ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES

Size: px
Start display at page:

Download "ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES"

Transcription

1 ASSESSMENT OF CELLULAR OXYGEN GRADIENTS WITH A PANEL OF PHOSPHORESCENT OXYGEN-SENSITIVE PROBES Ruslan I. Dmitriev, Alexander V. Zhdanov, Greg Jasionek, Dmitri B. Papkovsky Biochemistry Department, University College Cork, Cork, Ireland SUPPLEMENTARY DATA DNA sequence insert (5 3 ): Green EGFP encoding sequence; Yellow R 9 encoding sequence. Gray restriction sites for cloning (BamHI and Hin diii). No color linker region. ggatccatggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacgg CCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCG GCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGtCcTTCAGCCGCTACCCCGACCAC ATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGG CAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCA AGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAG AAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACC CCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTAC AAGagatctggaggtggaAGACGTCGAAGACGTCGAAGACGTCGAtaagctt Predicted ER9Q protein, includes sequence encoded by the vector pqe: Red vector derived sequence; Green EGFP; Yellow R 9 ; 143 Da, 265 a.a., pi 8.76 MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYG VQSFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNS HNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAA GITLGMDELYKRSGGGRRRRRRRRR Figure S1. DNA coding and amino acid sequences of ER9Q protein. 1

2 A Absorbance, a.u Excitation Em ission Phosphorescence,a.u. B 1 1 C Phosphorescence lifetime, μ s Wavelength, nm PtCP-TFN conc., μm Time, min Average Phosphorescence F1,cps Cellviability, % μ M/ FCCP -.5 μ M/ DMSO -.5 μ M/ baseline Figure S2: Evaluation of the TFN-PtCP probe for O2 sensing. A: Excitation and emission spectra in air-saturated solution. B: Average phosphorescence intensity counts (F1) from PC12 cells loaded with -2 μm TFN-PtCP for 2 h; effect on cell viability is also shown. C: Monitoring of oxygenation of PC12 cells loaded with TFN-PtCP (.5, 2 μm for 2 h) and exposed to metabolic with 1 μm FCCP or DMSO (solvent) and 2.5 mm, presented in phosphorescence lifetime (τ) scale. Bars indicate time of effectors addition. 2

3 A ER9Q ER9Q brightfield ER9Q TMRM B Average phosphorescence, cps F Staining time,h Cellviability,% τ, μs C 1uM FCCP 2uM FCCP τ, μs D h FCCP- 6 h D MSO- 6 h FCCP- 2hD MSO- 2hFCCP- Figure S3: Evaluation of ER9Q-PtCP protein with PC12 cells. A: Fluorescent images of PC12 cells stained with ER9Q protein (green, plasma membranes) and mitochondria-specific dye TMRM (red). B: Average phosphorescence intensity counts (F1) obtained with PC12 cells incubated with 1 μm ER9Q- PtCP for different time intervals; cell viability is also shown (right axis). C, D: Monitoring of oxygenation of PC12 cells stained with ER9Q-PtCP probe at rest and upon metabolic with uncoupler (FCCP) and Ca 2+ chelator (), presented in phosphorescence lifetime scale (τ). Bars indicate the time of effector treatment. 3

4 TFN-Alexa 499 Chlathrin-mediated endosomes dextran 1,-Alexa 488 Macropinosomes CTX-Alexa 488 Lipid raft-mediated endosomes GFP-Rab6 Trans-Golgi network MitoCase12 Mitochondria Nano2 Hoechst Figure S4. The intracellular localization of Nano2 probe in MEF cells compared to markers of endocytosis and mitochondria. Brightfield and merged fluorescence (obtained from the same optical slices) images of the live MEF cells are shown. Cells were stained with Nano2 probe and with markers of organelles and imaged as described in Materials and methods section. Scale bar μm. 4

5 Phosphorescence Intensity (t1), cps 7 1 blank control Per-NP ER9Q Figure S5: Respiration profiles of MEF cells exposed to mimics of PC and IC probes and measured using MitoXpress probe. Cells were incubated in conditions of routine staining with probes in presence of non-phosphorescent mimics of Nano2 (Per-NP) and ER9Q-PtCP (unlabeled ER9Q protein) and subjected to OCR analysis with the help of MitoXpress probe. 5

A highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae

A highly selective AIE fluorogen for lipid droplet imaging in live cells and green algae Electronic Supporting Information highly selective IE fluorogen for lipid droplet imaging in live cells and green algae Erjing Wang, ab Engui Zhao, ab Yuning Hong, ab Jacky W. Y. Lam, ab and en Zhong Tang*

More information

Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection

Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 2014 Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic

More information

genome edited transient transfection, CMV promoter

genome edited transient transfection, CMV promoter Supplementary Figure 1. In the absence of new protein translation, overexpressed caveolin-1-gfp is degraded faster than caveolin-1-gfp expressed from the endogenous caveolin 1 locus % loss of total caveolin-1-gfp

More information

Supporting Information

Supporting Information Supporting Information Cancer Cell Membrane-Biomimetic Nanoprobes with Two-Photon Excitation and Near-Infrared Emission for Intravital Tumor Fluorescence Imaging Yanlin Lv 1,2,, Ming Liu 3,4,, Yong Zhang

More information

ab Intracellular O 2 Probe

ab Intracellular O 2 Probe ab140101 Intracellular O 2 Probe Instructions for Use For the measurement of intracellular oxygen in populations of live mammalian cells This product is for research use only and is not intended for diagnostic

More information

Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.)

Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum...1. Trademarks: HiLyte Fluor (AnaSpec, Inc.) Table of Contents Fluor TM Labeling Dyes Superior Fluorescent Labeling Dyes Spanning the Full Visible Spectrum....1 Fluor TM 405 Dye, an Excellent Alternative to Alexa Fluor 405 & DyLight 405....2 Fluor

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1 Induction of non-apoptotic death of SV40-transformed and primary DKO MEFs, and DKO thymocytes. (A-F) STS-induced non-apoptotic death of DKO MEF. (A, B) Reduced viability of DKO MEFs after exposure

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Supplementary Figure 1 SNARE Probes for FRET/2pFLIM Analysis Used in the Present Study. mturquoise (mtq) and Venus (Ven) are in blue and yellow, respectively. The soluble N-ethylmaleimide-sensitive

More information

Near-infrared fluorescent proteins

Near-infrared fluorescent proteins nature methods Near-infrared fluorescent proteins Dmitry Shcherbo, Irina I Shemiakina, Anastasiya V Ryabova, Kathryn E Luker, Bradley T Schmidt, Ekaterina A Souslova, Tatiana V Gorodnicheva, Lydia Strukova,

More information

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml)

- 1 - Cell types Monocytes THP-1 cells Macrophages. LPS Treatment time (Hour) IL-6 level (pg/ml) Supplementary Table ST1: The dynamic effect of LPS on IL-6 production in monocytes and THP-1 cells after GdA treatment. Monocytes, THP-1 cells and macrophages (5x10 5 ) were incubated with 10 μg/ml of

More information

Supporting Information

Supporting Information Supporting Information Toward High-Efficient Red Emissive Carbon Dots: Facile Preparation, Unique Properties, and Applications as Multifunctional Theranostic Agents Shan Sun,, Ling Zhang, Kai Jiang, Aiguo

More information

-51mV 30s 3mV. n=14 n=4 p=0.4. Depolarization (mv) 3

-51mV 30s 3mV. n=14 n=4 p=0.4. Depolarization (mv) 3 Supplementary Figure 1 a optoβ 2 -AR b ChR2-51mV 30s 3mV -50mV 30s 3mV c 4 n=14 n=4 p=0.4 Depolarization (mv) 3 2 1 0 Both optogenetic actuators, optoβ 2 AR and ChR2, were effective in stimulating astrocytes

More information

Breaking the depth dependency of phototherapy with Cerenkov radiation and low-radianceresponsive

Breaking the depth dependency of phototherapy with Cerenkov radiation and low-radianceresponsive SUPPLEMENTARY INFORMATION DOI: 10.1038/NNANO.2015.17 Breaking the depth dependency of phototherapy with Cerenkov radiation and low-radianceresponsive nanophotosensitizers Nalinikanth Kotagiri, Gail P.

More information

d e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information

d e f Spatiotemporal quantification of subcellular ATP levels in a single HeLa cell during changes in morphology Supplementary Information Ca 2+ level (a. u.) Area (a. u.) Normalized distance Normalized distance Center Edge Center Edge Relative ATP level Relative ATP level Supplementary Information Spatiotemporal quantification of subcellular

More information

Supporting Information

Supporting Information Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2018 Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 2016. Supporting Information

More information

Cell membrane penetration and mitochondrial targeting by platinumdecorated

Cell membrane penetration and mitochondrial targeting by platinumdecorated Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 2016 Cell membrane penetration and mitochondrial targeting by platinumdecorated ceria nanoparticles

More information

MII. Supplement Figure 1. CapZ β2. Merge. 250ng. 500ng DIC. Merge. Journal of Cell Science Supplementary Material. GFP-CapZ β2 DNA

MII. Supplement Figure 1. CapZ β2. Merge. 250ng. 500ng DIC. Merge. Journal of Cell Science Supplementary Material. GFP-CapZ β2 DNA A GV GVBD MI DNA CapZ β2 CapZ β2 Merge B DIC GFP-CapZ β2 Merge CapZ β2-gfp 250ng 500ng Supplement Figure 1. MII A early MI late MI Control RNAi CapZαβ DNA Actin Tubulin B Phalloidin Intensity(A.U.) n=10

More information

Supplementary Material

Supplementary Material Electronic Supplementary Material (ESI) for Integrative Biology. This journal is The Royal Society of Chemistry 2018 Supplementary Material 1 Supplemental Figures Supplemental Figure S1. Mechanical properties

More information

Lysosomes and endocytic pathways 9/27/2012 Phyllis Hanson

Lysosomes and endocytic pathways 9/27/2012 Phyllis Hanson Lysosomes and endocytic pathways 9/27/2012 Phyllis Hanson General principles Properties of lysosomes Delivery of enzymes to lysosomes Endocytic uptake clathrin, others Endocytic pathways recycling vs.

More information

McWilliams et al., http :// /cgi /content /full /jcb /DC1

McWilliams et al., http ://  /cgi /content /full /jcb /DC1 Supplemental material JCB McWilliams et al., http ://www.jcb.org /cgi /content /full /jcb.201603039 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. In vitro characterization of mito-qc. (A and B) Analysis

More information

Supplementary information Common molecular mechanism of amyloid pore formation by Alzheimer s -amyloid peptide and -synuclein

Supplementary information Common molecular mechanism of amyloid pore formation by Alzheimer s -amyloid peptide and -synuclein 1 Supplementary information Common molecular mechanism of amyloid pore formation by Alzheimer s -amyloid peptide and -synuclein by Coralie Di Scala, Nouara Yahi, Sonia Boutemeur, Alessandra Flores, Léa

More information

Fluorescence Microscopy

Fluorescence Microscopy Fluorescence Microscopy Imaging Organelles Mitochondria Lysosomes Nuclei Endoplasmic Reticulum Plasma Membrane F-Actin AAT Bioquest Introduction: Organelle-Selective Stains Organelles are tiny, specialized

More information

Nature Biotechnology: doi: /nbt.3828

Nature Biotechnology: doi: /nbt.3828 Supplementary Figure 1 Development of a FRET-based MCS. (a) Linker and MA2 modification are indicated by single letter amino acid code. indicates deletion of amino acids and N or C indicate the terminus

More information

Supplemental Data. Wu et al. (2010). Plant Cell /tpc

Supplemental Data. Wu et al. (2010). Plant Cell /tpc Supplemental Figure 1. FIM5 is preferentially expressed in stamen and mature pollen. The expression data of FIM5 was extracted from Arabidopsis efp browser (http://www.bar.utoronto.ca/efp/development/),

More information

Supplementary information

Supplementary information Supplementary information Lipid peroxidation causes endosomal antigen release for cross-presentation Ilse Dingjan 1, Daniëlle RJ Verboogen 1, Laurent M Paardekooper 1, Natalia H Revelo 1, Simone P Sittig

More information

Supporting Information For

Supporting Information For Supporting Information For MicroRNA-Catalyzed Cancer Therapeutics Based on DNA-Programmed Nanoparticle Complex Xucheng Luo, 1 Zhi Li, 1 Ganglin Wang, 1 Xuewen He, 2,3 Xiaoqin Shen, 1 Quanhong Sun, 1 Li

More information

Long-lived metal complexes open up microsecond lifetime imaging microscopy under multiphoton excitation: from FLIM to PLIM and beyond

Long-lived metal complexes open up microsecond lifetime imaging microscopy under multiphoton excitation: from FLIM to PLIM and beyond Supplementary Information Long-lived metal complexes open up microsecond lifetime imaging microscopy under multiphoton excitation: from FLIM to PLIM and beyond Elizabeth Baggaley, Stanley W. Botchway,

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/2/12/e1601838/dc1 Supplementary Materials for General and programmable synthesis of hybrid liposome/metal nanoparticles Jin-Ho Lee, Yonghee Shin, Wooju Lee, Keumrai

More information

Ryan McGarrigle, Ph.D.

Ryan McGarrigle, Ph.D. Cardiomyocyte function characterised through combined analysis of metabolic flux, beat rate and cellular oxygenation and its application in in vitro ischemia reperfusion modelling Ryan McGarrigle, Ph.D.

More information

Influenza virus exploits tunneling nanotubes for cell-to-cell spread

Influenza virus exploits tunneling nanotubes for cell-to-cell spread Supplementary Information Influenza virus exploits tunneling nanotubes for cell-to-cell spread Amrita Kumar 1, Jin Hyang Kim 1, Priya Ranjan 1, Maureen G. Metcalfe 2, Weiping Cao 1, Margarita Mishina 1,

More information

El Azzouzi et al., http ://www.jcb.org /cgi /content /full /jcb /DC1

El Azzouzi et al., http ://www.jcb.org /cgi /content /full /jcb /DC1 Supplemental material JCB El Azzouzi et al., http ://www.jcb.org /cgi /content /full /jcb.201510043 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. Acquisition of -phluorin correlates negatively with podosome

More information

Figure S1. Western blot analysis of clathrin RNA interference in human DCs Human immature DCs were transfected with 100 nm Clathrin SMARTpool or

Figure S1. Western blot analysis of clathrin RNA interference in human DCs Human immature DCs were transfected with 100 nm Clathrin SMARTpool or Figure S1. Western blot analysis of clathrin RNA interference in human DCs Human immature DCs were transfected with 100 nm Clathrin SMARTpool or control nontargeting sirnas. At 90 hr after transfection,

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. EBV-gB 23-431 mainly exists as trimer in HEK 293FT cells. (a) Western blotting analysis for DSS crosslinked FLAG-gB 23-431. HEK 293FT cells transfected

More information

Engineering a polarity-sensitive biosensor for time-lapse imaging of apoptotic processes and degeneration

Engineering a polarity-sensitive biosensor for time-lapse imaging of apoptotic processes and degeneration nature methods Engineering a polarity-sensitive biosensor for time-lapse imaging of apoptotic processes and degeneration Yujin E Kim, Jeannie Chen, Jonah R Chan & Ralf Langen Supplementary figures and

More information

Lysine analogue of Polymyxin B as a significant opportunity for photodynamic antimicrobial chemotherapy

Lysine analogue of Polymyxin B as a significant opportunity for photodynamic antimicrobial chemotherapy SUPPORTING INFORMATION Lysine analogue of Polymyxin B as a significant opportunity for photodynamic antimicrobial chemotherapy Florent Le Guern, Tan-Sothea Ouk *, Catherine Ouk, Regis Vanderesse +, Yves

More information

Prolonged mitotic arrest induces a caspase-dependent DNA damage

Prolonged mitotic arrest induces a caspase-dependent DNA damage SUPPLEMENTARY INFORMATION Prolonged mitotic arrest induces a caspase-dependent DNA damage response at telomeres that determines cell survival Karolina O. Hain, Didier J. Colin, Shubhra Rastogi, Lindsey

More information

nature methods Organelle-specific, rapid induction of molecular activities and membrane tethering

nature methods Organelle-specific, rapid induction of molecular activities and membrane tethering nature methods Organelle-specific, rapid induction of molecular activities and membrane tethering Toru Komatsu, Igor Kukelyansky, J Michael McCaffery, Tasuku Ueno, Lidenys C Varela & Takanari Inoue Supplementary

More information

B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer

B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small cell lung cancer Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2017 Experimental Methods Cell culture B16-F10 (Mus musculus skin melanoma), NCI-H460 (human non-small

More information

bio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM.

bio-mof-1 DMASM Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. bio-mof-1 Transmittance bio-mof-1 DMASM DMASMI 2000 1500 1000 500 Wavenumber (cm -1 ) Supplementary Figure S1 FTIR spectra of bio-mof-1, DMASMI, and bio-mof-1 DMASM. Intensity (a.u.) bio-mof-1 DMASM as

More information

Supplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems

Supplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems Supplementary Figure 1 Overview of steps in the construction of photosynthetic protocellular systems (a) The small unilamellar vesicles were made with phospholipids. (b) Three types of small proteoliposomes

More information

Quantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles

Quantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles Quantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles Amin Feizpour Reinhard Lab Department of Chemistry and the Photonics Center, Boston University, Boston, MA May 2014

More information

Supporting Information

Supporting Information Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Supporting Information A new ICT and CHEF based visible light excitable fluorescent probe easily

More information

Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression.

Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. Supplementary Figure 1 Lentiviral Delivery of Combinatorial mirna Expression Constructs Provides Efficient Target Gene Repression. a, Design for lentiviral combinatorial mirna expression and sensor constructs.

More information

A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo

A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Supporting Information A novel quinoline-based two-photon fluorescent probe for detecting Cd 2+ in vitro and in vivo Yiming Li, a,b Hanbao Chong, a Xiangming Meng,* a Shuxin Wang, a Manzhou Zhu a and Qingxiang

More information

LDL Uptake Cell-Based Assay Kit

LDL Uptake Cell-Based Assay Kit LDL Uptake Cell-Based Assay Kit Catalog Number KA1327 100 assays Version: 07 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay...

More information

Carbon-1 versus carbon-3 linkage of D-galactose to porphyrins: Synthesis, uptake, and photodynamic efficiency

Carbon-1 versus carbon-3 linkage of D-galactose to porphyrins: Synthesis, uptake, and photodynamic efficiency Supporting information for Carbon-1 versus carbon-3 linkage of D-galactose to porphyrins: Synthesis, uptake, and photodynamic efficiency Patrícia M. R. Pereira #, Waqar Rizvi #, N. V. S. Dinesh K. Bhupathiraju,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7

More information

Tyrodes solution in a custom-built imaging chamber as described previously. Images were acquired

Tyrodes solution in a custom-built imaging chamber as described previously. Images were acquired Supplemental Material Supplemental Methods Electrical stimulation of CX-G3-labeled hippocampal neurons Following 5 min incubation in 0.5 µm CX-G3 and washes, 18-20 DIV neurons were imaged in normal Tyrodes

More information

Supplementary table and figures

Supplementary table and figures 3D single molecule tracking with multifocal plane microscopy reveals rapid intercellular transferrin transport at epithelial cell barriers Sripad Ram, Dongyoung Kim, Raimund J. Ober and E. Sally Ward Supplementary

More information

Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard. Product Number: AD0013

Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard. Product Number: AD0013 TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard Product Number: AD0013 INTRODUCTION: Fluorescent isothiocyanato-activated

More information

THE ROLE OF ALTERED CALCIUM AND mtor SIGNALING IN THE PATHOGENESIS OF CYSTINOSIS

THE ROLE OF ALTERED CALCIUM AND mtor SIGNALING IN THE PATHOGENESIS OF CYSTINOSIS Research Foundation, 18 month progress report THE ROLE OF ALTERED CALCIUM AND mtor SIGNALING IN THE PATHOGENESIS OF CYSTINOSIS Ekaterina Ivanova, doctoral student Elena Levtchenko, MD, PhD, PI Antonella

More information

Electronic Supporting Information for

Electronic Supporting Information for Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Electronic Supporting Information for Rhodamine based Turn-On Fluorescent Probe for Pb(II)

More information

A Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells

A Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells Supporting Information for A Single fluorescent probe for Dual-imaging Viscosity and H 2 O 2 in Mitochondria with Different Fluorescence Signals in Living Cells Mingguang Ren, Beibei Deng, Kai Zhou, Xiuqi

More information

Supporting Information. Light-enhanced hypoxia-response of conjugated polymer nanocarrier. for successive synergistic photodynamic and chemo-therapy

Supporting Information. Light-enhanced hypoxia-response of conjugated polymer nanocarrier. for successive synergistic photodynamic and chemo-therapy Supporting Information Light-enhanced hypoxia-response of conjugated polymer nanocarrier for successive synergistic photodynamic and chemo-therapy Xiaolong Zhang a,d, Ming Wu a,d, Jiong Li a,c,d, Shanyou

More information

Singlet oxygen photosensitisation by the fluorescent probe Singlet Oxygen Sensor Green

Singlet oxygen photosensitisation by the fluorescent probe Singlet Oxygen Sensor Green Singlet oxygen photosensitisation by the fluorescent probe Singlet Oxygen Sensor Green Xavier Ragàs, Ana Jiménez-Banzo, David Sánchez-García, Xavier Batllori and Santi Nonell* Grup d Enginyeria Molecular,

More information

Supplemental Data. Supplemental Text

Supplemental Data. Supplemental Text Supplemental Data The magnitude of the light-induced conformational change in different rhodopsins correlates with their ability to activate G proteins. Hisao Tsukamoto, David L. Farrens, Mitsumasa Koyanagi

More information

Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) .

Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) . Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) The inhibitory effects of new antibodies (Mab17 and Mab18). They were investigated in in vitro fertilization

More information

LANCE Eu-W1024 ITC Chelate & Europium Standard AD0013 Development grade

LANCE Eu-W1024 ITC Chelate & Europium Standard AD0013 Development grade AD0017P-4 (en) 1 LANCE Eu-W1024 ITC Chelate & Europium Standard AD0013 Development grade INTRODUCTION Fluorescent isothiocyanato-activated (ITC-activated) Eu-W1024 chelate is optimized for labelling proteins

More information

CH 7 CELL STRUCTURE AND FUNCTION

CH 7 CELL STRUCTURE AND FUNCTION 1 Review What is a cell Explain What three statements make up the cell theory Infer How did the invention of the microscope help the development of the cell theory 2 Review How do microscopes work Apply

More information

SUPPORTING INFORMATION

SUPPORTING INFORMATION SUPPORTING INFORMATION SUPPLEMENTARY FIGURE LEGENDS Fig. S1. Separation of non-dissolved nanoparticles. Tests were conducted on the separation of non-dissolved nanoparticles added in excess to BEGM (A)

More information

Electronic Supplementary Information (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2012

Electronic Supplementary Information (ESI) for Lab on a Chip. This journal is The Royal Society of Chemistry 2012 Electronic Supplementary Information (ESI) for Lab on a Chip Electronic Supplementary Information Construction of oxygen and chemical concentration gradients in a single microfluidic device for studying

More information

A. Generation and characterization of Ras-expressing autophagycompetent

A. Generation and characterization of Ras-expressing autophagycompetent Supplemental Material Supplemental Figure Legends Fig. S1 A. Generation and characterization of Ras-expressing autophagycompetent and -deficient cell lines. HA-tagged H-ras V12 was stably expressed in

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nature6416 Supplementary Notes Spine Ca 2+ signals produced by glutamate uncaging We imaged uncaging-evoked [Ca 2+ ] transients in neurons loaded with a green Ca 2+ - sensitive indicator (G;

More information

Supplemental Information for: Localization of anionic phospholipids in Escherichia coli cells

Supplemental Information for: Localization of anionic phospholipids in Escherichia coli cells Supplemental Information for: Localization of anionic phospholipids in Escherichia coli cells Piercen M. Oliver, a John A. Crooks, a Mathias Leidl, b Earl J. Yoon, a Alan Saghatelian, b and Douglas B.

More information

Supplementary figure legends

Supplementary figure legends Supplementary figure legends Supplementary Figure 1. Exposure of CRT occurs independently from the apoptosisassociated loss of the mitochondrial membrane potential (MMP). (A) HeLa cells treated with MTX

More information

Synergistic effects of antioxidative peptides from rice bran

Synergistic effects of antioxidative peptides from rice bran Synergistic effects of antioxidative peptides from rice bran Pichamon Kiatwuthinon 1,*, Neeracha Lapanusorn 1, Anunyaporn Phungsom 1, Wirawan Tinanchai 1 1 Department of Biochemistry, Faculty of Science,

More information

Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow

Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow SUPPLEMENTARY DATA Supplementary Figure Legends Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow cytometry analysis of PMVs labelled with annexin-v-pe (Guava technologies)

More information

SOD1 inhibition reduces non-small cell lung cancer by inducing cell death

SOD1 inhibition reduces non-small cell lung cancer by inducing cell death SUPPLEMENTAL INFORMATION SOD1 inhibition reduces non-small cell lung cancer by inducing cell death Andrea Glasauer, Laura A. Sena, Lauren P. Diebold, Andrew P. Mazar & Navdeep S. Chandel Inventory of Supplemental

More information

SUPPLEMENTARY DATA. Biologie and Pathology, Grenoble, France,

SUPPLEMENTARY DATA. Biologie and Pathology, Grenoble, France, SUPPLEMENTARY DATA MitoCeption as a new tool to assess the effects of mesenchymal stem/stromal cell mitochondria on cancer cell metabolism and functions Andrés Caicedo a,b, Vanessa Fritz c, Jean-Marc Brondello

More information

Ananya Baksi CY11D042

Ananya Baksi CY11D042 Insulin-Directed Synthesis of Fluorescent Gold Nanoclusters: Preservation of Insulin Bioactivity and Versatility in Cell Imaging Angew. Chem. Int. Ed. 2011, 50, 7056 7060 Chien-Liang Liu, Hung-Tsung Wu,

More information

J. Cell Sci. 129: doi: /jcs : Supplementary information

J. Cell Sci. 129: doi: /jcs : Supplementary information Movie 1. AgLDL is contained in small sub-regions of the lysosomal synapse that are acidic. J774 cells were incubated with agldl dual labeled with a ph sensitive and a ph insensitive fluorophore for 1 hr.

More information

Supplements. Figure S1. B Phalloidin Alexa488

Supplements. Figure S1. B Phalloidin Alexa488 Supplements A, DMSO, PP2, PP3 Crk-myc Figure S1. (A) Src kinase activity is necessary for recruitment of Crk to Nephrin cytoplasmic domain. Human podocytes expressing /7-NephrinCD () were treated with

More information

Supplementary Figure S1

Supplementary Figure S1 Supplementary Figure S1 Supplementary Figure S1. PARP localization patterns using GFP-PARP and PARP-specific antibody libraries GFP-PARP localization in non-fixed (A) and formaldehyde fixed (B) GFP-PARPx

More information

Imaging energy status in live cells with a fluorescent biosensor of the intracellular ATP-to-ADP. ratio

Imaging energy status in live cells with a fluorescent biosensor of the intracellular ATP-to-ADP. ratio Imaging energy status in live cells with a fluorescent biosensor of the intracellular ATP-to-ADP ratio Mathew Tantama, Juan Ramón Martínez-François, Rebecca Mongeon, Gary Yellen* Department of Neurobiology,

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1: cholesterol manipulation alters the positioning of autophagosomes in cells, related to figure 1. (a) HeLa cells were treated for 24h under conditions reducing

More information

Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS)

Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS) and their exosomes (EXO) in resting (REST) and activated

More information

Supplementary Information. Acoustically-Mediated Intracellular Nanoparticle and Macromolecule Delivery

Supplementary Information. Acoustically-Mediated Intracellular Nanoparticle and Macromolecule Delivery Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 218 Supplementary Information Acoustically-Mediated Intracellular Nanoparticle and Macromolecule Delivery

More information

Supplementary Information. Solvatochromic Dye LDS 798 as Microviscosity and ph Probe

Supplementary Information. Solvatochromic Dye LDS 798 as Microviscosity and ph Probe Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the Owner Societies 2017 Supplementary Information Solvatochromic Dye LDS 798 as Microviscosity and ph Probe

More information

SHG Nanoprobes: Advancing harmonic imaging in biology. Periklis (Laki) Pantazis

SHG Nanoprobes: Advancing harmonic imaging in biology. Periklis (Laki) Pantazis SHG Nanoprobes: Advancing harmonic imaging in biology Periklis (Laki) Pantazis fluorescence microscopy in biomedical research: impact of fluorescent proteins 1960s and 1970s 1992 and 1994 1995 1996 wt-gfp

More information

Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted

Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted Supplementary Figure 1: Imaging T-ALL progression and growth in transplanted rag2e450fs fish. Monoclonal T-ALLs were serially passaged in strain fish and then used as donors (left panel). Cells were transplanted

More information

INTRODUCTION. This material is quoted from below PDF and modified.

INTRODUCTION. This material is quoted from below PDF and modified. INTRODUCTION While drug response profiling of cancer cells in two-dimensional culture has been a mainstay of predictive biomarker discovery and anti-cancer drug development, there are aspects of tumor

More information

33VASTVNGATSANNHGEPPS51PADARPR58

33VASTVNGATSANNHGEPPS51PADARPR58 Pro-rich region Trans-membrane region 214 246 359 381 UL50 1 397 211SSRTAS216PPPPPR222 NLS CR1 CR2 CR3 CR4 UL53 1 376 11RERRS15ALRS19LLRKRRR25 33VASTVNGATSANNHGEPPS51PADARPR58 FIG S1. UL97 phosphorylation

More information

WT MSD MPS-IIIA. Lysosomal ph

WT MSD MPS-IIIA. Lysosomal ph 7 6 Lysosomal ph 5 4 3 2 1 Supplementary figure S1. Lysosomal ph was measure in, and MPSIIIA MEFs using a Lysosensor yellow/blue-dextran (Molecular Probes) as a lysosomal ph indicator (see methods). P

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/7/334/rs4/dc1 Supplementary Materials for Rapidly rendering cells phagocytic through a cell surface display technique and concurrent Rac activation Hiroki Onuma,

More information

Supplementary Information

Supplementary Information Electronic Supplementary Material (ESI) for Analyst. This journal is The Royal Society of Chemistry 2018 Supplementary Information Spying on Protein Interactions in Living Cells with Reconstituted Scarlet

More information

Supporting Information

Supporting Information Supporting Information Fig. S1. Overexpression of Rpr causes progenitor cell death. (A) TUNEL assay of control intestines. No progenitor cell death could be observed, except that some ECs are undergoing

More information

Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard. Product Number: AD0014

Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard. Product Number: AD0014 TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard Product Number: AD0014 INTRODUCTION: Iodoacetamido-activated

More information

Supplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization

Supplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization Supplementary Information for A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization Anand D Jeyasekharan 1, Yang Liu 1, Hiroyoshi Hattori 1,3, Venkat Pisupati

More information

LDL Uptake Cell-Based Assay Kit

LDL Uptake Cell-Based Assay Kit LDL Uptake Cell-Based Assay Kit Item No. 10011125 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL INFORMATION

More information

Phospholipid Assay Kit

Phospholipid Assay Kit Phospholipid Assay Kit Catalog Number KA1635 100 assays Version: 06 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Cellular metabolism made easy: Microplate assays for mitochondrial function & glycolytic flux

Cellular metabolism made easy: Microplate assays for mitochondrial function & glycolytic flux Cellular metabolism made easy: Microplate assays for mitochondrial function & glycolytic flux Convenient Microplate Based Analysis of Cell Metabolism Resuspend Add Reagent Measure A simple push-button

More information

Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis

Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Scientific Reports Supplementary information Title: Vectorization of biomacromolecules into cells using extracellular vesicles with enhanced internalization induced by macropinocytosis Authors: Ikuhiko

More information

Supplemental Data Figure S1 Effect of TS2/4 and R6.5 antibodies on the kinetics of CD16.NK-92-mediated specific lysis of SKBR-3 target cells.

Supplemental Data Figure S1 Effect of TS2/4 and R6.5 antibodies on the kinetics of CD16.NK-92-mediated specific lysis of SKBR-3 target cells. Supplemental Data Figure S1. Effect of TS2/4 and R6.5 antibodies on the kinetics of CD16.NK-92-mediated specific lysis of SKBR-3 target cells. (A) Specific lysis of IFN-γ-treated SKBR-3 cells in the absence

More information

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript.

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript. Supplemental Materials: I. Supplemental Methods II. Supplemental Figure Legends III. Supplemental Figures Supplemental Methods Cell Culture and Transfections for Wild Type and JNK1-/-,JNK2-/- MEFs: The

More information

Supporting Information. Non-thermal plasma with 2-deoxy-D-glucose synergistically induces cell death by targeting glycolysis in blood cancer cells

Supporting Information. Non-thermal plasma with 2-deoxy-D-glucose synergistically induces cell death by targeting glycolysis in blood cancer cells Supporting Information Non-thermal plasma with 2-deoxy-D-glucose synergistically induces cell death by targeting glycolysis in blood cancer cells Neha Kaushik, 1 Su Jae Lee, 2 Tae Gyu Choi 3, Ku Youn Baik,

More information

A ph-dependent Charge Reversal Peptide for Cancer Targeting

A ph-dependent Charge Reversal Peptide for Cancer Targeting Supporting Information A ph-dependent Charge Reversal Peptide for Cancer Targeting Naoko Wakabayashi 1, Yoshiaki Yano 1, Kenichi Kawano 1, and Katsumi Matsuzaki 1 1 Graduate School of Pharmaceutical Sciences,

More information

Conditional and reversible disruption of essential herpesvirus protein functions

Conditional and reversible disruption of essential herpesvirus protein functions nature methods Conditional and reversible disruption of essential herpesvirus protein functions Mandy Glaß, Andreas Busche, Karen Wagner, Martin Messerle & Eva Maria Borst Supplementary figures and text:

More information

20S Proteasome Activity Assay Kit

20S Proteasome Activity Assay Kit 20S Proteasome Activity Assay Kit For 100 Assays Cat. No. APT280 FOR RESEARCH USE ONLY NOT FOR USE IN DIAGNOSTIC PROCEDURES USA & Canada Phone: +1(800) 437-7500 Fax: +1 (951) 676-9209 Europe +44 (0) 23

More information

Supplementary Figure 1 (Mu)

Supplementary Figure 1 (Mu) Supplementary Figure 1 (Mu) SBP (mmhg) 2 18 16 p

More information

Supporting Information

Supporting Information Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 212. Supporting Information for Adv. Funct. Mater., DOI:.2/adfm.2122233 MnO Nanocrystals: A Platform for Integration of MRI and Genuine

More information