 weeks post DPA (n=14) or saline (n=16) treatment. Data were shown as mean ± s.e.m. t test, *P <0.05, ***P < (l) Quantification of average tumor size per mouse for ADC and SCC from Kras/Lkb1 mice at 4 weeks post DPA (n=14) or saline (n=16) treatment. Data were shown as mean ± s.e.m. (m) Quantification of individual tumor size of SCC in Kras/Lkb1 mice post DPA (n=10) or saline (n=14) treatment. Data were shown as mean ± s.e.m. t test. (n-o) Representative Ki67 immunohistochemical staining (n) and statistical analysis (o) in lung ADC and SCC from Kras/Lkb1 mice post BAPN (n=12), DPA (n=10) or saline (n=14) treatment. More than 200 high-power fields (HPF) were analyzed each mouse. Scale bar: 150 μm. t test, ***P < (p-q) Representative Cleaved caspase 3 immunohistochemical staining (p) and statistical analysis (q) in lung ADC and SCC from Kras/Lkb1 mice post BAPN (n=12), DPA (n=10) or saline (n=14) treatment. More than 200 high-power fields (HPF) were analyzed each mouse. Scale bar: 150 μm. Data were shown as mean ± s.e.m, t test, ***P <
11 Supplementary Figure 8. Activation of DNp63α partially promotes ADC to SCC transdifferentiation. (a) Lung ADC (n=5) and SCC (n=7) dissected from Kras/Lkb1mice at 10 weeks post Ad-Cre treatment were subjected to RNA preparation and real time PCR analyses. Data were shown as mean ± s.e.m.t test. *P <0.05.(b) Western blotting confirmed the ectopic expression of DNp63α in Kras/p53cells. (c) Immunofluorescence staining showed that transient DNp63αexpression partially activates Krt5 and Krt14 expression in Kras/p53cells. Scale bar: 150μm.(d) Distinct morphologies of Kras/p53cells with stablednp63αexpression in contrast to the parental cells. Scale bar: 75μm.
12 Supplementary Figure 9. Full gel scans for mouse Actin, SPC, Lox and p63(dnp63α) blots are shown. 12
13 Supplementary Table 1. The 20 most significantly deregulated signal pathways between ADC and SCC from Kras/Lkb1 mice. Fisher s Exact Test was used to generate the p value. Pathway SCC1 SCC2 SCC3 SCC4 SCC5 ADC1 ADC2 ADC3 ADC4 ADC5 Accuracy Validated transcriptional targets of deltanp E E E E E E E E E E % isoforms Validated transcriptional targets of TAp E E E E E E E E E E % isoforms Tight junction interactions 2.07E E E E E E E E E E % Cell junction organization 2.92E E E E E E E E E E % Direct p53 effectors 3.61E E E E E E E E E E % p53 signaling pathway 1.32E E E E E E E E E E % Apoptosis 1.86E E E E E E E E E E % Muscle cell TarBase 1.11E E E E E E E E E E % Interferon alpha/beta signaling 1.33E E E E E E E E E E % Apoptosis Modulation by HSP E E E E E E E E E E % Nucleotide Metabolism 6.99E E E E E E E E E E % Staphylococcus aureus infection -3.46E E E E E E E E E E % NCAM1 interactions 3.95E E E E E E E E E E % Protein digestion and absorption -1.26E E E E E E E E E E % NCAM signaling for neurite out-growth 1.00E E E E E E E E E E % Adipogenesis -2.87E E E E E E E E E E % Signaling by PDGF 1.00E E E E E E E E E E % Integrin cell surface interactions 7.40E E E E E E E E E E % Initial triggering of complement -1.20E E E E E E E E E E % Beta3 integrin cell surface interactions 1.61E E E E E E E E E E % 13
14 Supplememtary Table 2. Genes significantly deregulated in SCC relative to ADC from Kras/Lkb1 mice. Fisher s Exact Test was used to generate the p value. Description Gene T score P value Lox Lox family Loxl Loxl Loxl Col4a Col4a Col4a Collagen members Col4a Col4a Col14a Col3a Col6a Col6a Timp ECM assembly Timp Timp Vim Snai EMT Fn Cdh Cdh Trp E-06 Sox Squamous markers Krt E-09 Krt6a E-08 Krt ECM degradation Mmp Mmp Perp E-05 Pkp E-05 Pkp Desmosome Jup Dsc E-05 Dsc DSG Dsp Cldn Tight junction Cldn Cldn Cldn
15 Gap junction Gjb Gjd Pcdhb E-06 Cadm Pvrl Others Mpzl Efs Pcdh Csf3r E-05 Thbs
16 Supplementary Table 3. The primers used for regular PCR and genomic sequencing Gene Primers for PCR (5'-3') Primers for sequencing (5'-3') Pi3k-ca (E542) Pi3k-ca (E545) Pi3k-ca(H1047) p53 (CDS) NRF2 (CDS) Keap1 (CDS) Cul3 (CDS) p16 (CDS) p19 (CDS) AAGGAGGAGCACTGTCCGTT AAGGAGGAGCACTGTCCGTT TGGGCCACTTCGTCTCTGGA TGGGCCACTTCGTCTCTGGA AAGGAGGAGCACTGTCCGTT AAGGAGGAGCACTGTCCGTT TGGGCCACTTCGTCTCTGGA TGGGCCACTTCGTCTCTGGA GATGTGTTACAAGGCTTACCT GATGTGTTACAAGGCTTACCT CTTGCTCAAGTCCTAATGTT CTTGCTCAAGTCCTAATGTT GGTAGCGACTACAGTTAGGGGGCA GGTAGCGACTACAGTTAGGGGGCA CAGCAGAAGGGACCGGGAGGA CAGCAGAAGGGACCGGGAGGA GCCTCACCTCTGCTGCAAGT GCCTCACCTCTGCTGCAAGT TTTCACATCACAGTAGGAAG TTTCACATCACAGTAGGAAG CTGTGCTTAGTCACCGTGA GCTAGCAGAGGAACTGTGTCT CTTTAGTACAGAGAAGCAGT TGTTCCACGCGTGCATCGAC CCTCCGAGTGCGAGCCGCA CCTCCGAGTGCGAGCCGCA CCTCCGAGTGCGAGCCGCA CCTCCGAGTGCGAGCCGCA GTAGACAGAGGAGCAATAAGA CACTGAATCTCCGCGAGGAA CACTGAATCTCCGCGAGGAA AGCCACATGCTAGACACGCT AGCCACATGCTAGACACGCT TGGGGGCGGCGCTTCTCACCT TGGGGGCGGCGCTTCTCACCT GGCTGAGGCCGGATTTAGCT GGCTGAGGCCGGATTTAGCT 16
17 Supplementary Table 4. Description and frequency of LKB1 genetic alterations Exonic deletion n(%) Deletion of whole exon 2(1.98) Deletion of exon 1 5(4.95) Deletion of exon10 2(1.98) Deletion of exon 1-4 1(0.99) Deletion of exon 1-6 1(0.99) Deletion of exon 5-8 1(0.99) Deletion of exon 7-8 1(0.99) 17
18 Supplementary Table 5. The primers used for real-time PCR Gene Forward primer Reverse primer β-actin TGAGCGCAAGTACTCTGTGTGGAT ACTCATCGTACTCCTGCTTGCTGA Brf2 CCTTCCTGGCATGGCAGTCTCT CACCACCGACCGCTTGTTAAGTT Cldn8 GCAACCTACGCTCTTCAAATGG TTCCCAGCGGTTCTCAAACAC cmyc CAACGACAGCAGCTCGCCCA AGCCCGACTCCGACCTCTTGG Col1a1 GCTCCTCTTAGGGGCCACT CCACGTCTCACCATTGGGG Col4a1 CTGGCACAAAAGGGACGAG ACGTGGCCGAGAATTTCACC Col4a5 GGAGAACGGGGGTTTCCAG CTCCCTTGGTTCCATTGCATC Col4a6 GAACTGGCAGAATCGGGACAG TCCAATGGGACCCTTATCTCC Col6a1 CTGCTGCTACAAGCCTGCT CCCCATAAGGTTTCAGCCTCA Col6a2 GCTCCTGATTGGGGGACTCT CCAACACGAAATACACGTTGAC Dcn GTCATCTTCGAGTGGTGCAGT CGGGTGGAAAATCCCAGGG Dlx5 TCTCTAGGACTGACGCAAACA GTTACACGCCATAGGGTCGC DLX5 AAGCGCCACCAACCAGCCAG CGTTCCGGCAAGGCGAGGTA Dsc2 ATGGCGGCTGTGGGATCTAT GCAAGGATCGCAAGGGTCAA Dsg2 CGTGGTTGAAGGCATTCATTTC TAGCTGCTTGACCAGTGTCTT Gjb2 ATCCTCGGGGGTGTCAACAA AGACAAAATCGGCTTGCTCATC Hif1a ACCTTCATCGGAAACTCCAAAG CTGTTAGGCTGGGAAAAGTTAGG Itga6 GCAGAAGCACTCCCGCTGCA TTGCCCCCTGGACCTTGGCT Jup TGGCAACAGACATACACCTACG GGTGGTAGTCTTCTTGAGTGTG Klf5 CCTCCGTCCTATGCCGCTACAA GCTTCTCGCCCGTATGAGTCCT KLF5 TCGGATGAGCTGACCCGCCA TCAGAGCGCGAGAAGCTGCG Krt14 CAGCGGCCCACTGAGATCAAAG CTTGGTCCGGAAGTCATCGGCA Krt15 TTTGGAGGCAGCTCTACCCGAGG CTGCCCCCGAGGAGACAAACC Krt17 CGGGGCCAGCCAGAGACTAC TCGGCTCTGGCCAGGGTCAG Krt5 GGCCCACAGAGACTGCTTCTTT AACATTTTGGGGTCTGGGTCAC Krt6a TCCCAGATGTCATGGCTGCAGAA AGATGAGCAGTGGGGACCCATG Lox TCTTCTGCTGCGTGACAACC GAGAAACCAGCTTGGAACCAG Mmp14 CAGTATGGCTACCTACCTCCAG GCCTTGCCTGTCACTTGTAAA Mmp9 TGTCTGGAGATTCGACTTGAAGTC TGGTGTGCCCTGGAACTCA Oct1 AGCTCTTGCTTCTAGTGGCTC CTGGCTGTAGGTGCAGAGTTC p63 GTGTTGGTGTGGCACAGGGG TCTTCCCCACAGCTCTGGCT Perp ATCGCCTTCGACATCATCGC CCCCATGCGTACTCCATGAG Sccro AGAGTGTAAAAGGATCGTTGGAC CTGGATCGAGGGCCAGATCA 18
19 Sox2 TGCTGCCTCTTTAAGACTAGGGCT CGGGCGAAGTGCAATTGGGA Spc ATGGACATGAGTAGCAAAGAGGT CACGATGAGAAGGCGTTTGAG Timp1 GCAACTCGGACCTGGTCATAA CGGCCCGTGATGAGAAACT Timp2 TCAGAGCCAAAGCAGTGAGC GCCGTGTAGATAAACTCGATGTC Timp3 CTTCTGCAACTCCGACATCGT GGGGCATCTTACTGAAGCCTC Trim29 AGAATGGCACTAAAGCAGACAG AAATAGGCCACTCTTCCCCTC TRIM29 GGGGTGAGTGGAGTGCACCG GAGCTGCCTTGGACGACGGG 19
Supplementary Figures
Supplementary Figures Supplementary Figure 1 Correlation between LKB1 and YAP expression in human lung cancer samples. (a) Representative photos showing LKB1 and YAP immunohistochemical staining in human
More informationNature Medicine: doi: /nm.4324
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Supplementary Figure 1. Kinetics of SnCs development in surgically-induced OA and effect of GCV-induced SnC clearance on OA disease progression
More informationSupplementary Figure 1. Identification of tumorous sphere-forming CSCs and CAF feeder cells. The LEAP (Laser-Enabled Analysis and Processing)
Supplementary Figure 1. Identification of tumorous sphere-forming CSCs and CAF feeder cells. The LEAP (Laser-Enabled Analysis and Processing) platform with laser manipulation to efficiently purify lung
More informationSupplementary Table 1. List of primers used in this study
Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3
More informationSupplementary Figure 1
Combination index (CI) Supplementary Figure 1 2. 1.5 1. Ishikawa AN3CA Nou-1 Hec-18.5...2.4.6.8 1. Fraction affected (Fa) Supplementary Figure 1. The synergistic effect of PARP inhibitor and PI3K inhibitor
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationSUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
More informationSupplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier curves for progression-free survival (PFS) and overall survival (OS) in a cohort of patients (N=52) with stage III primary ovarian
More informationSupplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
More informationSOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al.
s1 A Pten flox/flox () SOPten flox/flox () flox allele 6. kb B Pten flox/flox () SOPten flox/flox () Pten Actin! allele 2.3 kb Supplementary Figure S1. Yanagi, et al. A B BrdU BrdU positive cells ( ) 3
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplemental Figure S1. RANK expression on human lung cancer cells.
Supplemental Figure S1. RANK expression on human lung cancer cells. (A) Incidence and H-Scores of RANK expression determined from IHC in the indicated primary lung cancer subgroups. The overall expression
More informationSupplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections
Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationstability and tumor suppression
Supplementary information The stress kinase MKK7 couples oncogenic stress to p53 stability and tumor suppression Daniel Schramek 1, Athanassios Kotsinas 2, Arabella Meixner 1, Teiji Wada 1, Ulrich Elling
More informationSupplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as
Supplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as well as their downstream effectors across a panel of ESCC
More informationSupplementary Figure 1
Supplementary Figure 1 a Percent of body weight! (%) 4! 3! 1! Epididymal fat Subcutaneous fat Liver SD Percent of body weight! (%) ** 3! 1! SD Percent of body weight! (%) 6! 4! SD ** b Blood glucose (mg/dl)!
More informationSupplementary Figure (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were
Supplementary Figure 1. Gd@C 82 (OH) 22 nanoparticles did not affect cell viability and apoposis. MDA-MB-231, MCF-7, MCF-10A and BT549 cells were treated with PBS, Gd@C 82 (OH) 22, C 60 (OH) 22 or GdCl
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/375/ra41/dc1 Supplementary Materials for Actin cytoskeletal remodeling with protrusion formation is essential for heart regeneration in Hippo-deficient mice
More informationSupplementary Figure 1. SA-β-Gal positive senescent cells in various cancer tissues. Representative frozen sections of breast, thyroid, colon and
Supplementary Figure 1. SA-β-Gal positive senescent cells in various cancer tissues. Representative frozen sections of breast, thyroid, colon and stomach cancer were stained with SA-β-Gal and nuclear fast
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationTitle: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events
Title: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events Pu Yang 1, 3, radley M. Schmit 1, Chunhua Fu 1, Kenneth DeSart 1, S. Paul
More informationfl/+ KRas;Atg5 fl/+ KRas;Atg5 fl/fl KRas;Atg5 fl/fl KRas;Atg5 Supplementary Figure 1. Gene set enrichment analyses. (a) (b)
KRas;At KRas;At KRas;At KRas;At a b Supplementary Figure 1. Gene set enrichment analyses. (a) GO gene sets (MSigDB v3. c5) enriched in KRas;Atg5 fl/+ as compared to KRas;Atg5 fl/fl tumors using gene set
More informationSupplemental Information. LKB1 Inactivation Elicits a Redox Imbalance. to Modulate Non-small Cell Lung Cancer Plasticity. and Therapeutic Response
Cancer Cell, Volume 27 Supplemental Information LKB1 Inactivation Elicits a Redox Imbalance to Modulate Non-small Cell Lung Cancer Plasticity and Therapeutic Response Fuming Li, Xiangkun Han, Fei Li, Rui
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationSupplemental Table 1. Plasma NEFA and liver triglyceride levels in ap2-hif1ako and ap2-hif2ako mice under control and high fat diets.
Supplemental Table 1. Plasma NEFA and liver triglyceride levels in Hif1aKO and Hif2aKO mice under control and high fat diets. Hif1a (n=6) Hif1aK O (n=6) Hif2a Hif2aK O Hif1a (n=5) Hif1aKO (n=5) Hif2a Hif2aK
More informationFigure S1: Effects on haptotaxis are independent of effects on cell velocity A)
Supplemental Figures Figure S1: Effects on haptotaxis are independent of effects on cell velocity A) Velocity of MV D7 fibroblasts expressing different GFP-tagged Ena/VASP family proteins in the haptotaxis
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationSupplemental Tables and Figures. The metalloproteinase-proteoglycans ADAMTS7 and ADAMTS12 provide an innate,
Supplemental Tables and Figures The metalloproteinase-proteoglycans ADAMTS7 and ADAMTS12 provide an innate, tendon-specific protective mechanism against heterotopic ossification Timothy Mead et al Supplemental
More informationSupplemental Information. Induction of Expansion and Folding. in Human Cerebral Organoids
Cell Stem Cell, Volume 20 Supplemental Information Induction of Expansion and Folding in Human Cerebral Organoids Yun Li, Julien Muffat, Attya Omer, Irene Bosch, Madeline A. Lancaster, Mriganka Sur, Lee
More informationSupplementary Fig. S1. Schematic diagram of minigenome segments.
open reading frame 1565 (segment 5) 47 (-) 3 5 (+) 76 101 125 149 173 197 221 246 287 open reading frame 890 (segment 8) 60 (-) 3 5 (+) 172 Supplementary Fig. S1. Schematic diagram of minigenome segments.
More informationSupplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis (a) Immunohistochemical (IHC) analysis of tyrosine 705 phosphorylation status of STAT3 (P- STAT3) in tumors and stroma (all-time
More informationTcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W
A Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 Tcf21 MCM ; R26 mtmg TAC 2W Tcf21 MCM ; R26 mtmg TAC 8W B Postn MCM ; R26 mtmg Sham GFP Col 1/3 Postn MCM ; R26 mtmg TAC 2W Postn MCM ; R26 mtmg TAC 8W Supplementary
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2566 Figure S1 CDKL5 protein expression pattern and localization in mouse brain. (a) Multiple-tissue western blot from a postnatal day (P) 21 mouse probed with an antibody against CDKL5.
More informationSupplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous
Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous LRP5 in intact adult mouse ventricular myocytes (AMVMs)
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More informationSupplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation
Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2610 Figure S1 FSMCs derived from MSLN CLN transgenic mice express smooth muscle-specific proteins. Beta-galactosidase is ubiquitously expressed within cultured FSMCs derived from MSLN
More informationSupplemental Figure 1. Egr1 expression in adult Achilles tendons. (A,B) Achilles tendons were isolated from 2 month-old Egr1 +/- mice and stained for
Supplemental Figure 1. Egr1 expression in adult Achilles tendons. (A,B) Achilles tendons were isolated from 2 month-old Egr1 +/- mice and stained for LacZ activity, which reflects Egr1 expression. (A)
More informationFigure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from
Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from germ cell mutants (dnrar flox/flox, Stra8-Cre +, RARElacZ) (A ), controls (dnrar flox/flox, RARElacZ) (B ),
More informationSupplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
More informationSupplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β
Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β
More informationSUPPLEMENTARY INFORMATION
doi: 10.1038/nature06030 SUPPLEMENTARY INFORMATION Whole Mount eno-empty eno-cre Original Magnification 200X eno-cre eno-empty Ji, Ramsey et al., Supplementary Figure 1 www.nature.com/nature 1 a Percent
More informationTargeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics. For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from
Supplementary Methods: Targeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from mouse tumor samples and analyzed as
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationSupplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2
Supplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2 activity. Upper panel: Representative histograms for FACS
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationa b c periosteum parietal bone bone marrow dura periosteum suture mesenchyme osteogenic front suture mesenchyme 1
coronary suture sagittal suture DOI: 10.1038/ncb3139 a b c e parietal bone suture mesenchyme parietal bone bone marrow ura ura ura f parietal bone ura suture mesenchyme bone g ura osteogenic front suture
More informationSupplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells
Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Immunofluorescence staining of H3K9me3 and 53BP1 in PH and HGADFN003 (HG003) cells at 24 h after γ-irradiation. Scale bar,
More informationSupplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway
Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.
More informationSupplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic B cells from WT Nfat2 +/+, TCL1 Nfat2 +/+ and TCL1 Nfat2
More informationFigure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min
Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with
More informationSupplementary Figure 1. Electroporation of a stable form of β-catenin causes masses protruding into the IV ventricle. HH12 chicken embryos were
Supplementary Figure 1. Electroporation of a stable form of β-catenin causes masses protruding into the IV ventricle. HH12 chicken embryos were electroporated with β- Catenin S33Y in PiggyBac expression
More informationSupplementary Figure 1. A. Bar graph representing the expression levels of the 19 indicated genes in the microarrays analyses comparing human lung
Supplementary Figure 1. A. Bar graph representing the expression levels of the 19 indicated genes in the microarrays analyses comparing human lung immortalized broncho-epithelial cells (AALE cells) expressing
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES 1 Supplementary Figure 1, Adult hippocampal QNPs and TAPs uniformly express REST a-b) Confocal images of adult hippocampal mouse sections showing GFAP (green), Sox2 (red), and REST
More informationFig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4
Fig. S1. Upregulation of K18 and K14 mrna levels during ectoderm specification of hescs. Quantitative real-time PCR analysis of mrna levels of OCT4 (n=3 independent differentiation experiments for each
More informationSupplementary Figure S1. Monolayer differentiation of mouse ESCs into telencephalic neural precursors. (a) Schematic representation of the protocols
Supplementary Figure S1. Monolayer differentiation of mouse ESCs into telencephalic neural precursors. (a) Schematic representation of the protocols used to differentiate mouse ESCs. (b) Representative
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationSupplementary Figure 1:
Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationProgrammed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration
Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration The Harvard community has made this article openly available. Please
More informationSupplementary Figure 1. Validation of astrocytes. Primary astrocytes were
Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent
More informationSupplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice.
Supplementary Figures: Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Male apoe -/- mice were fed a high-fat diet for 8 weeks, and given PBS (model group) or
More informationSupplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence
Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. The expression of ephrin-b2 H2BGFP persists in the post-hearingonset organ of Corti and is specifically restricted to supporting cells. Sox2 immunolabeling
More informationSupplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin
Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin sections from sham-operated adult hearts (a and i) and
More informationAP VP DLP H&E. p-akt DLP
A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2535 Figure S1 SOX10 is expressed in human giant congenital nevi and its expression in human melanoma samples suggests that SOX10 functions in a MITF-independent manner. a, b, Representative
More informationPKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65
SUPPLEMENTARY INFORMATION TITLE: PKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65 RUNNING TITLE: PKCζ-NFκB Signaling in Breast Cancer
More informationSupplementary Figure S1: Tanycytes are restricted to the central/posterior hypothalamus
Supplementary Figure S1: Tanycytes are restricted to the central/posterior hypothalamus a: Expression of Vimentin, GFAP, Sox2 and Nestin in anterior, central and posterior hypothalamus. In the anterior
More informationTargeting BMI1 + Cancer Stem Cells Overcomes Chemoresistance and Inhibits Metastases in Squamous Cell Carcinoma
Article Targeting BMI1 + Cancer Stem Cells Overcomes Chemoresistance and Inhibits Metastases in Squamous Cell Carcinoma Graphical Abstract Authors Demeng Chen, Mansi Wu, Yang Li,..., Sivakumar Ramadoss,
More informationAtg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1
Takamura_Fig. S1 brain heart lung spleen stomach colon kidney SM Supplemental Figure 1 Histological findings of tg5 flox/flox ;CG-Cre mouse tissues. H&E staining of the brain, heart, lung, spleen, stomach,
More informationsupplementary information
DOI: 10.1038/ncb2133 Figure S1 Actomyosin organisation in human squamous cell carcinoma. (a) Three examples of actomyosin organisation around the edges of squamous cell carcinoma biopsies are shown. Myosin
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. Long-term protection studies. 45 minutes of ischemia was induced in wild type (S1pr2 +/+ ) and S1pr2 -/- by MCAO. A) 5 days later brains were harvested
More informationSUPPLEMENTARY INFORMATION
1. Supplementary Figures and Legends Supplementary Fig. 1. S1P-mediated transcriptional regulation of integrins expressed in OP/monocytoid cells. Real-time quantitative PCR analyses of mrna for two integrins,
More informationSupplemental Information. Tissue Myeloid Progenitors Differentiate. into Pericytes through TGF-b Signaling. in Developing Skin Vasculature
Cell Reports, Volume 18 Supplemental Information Tissue Myeloid Progenitors Differentiate into Pericytes through TGF-b Signaling in Developing Skin Vasculature Tomoko Yamazaki, Ani Nalbandian, Yutaka Uchida,
More informationIn vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell
Supplementary Methods BrdU incorporation in vivo In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell proliferation in the heart. Mice were subjected to LI-TAC, and 5 days later
More informationType of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures
Type of file: PDF Size of file: 0 KB Title of file for HTML: Supplementary Information Description: Supplementary Figures Supplementary Figure 1 mir-128-3p is highly expressed in chemoresistant, metastatic
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationSupplementary Figures for
Supplementary Figures for SOX2 suppresses CDKN1A to sustain growth of lung squamous cell carcinoma Takuya Fukazawa 1, Minzhe Guo 4, 5, Naomasa Ishida 1, Tomoki Yamatsuji 1, Munenori Takaoka 1, Etsuko Yokota
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/3/8/e1700521/dc1 Supplementary Materials for Functional vascularized lung grafts for lung bioengineering N. Valerio Dorrello, Brandon A. Guenthart, John D. O Neill,
More informationSUPPLEMENTARY FIGURE LEGENDS. atypical adenomatous hyperplasias (AAH); Grade II: adenomas; Grade III: adenocarcinomas;
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure S1: Tumor grades in Ras G12D ; p53 / lung tumors. Representative histology (H&E) of K-Ras G12D ; p53 / lung tumors 13 weeks after tumor initiation. Grade
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces
More informationSupplemental Table S1. Primers used in qrt-pcr analyses. Supplemental Figure S1, related to Figure 4. Extracellular matrix proteins
Supplemental Material PDGFRb regulates craniofacial development through homodimers and functional heterodimers with PDGFRa Katherine A. Fantauzzo and Philippe Soriano Supplemental materials provided: Supplemental
More informationSupplementary Figure 1
Supplementary Figure 1 A B mir-141, human cell lines mir-2c, human cell lines mir-141, hepatocytes mir-2c, hepatocytes Relative RNA.1.8.6.4.2 Relative RNA.3.2.1 Relative RNA 1.5 1..5 Relative RNA 2. 1.5
More informationSupplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.
Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding
More informationSupplementary Information
Supplementary Information mediates STAT3 activation at retromer-positive structures to promote colitis and colitis-associated carcinogenesis Zhang et al. a b d e g h Rel. Luc. Act. Rel. mrna Rel. mrna
More informationsupplementary information
DOI: 10.1038/ncb1875 Figure S1 (a) The 79 surgical specimens from NSCLC patients were analysed by immunohistochemistry with an anti-p53 antibody and control serum (data not shown). The normal bronchi served
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationSupplementary Figure 1: Signaling centers contain few proliferating cells, express p21, and
Supplementary Figure 1: Signaling centers contain few proliferating cells, express p21, and exclude YAP from the nucleus. (a) Schematic diagram of an E10.5 mouse embryo. (b,c) Sections at B and C in (a)
More informationB16F1 B16F10 Supplemental Figure S1
B16F1 B16F1 Supplemental Figure S1 Representative microangiography images of B16F1 and B16F1 tumors grown in the cranial windows. FITC-dextran (2 million MW) was injected systemically to visualize blood
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More information