ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES
|
|
- Adrian Greene
- 5 years ago
- Views:
Transcription
1 ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES Ruslan I. Dmitriev, Alexander V. Zhdanov, Greg Jasionek, Dmitri B. Papkovsky Biochemistry Department, University College Cork, Cork, Ireland SUPPLEMENTARY DATA DNA sequence insert (5 3 ): Green EGFP encoding sequence; Yellow R 9 encoding sequence. Gray restriction sites for cloning (BamHI and Hin diii). No color linker region. ggatccatggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacgg CCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCG GCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGtCcTTCAGCCGCTACCCCGACCAC ATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGG CAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCA AGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAG AAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACC CCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTAC AAGagatctggaggtggaAGACGTCGAAGACGTCGAAGACGTCGAtaagctt Predicted ER9Q protein, includes sequence encoded by the vector pqe: Red vector derived sequence; Green EGFP; Yellow R 9 ; 143 Da, 265 a.a., pi 8.76 MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG VQSFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNS HNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAA GITLGMDELYKRSGGGRRRRRRRRR Figure S1. DNA coding and amino acid sequences of ER9Q protein. 1
2 A Absorbance, a.u Excitation Em ission Phosphorescence,a.u. B 1 1 C Phosphorescence lifetime, μ s Wavelength, nm PtCP-TFN conc., μm Time, min Average Phosphorescence F1,cps Cellviability, % μ M/ FCCP -.5 μ M/ DMSO -.5 μ M/ baseline Figure S2: Evaluation of the TFN-PtCP probe for O2 sensing. A: Excitation and emission spectra in air-saturated solution. B: Average phosphorescence intensity counts (F1) from PC12 cells loaded with -2 μm TFN-PtCP for 2 h; effect on cell viability is also shown. C: Monitoring of oxygenation of PC12 cells loaded with TFN-PtCP (.5, 2 μm for 2 h) and exposed to metabolic with 1 μm FCCP or DMSO (solvent) and 2.5 mm, presented in phosphorescence lifetime (τ) scale. Bars indicate time of effectors addition. 2
3 A ER9Q ER9Q brightfield ER9Q TMRM B Average phosphorescence, cps F Staining time,h Cellviability,% τ, μs C 1uM FCCP 2uM FCCP τ, μs D h FCCP- 6 h D MSO- 6 h FCCP- 2hD MSO- 2hFCCP- Figure S3: Evaluation of ER9Q-PtCP protein with PC12 cells. A: Fluorescent images of PC12 cells stained with ER9Q protein (green, plasma membranes) and mitochondria-specific dye TMRM (red). B: Average phosphorescence intensity counts (F1) obtained with PC12 cells incubated with 1 μm ER9Q- PtCP for different time intervals; cell viability is also shown (right axis). C, D: Monitoring of oxygenation of PC12 cells stained with ER9Q-PtCP probe at rest and upon metabolic with uncoupler (FCCP) and Ca 2+ chelator (), presented in phosphorescence lifetime scale (τ). Bars indicate the time of effector treatment. 3
4 TFN-Alexa 499 Chlathrin-mediated endosomes dextran 1,-Alexa 488 Macropinosomes CTX-Alexa 488 Lipid raft-mediated endosomes GFP-Rab6 Trans-Golgi network MitoCase12 Mitochondria Nano2 Hoechst Figure S4. The intracellular localization of Nano2 probe in MEF cells compared to markers of endocytosis and mitochondria. Brightfield and merged fluorescence (obtained from the same optical slices) images of the live MEF cells are shown. Cells were stained with Nano2 probe and with markers of organelles and imaged as described in Materials and methods section. Scale bar μm. 4
5 Phosphorescence Intensity (t1), cps 7 1 blank control Per-NP ER9Q Figure S5: Respiration profiles of MEF cells exposed to mimics of PC and IC probes and measured using MitoXpress probe. Cells were incubated in conditions of routine staining with probes in presence of non-phosphorescent mimics of Nano2 (Per-NP) and ER9Q-PtCP (unlabeled ER9Q protein) and subjected to OCR analysis with the help of MitoXpress probe. 5
A highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae
Electronic Supporting Information highly selective IE fluorogen for lipid droplet imaging in live cells and green algae Erjing Wang, ab Engui Zhao, ab Yuning Hong, ab Jacky W. Y. Lam, ab and en Zhong Tang*
More informationElectronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection
Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 2014 Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic
More informationgenome edited transient transfection, CMV promoter
Supplementary Figure 1. In the absence of new protein translation, overexpressed caveolin-1-gfp is degraded faster than caveolin-1-gfp expressed from the endogenous caveolin 1 locus % loss of total caveolin-1-gfp
More informationSupporting Information
Supporting Information Cancer Cell Membrane-Biomimetic Nanoprobes with Two-Photon Excitation and Near-Infrared Emission for Intravital Tumor Fluorescence Imaging Yanlin Lv 1,2,, Ming Liu 3,4,, Yong Zhang
More informationab Intracellular O 2 Probe
ab140101 Intracellular O 2 Probe Instructions for Use For the measurement of intracellular oxygen in populations of live mammalian cells This product is for research use only and is not intended for diagnostic
More informationSuperior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.)
Table of Contents Fluor TM Labeling Dyes Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum....1 Fluor TM 405 Dye, an Excellent Alternative to Alexa Fluor 405 & DyLight 405....2 Fluor
More informationSUPPLEMENTARY INFORMATION
Figure S1 Induction of non-apoptotic death of SV40-transformed and primary DKO MEFs, and DKO thymocytes. (A-F) STS-induced non-apoptotic death of DKO MEF. (A, B) Reduced viability of DKO MEFs after exposure
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1 SNARE Probes for FRET/2pFLIM Analysis Used in the Present Study. mturquoise (mtq) and Venus (Ven) are in blue and yellow, respectively. The soluble N-ethylmaleimide-sensitive
More informationNear-infrared fluorescent proteins
nature methods Near-infrared fluorescent proteins Dmitry Shcherbo, Irina I Shemiakina, Anastasiya V Ryabova, Kathryn E Luker, Bradley T Schmidt, Ekaterina A Souslova, Tatiana V Gorodnicheva, Lydia Strukova,
More information- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml)
Supplementary Table ST1: The dynamic effect of LPS on IL-6 production in monocytes and THP-1 cells after GdA treatment. Monocytes, THP-1 cells and macrophages (5x10 5 ) were incubated with 10 μg/ml of
More informationSupporting Information
Supporting Information Toward High-Efficient Red Emissive Carbon Dots: Facile Preparation, Unique Properties, and Applications as Multifunctional Theranostic Agents Shan Sun,, Ling Zhang, Kai Jiang, Aiguo
More information-51mV 30s 3mV. n=14 n=4 p=0.4. Depolarization (mv) 3
Supplementary Figure 1 a optoβ 2 -AR b ChR2-51mV 30s 3mV -50mV 30s 3mV c 4 n=14 n=4 p=0.4 Depolarization (mv) 3 2 1 0 Both optogenetic actuators, optoβ 2 AR and ChR2, were effective in stimulating astrocytes
More informationBreaking the depth dependency of phototherapy with Cerenkov radiation and low-radianceresponsive
SUPPLEMENTARY INFORMATION DOI: 10.1038/NNANO.2015.17 Breaking the depth dependency of phototherapy with Cerenkov radiation and low-radianceresponsive nanophotosensitizers Nalinikanth Kotagiri, Gail P.
More informationd e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information
Ca 2+ level (a. u.) Area (a. u.) Normalized distance Normalized distance Center Edge Center Edge Relative ATP level Relative ATP level Supplementary Information Spatiotemporal quantification of subcellular
More informationSupporting Information
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2018 Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 2016. Supporting Information
More informationCell membrane penetration and mitochondrial targeting by platinumdecorated
Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 2016 Cell membrane penetration and mitochondrial targeting by platinumdecorated ceria nanoparticles
More informationMII. Supplement Figure 1. CapZ β2. Merge. 250ng. 500ng DIC. Merge. Journal of Cell Science Supplementary Material. GFP-CapZ β2 DNA
A GV GVBD MI DNA CapZ β2 CapZ β2 Merge B DIC GFP-CapZ β2 Merge CapZ β2-gfp 250ng 500ng Supplement Figure 1. MII A early MI late MI Control RNAi CapZαβ DNA Actin Tubulin B Phalloidin Intensity(A.U.) n=10
More informationSupplementary Material
Electronic Supplementary Material (ESI) for Integrative Biology. This journal is The Royal Society of Chemistry 2018 Supplementary Material 1 Supplemental Figures Supplemental Figure S1. Mechanical properties
More informationLysosomes and endocytic pathways 9/27/2012 Phyllis Hanson
Lysosomes and endocytic pathways 9/27/2012 Phyllis Hanson General principles Properties of lysosomes Delivery of enzymes to lysosomes Endocytic uptake clathrin, others Endocytic pathways recycling vs.
More informationMcWilliams et al., http :// /cgi /content /full /jcb /DC1
Supplemental material JCB McWilliams et al., http ://www.jcb.org /cgi /content /full /jcb.201603039 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. In vitro characterization of mito-qc. (A and B) Analysis
More informationSupplementary information Common molecular mechanism of amyloid pore formation by Alzheimer s -amyloid peptide and -synuclein
1 Supplementary information Common molecular mechanism of amyloid pore formation by Alzheimer s -amyloid peptide and -synuclein by Coralie Di Scala, Nouara Yahi, Sonia Boutemeur, Alessandra Flores, Léa
More informationFluorescence Microscopy
Fluorescence Microscopy Imaging Organelles Mitochondria Lysosomes Nuclei Endoplasmic Reticulum Plasma Membrane F-Actin AAT Bioquest Introduction: Organelle-Selective Stains Organelles are tiny, specialized
More informationNature Biotechnology: doi: /nbt.3828
Supplementary Figure 1 Development of a FRET-based MCS. (a) Linker and MA2 modification are indicated by single letter amino acid code. indicates deletion of amino acids and N or C indicate the terminus
More informationSupplemental Data. Wu et al. (2010). Plant Cell /tpc
Supplemental Figure 1. FIM5 is preferentially expressed in stamen and mature pollen. The expression data of FIM5 was extracted from Arabidopsis efp browser (http://www.bar.utoronto.ca/efp/development/),
More informationSupplementary information
Supplementary information Lipid peroxidation causes endosomal antigen release for cross-presentation Ilse Dingjan 1, Daniëlle RJ Verboogen 1, Laurent M Paardekooper 1, Natalia H Revelo 1, Simone P Sittig
More informationSupporting Information For
Supporting Information For MicroRNA-Catalyzed Cancer Therapeutics Based on DNA-Programmed Nanoparticle Complex Xucheng Luo, 1 Zhi Li, 1 Ganglin Wang, 1 Xuewen He, 2,3 Xiaoqin Shen, 1 Quanhong Sun, 1 Li
More informationLong-lived metal complexes open up microsecond lifetime imaging microscopy under multiphoton excitation: from FLIM to PLIM and beyond
Supplementary Information Long-lived metal complexes open up microsecond lifetime imaging microscopy under multiphoton excitation: from FLIM to PLIM and beyond Elizabeth Baggaley, Stanley W. Botchway,
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/2/12/e1601838/dc1 Supplementary Materials for General and programmable synthesis of hybrid liposome/metal nanoparticles Jin-Ho Lee, Yonghee Shin, Wooju Lee, Keumrai
More informationRyan McGarrigle, Ph.D.
Cardiomyocyte function characterised through combined analysis of metabolic flux, beat rate and cellular oxygenation and its application in in vitro ischemia reperfusion modelling Ryan McGarrigle, Ph.D.
More informationInfluenza virus exploits tunneling nanotubes for cell-to-cell spread
Supplementary Information Influenza virus exploits tunneling nanotubes for cell-to-cell spread Amrita Kumar 1, Jin Hyang Kim 1, Priya Ranjan 1, Maureen G. Metcalfe 2, Weiping Cao 1, Margarita Mishina 1,
More informationEl Azzouzi et al., http ://www.jcb.org /cgi /content /full /jcb /DC1
Supplemental material JCB El Azzouzi et al., http ://www.jcb.org /cgi /content /full /jcb.201510043 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. Acquisition of -phluorin correlates negatively with podosome
More informationFigure S1. Western blot analysis of clathrin RNA interference in human DCs Human immature DCs were transfected with 100 nm Clathrin SMARTpool or
Figure S1. Western blot analysis of clathrin RNA interference in human DCs Human immature DCs were transfected with 100 nm Clathrin SMARTpool or control nontargeting sirnas. At 90 hr after transfection,
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. EBV-gB 23-431 mainly exists as trimer in HEK 293FT cells. (a) Western blotting analysis for DSS crosslinked FLAG-gB 23-431. HEK 293FT cells transfected
More informationEngineering a polarity-sensitive biosensor for time-lapse imaging of apoptotic processes and degeneration
nature methods Engineering a polarity-sensitive biosensor for time-lapse imaging of apoptotic processes and degeneration Yujin E Kim, Jeannie Chen, Jonah R Chan & Ralf Langen Supplementary figures and
More informationLysine analogue of Polymyxin B as a significant opportunity for photodynamic antimicrobial chemotherapy
SUPPORTING INFORMATION Lysine analogue of Polymyxin B as a significant opportunity for photodynamic antimicrobial chemotherapy Florent Le Guern, Tan-Sothea Ouk *, Catherine Ouk, Regis Vanderesse +, Yves
More informationProlonged mitotic arrest induces a caspase-dependent DNA damage
SUPPLEMENTARY INFORMATION Prolonged mitotic arrest induces a caspase-dependent DNA damage response at telomeres that determines cell survival Karolina O. Hain, Didier J. Colin, Shubhra Rastogi, Lindsey
More informationnature methods Organelle-specific, rapid induction of molecular activities and membrane tethering
nature methods Organelle-specific, rapid induction of molecular activities and membrane tethering Toru Komatsu, Igor Kukelyansky, J Michael McCaffery, Tasuku Ueno, Lidenys C Varela & Takanari Inoue Supplementary
More informationB16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small
More informationbio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM.
bio-mof-1 Transmittance bio-mof-1 DMASM DMASMI 2000 1500 1000 500 Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. Intensity (a.u.) bio-mof-1 DMASM as
More informationSupplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems
Supplementary Figure 1 Overview of steps in the construction of photosynthetic protocellular systems (a) The small unilamellar vesicles were made with phospholipids. (b) Three types of small proteoliposomes
More informationQuantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles
Quantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles Amin Feizpour Reinhard Lab Department of Chemistry and the Photonics Center, Boston University, Boston, MA May 2014
More informationSupporting Information
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Supporting Information A new ICT and CHEF based visible light excitable fluorescent probe easily
More informationLentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.
Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.
More informationA novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo
Supporting Information A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Yiming Li, a,b Hanbao Chong, a Xiangming Meng,* a Shuxin Wang, a Manzhou Zhu a and Qingxiang
More informationLDL Uptake Cell-Based Assay Kit
LDL Uptake Cell-Based Assay Kit Catalog Number KA1327 100 assays Version: 07 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay...
More informationCarbon-1 versus carbon-3 linkage of D-galactose to porphyrins: Synthesis, uptake, and photodynamic efficiency
Supporting information for Carbon-1 versus carbon-3 linkage of D-galactose to porphyrins: Synthesis, uptake, and photodynamic efficiency Patrícia M. R. Pereira #, Waqar Rizvi #, N. V. S. Dinesh K. Bhupathiraju,
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7
More informationTyrodes solution in a custom-built imaging chamber as described previously. Images were acquired
Supplemental Material Supplemental Methods Electrical stimulation of CX-G3-labeled hippocampal neurons Following 5 min incubation in 0.5 µm CX-G3 and washes, 18-20 DIV neurons were imaged in normal Tyrodes
More informationSupplementary table and figures
3D single molecule tracking with multifocal plane microscopy reveals rapid intercellular transferrin transport at epithelial cell barriers Sripad Ram, Dongyoung Kim, Raimund J. Ober and E. Sally Ward Supplementary
More informationCaution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard. Product Number: AD0013
TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard Product Number: AD0013 INTRODUCTION: Fluorescent isothiocyanato-activated
More informationTHE ROLE OF ALTERED CALCIUM AND mtor SIGNALING IN THE PATHOGENESIS OF CYSTINOSIS
Research Foundation, 18 month progress report THE ROLE OF ALTERED CALCIUM AND mtor SIGNALING IN THE PATHOGENESIS OF CYSTINOSIS Ekaterina Ivanova, doctoral student Elena Levtchenko, MD, PhD, PI Antonella
More informationElectronic Supporting Information for
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Electronic Supporting Information for Rhodamine based Turn-On Fluorescent Probe for Pb(II)
More informationA Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells
Supporting Information for A Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells Mingguang Ren, Beibei Deng, Kai Zhou, Xiuqi
More informationSupporting Information. Light-enhanced hypoxia-response of conjugated polymer nanocarrier. for successive synergistic photodynamic and chemo-therapy
Supporting Information Light-enhanced hypoxia-response of conjugated polymer nanocarrier for successive synergistic photodynamic and chemo-therapy Xiaolong Zhang a,d, Ming Wu a,d, Jiong Li a,c,d, Shanyou
More informationSinglet oxygen photosensitisation by the fluorescent probe Singlet Oxygen Sensor Green
Singlet oxygen photosensitisation by the fluorescent probe Singlet Oxygen Sensor Green Xavier Ragàs, Ana Jiménez-Banzo, David Sánchez-García, Xavier Batllori and Santi Nonell* Grup d Enginyeria Molecular,
More informationSupplemental Data. Supplemental Text
Supplemental Data The magnitude of the light-induced conformational change in different rhodopsins correlates with their ability to activate G proteins. Hisao Tsukamoto, David L. Farrens, Mitsumasa Koyanagi
More informationSupplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) .
Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) The inhibitory effects of new antibodies (Mab17 and Mab18). They were investigated in in vitro fertilization
More informationLANCE Eu-W1024 ITC Chelate & Europium Standard AD0013 Development grade
AD0017P-4 (en) 1 LANCE Eu-W1024 ITC Chelate & Europium Standard AD0013 Development grade INTRODUCTION Fluorescent isothiocyanato-activated (ITC-activated) Eu-W1024 chelate is optimized for labelling proteins
More informationCH 7 CELL STRUCTURE AND FUNCTION
1 Review What is a cell Explain What three statements make up the cell theory Infer How did the invention of the microscope help the development of the cell theory 2 Review How do microscopes work Apply
More informationSUPPORTING INFORMATION
SUPPORTING INFORMATION SUPPLEMENTARY FIGURE LEGENDS Fig. S1. Separation of non-dissolved nanoparticles. Tests were conducted on the separation of non-dissolved nanoparticles added in excess to BEGM (A)
More informationElectronic Supplementary Information (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2012
Electronic Supplementary Information (ESI) for Lab on a Chip Electronic Supplementary Information Construction of oxygen and chemical concentration gradients in a single microfluidic device for studying
More informationA. Generation and characterization of Ras-expressing autophagycompetent
Supplemental Material Supplemental Figure Legends Fig. S1 A. Generation and characterization of Ras-expressing autophagycompetent and -deficient cell lines. HA-tagged H-ras V12 was stably expressed in
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nature6416 Supplementary Notes Spine Ca 2+ signals produced by glutamate uncaging We imaged uncaging-evoked [Ca 2+ ] transients in neurons loaded with a green Ca 2+ - sensitive indicator (G;
More informationSupplemental Information for: Localization of anionic phospholipids in Escherichia coli cells
Supplemental Information for: Localization of anionic phospholipids in Escherichia coli cells Piercen M. Oliver, a John A. Crooks, a Mathias Leidl, b Earl J. Yoon, a Alan Saghatelian, b and Douglas B.
More informationSupplementary figure legends
Supplementary figure legends Supplementary Figure 1. Exposure of CRT occurs independently from the apoptosisassociated loss of the mitochondrial membrane potential (MMP). (A) HeLa cells treated with MTX
More informationSynergistic effects of antioxidative peptides from rice bran
Synergistic effects of antioxidative peptides from rice bran Pichamon Kiatwuthinon 1,*, Neeracha Lapanusorn 1, Anunyaporn Phungsom 1, Wirawan Tinanchai 1 1 Department of Biochemistry, Faculty of Science,
More informationFigure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow
SUPPLEMENTARY DATA Supplementary Figure Legends Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow cytometry analysis of PMVs labelled with annexin-v-pe (Guava technologies)
More informationSOD1 inhibition reduces non-small cell lung cancer by inducing cell death
SUPPLEMENTAL INFORMATION SOD1 inhibition reduces non-small cell lung cancer by inducing cell death Andrea Glasauer, Laura A. Sena, Lauren P. Diebold, Andrew P. Mazar & Navdeep S. Chandel Inventory of Supplemental
More informationSUPPLEMENTARY DATA. Biologie and Pathology, Grenoble, France,
SUPPLEMENTARY DATA MitoCeption as a new tool to assess the effects of mesenchymal stem/stromal cell mitochondria on cancer cell metabolism and functions Andrés Caicedo a,b, Vanessa Fritz c, Jean-Marc Brondello
More informationAnanya Baksi CY11D042
Insulin-Directed Synthesis of Fluorescent Gold Nanoclusters: Preservation of Insulin Bioactivity and Versatility in Cell Imaging Angew. Chem. Int. Ed. 2011, 50, 7056 7060 Chien-Liang Liu, Hung-Tsung Wu,
More informationJ. Cell Sci. 129: doi: /jcs : Supplementary information
Movie 1. AgLDL is contained in small sub-regions of the lysosomal synapse that are acidic. J774 cells were incubated with agldl dual labeled with a ph sensitive and a ph insensitive fluorophore for 1 hr.
More informationSupplements. Figure S1. B Phalloidin Alexa488
Supplements A, DMSO, PP2, PP3 Crk-myc Figure S1. (A) Src kinase activity is necessary for recruitment of Crk to Nephrin cytoplasmic domain. Human podocytes expressing /7-NephrinCD () were treated with
More informationSupplementary Figure S1
Supplementary Figure S1 Supplementary Figure S1. PARP localization patterns using GFP-PARP and PARP-specific antibody libraries GFP-PARP localization in non-fixed (A) and formaldehyde fixed (B) GFP-PARPx
More informationImaging energy status in live cells with a fluorescent biosensor of the intracellular ATP-to-ADP. ratio
Imaging energy status in live cells with a fluorescent biosensor of the intracellular ATP-to-ADP ratio Mathew Tantama, Juan Ramón Martínez-François, Rebecca Mongeon, Gary Yellen* Department of Neurobiology,
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: cholesterol manipulation alters the positioning of autophagosomes in cells, related to figure 1. (a) HeLa cells were treated for 24h under conditions reducing
More informationSupplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS)
Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) and their exosomes (EXO) in resting (REST) and activated
More informationSupplementary Information. Acoustically-Mediated Intracellular Nanoparticle and Macromolecule Delivery
Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 218 Supplementary Information Acoustically-Mediated Intracellular Nanoparticle and Macromolecule Delivery
More informationSupplementary Information. Solvatochromic Dye LDS 798 as Microviscosity and ph Probe
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 2017 Supplementary Information Solvatochromic Dye LDS 798 as Microviscosity and ph Probe
More informationSHG Nanoprobes: Advancing harmonic imaging in biology. Periklis (Laki) Pantazis
SHG Nanoprobes: Advancing harmonic imaging in biology Periklis (Laki) Pantazis fluorescence microscopy in biomedical research: impact of fluorescent proteins 1960s and 1970s 1992 and 1994 1995 1996 wt-gfp
More informationSupplementary Figure 1: Imaging T-ALL progression and growth in transplanted
Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted rag2e450fs fish. Monoclonal T-ALLs were serially passaged in strain fish and then used as donors (left panel). Cells were transplanted
More informationINTRODUCTION. This material is quoted from below PDF and modified.
INTRODUCTION While drug response profiling of cancer cells in two-dimensional culture has been a mainstay of predictive biomarker discovery and anti-cancer drug development, there are aspects of tumor
More information33VASTVNGATSANNHGEPPS51PADARPR58
Pro-rich region Trans-membrane region 214 246 359 381 UL50 1 397 211SSRTAS216PPPPPR222 NLS CR1 CR2 CR3 CR4 UL53 1 376 11RERRS15ALRS19LLRKRRR25 33VASTVNGATSANNHGEPPS51PADARPR58 FIG S1. UL97 phosphorylation
More informationWT MSD MPS-IIIA. Lysosomal ph
7 6 Lysosomal ph 5 4 3 2 1 Supplementary figure S1. Lysosomal ph was measure in, and MPSIIIA MEFs using a Lysosensor yellow/blue-dextran (Molecular Probes) as a lysosomal ph indicator (see methods). P
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/7/334/rs4/dc1 Supplementary Materials for Rapidly rendering cells phagocytic through a cell surface display technique and concurrent Rac activation Hiroki Onuma,
More informationSupplementary Information
Electronic Supplementary Material (ESI) for Analyst. This journal is The Royal Society of Chemistry 2018 Supplementary Information Spying on Protein Interactions in Living Cells with Reconstituted Scarlet
More informationSupporting Information
Supporting Information Fig. S1. Overexpression of Rpr causes progenitor cell death. (A) TUNEL assay of control intestines. No progenitor cell death could be observed, except that some ECs are undergoing
More informationCaution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard. Product Number: AD0014
TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard Product Number: AD0014 INTRODUCTION: Iodoacetamido-activated
More informationSupplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization
Supplementary Information for A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization Anand D Jeyasekharan 1, Yang Liu 1, Hiroyoshi Hattori 1,3, Venkat Pisupati
More informationLDL Uptake Cell-Based Assay Kit
LDL Uptake Cell-Based Assay Kit Item No. 10011125 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL INFORMATION
More informationPhospholipid Assay Kit
Phospholipid Assay Kit Catalog Number KA1635 100 assays Version: 06 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationCellular metabolism made easy: Microplate assays for mitochondrial function & glycolytic flux
Cellular metabolism made easy: Microplate assays for mitochondrial function & glycolytic flux Convenient Microplate Based Analysis of Cell Metabolism Resuspend Add Reagent Measure A simple push-button
More informationTitle: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis
Scientific Reports Supplementary information Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Authors: Ikuhiko
More informationSupplemental Data Figure S1 Effect of TS2/4 and R6.5 antibodies on the kinetics of CD16.NK-92-mediated specific lysis of SKBR-3 target cells.
Supplemental Data Figure S1. Effect of TS2/4 and R6.5 antibodies on the kinetics of CD16.NK-92-mediated specific lysis of SKBR-3 target cells. (A) Specific lysis of IFN-γ-treated SKBR-3 cells in the absence
More informationAdditional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript.
Supplemental Materials: I. Supplemental Methods II. Supplemental Figure Legends III. Supplemental Figures Supplemental Methods Cell Culture and Transfections for Wild Type and JNK1-/-,JNK2-/- MEFs: The
More informationSupporting Information. Non-thermal plasma with 2-deoxy-D-glucose synergistically induces cell death by targeting glycolysis in blood cancer cells
Supporting Information Non-thermal plasma with 2-deoxy-D-glucose synergistically induces cell death by targeting glycolysis in blood cancer cells Neha Kaushik, 1 Su Jae Lee, 2 Tae Gyu Choi 3, Ku Youn Baik,
More informationA ph-dependent Charge Reversal Peptide for Cancer Targeting
Supporting Information A ph-dependent Charge Reversal Peptide for Cancer Targeting Naoko Wakabayashi 1, Yoshiaki Yano 1, Kenichi Kawano 1, and Katsumi Matsuzaki 1 1 Graduate School of Pharmaceutical Sciences,
More informationConditional and reversible disruption of essential herpesvirus protein functions
nature methods Conditional and reversible disruption of essential herpesvirus protein functions Mandy Glaß, Andreas Busche, Karen Wagner, Martin Messerle & Eva Maria Borst Supplementary figures and text:
More information20S Proteasome Activity Assay Kit
20S Proteasome Activity Assay Kit For 100 Assays Cat. No. APT280 FOR RESEARCH USE ONLY NOT FOR USE IN DIAGNOSTIC PROCEDURES USA & Canada Phone: +1(800) 437-7500 Fax: +1 (951) 676-9209 Europe +44 (0) 23
More informationSupporting Information
Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 212. Supporting Information for Adv. Funct. Mater., DOI:.2/adfm.2122233 MnO Nanocrystals: A Platform for Integration of MRI and Genuine
More information