raav vector-mediated sarcogylcan gene transfer in a hamster model for limb girdle muscular dystrophy
|
|
- Bertram Morris
- 6 years ago
- Views:
Transcription
1 Gene Therapy (1999) 6, Stockton Press All rights reserved /99 $ raav vector-mediated sarcogylcan gene transfer in a hamster model for limb girdle muscular dystrophy JLi 1, D Dressman 1, YP Tsao 1,6, A Sakamoto 2, EP Hoffman 1,3,4,5 and X Xiao 1 Departments of 1 Molecular Genetics and Biochemistry, 3 Human Genetics, 4 Pediatrics, and 5 Neurology, University of Pittsburgh School of Medicine, Pittsburgh, PA, USA; 2 National Cardiovascular Center, Osaka, Japan; and 6 National Defense Medical Center, Taipei, Taiwan The limb girdle muscular dystrophies (LGMD) are a geneti- sarcoglycan-deficient hamster model (Bio14.6). We show cally and phenotypically heterogeneous group of degener- efficient delivery and widespread expression of -sarcoglyative neuromuscular diseases. A subset of the genetically can after a single intramuscular injection. Importantly, raav recessive forms of LGMD are caused by mutations in the vector containing the human -sarcoglycan cdna restored four muscle sarcoglycan genes (,, and ). The coding secondary biochemical deficiencies, with correct localizsequences of all known sarcoglycan genes are smaller ation of other sarcoglycan proteins to the muscle fiber than 2 kb, and thus can be readily packaged in recombi- membrane. Interestingly, restoration of -, as well as nant adeno-associated virus (raav) vectors. Previously, sarcoglycan was homogeneous and properly localized we have demonstrated highly efficient and sustained trans- throughout transduced muscle, and appeared unaffected duction in mature muscle tissue of immunocompetent ani- by dramatic overexpression of -sarcoglycan in the cytomals with raav vectors. In this report, we utilize recombi- plasm of some myofibers. These results support the feasinant AAV containing the -sarcoglycan gene for genetic bility of raav vector s application to treat LGMD by means complementation of muscle diseases using a - of direct in vivo gene transfer. Keywords: raav; sarcoglycan; limb girdle muscular dystrophy; Bio14.6 hamster Introduction The recombinant adeno-associated virus (raav) vector is a promising gene delivery system, which is derived from defective and nonpathogenic human parvoviruses. 1,2 The vector system offers a number of attractive featues for gene therapy, including transduction of both dividing and nondividing cells, the lack of CTL immune reactions and genomic integration. In contrast to other viral vectors, 3,4 raav is capable of efficiently bypassing the myofiber basal lamina and transducing mature muscle cells, which is particularly desirable for in vivo muscle gene transfer. We and others have successfully demonstrated that raav vectors harboring foreign genes, such as lacz, are capable of achieving highly efficient and sustained gene transfer in the mature muscle of immunocompetent animals for more than 1.5 years without detectable toxicity. 5 8 In addition, muscle tissue has been successfully used as a platform for raav-mediated therapeutic gene transfer for metabolic diseases and secreted proteins However, no experiments using raav vectors to restore the functional deficits in muscle tissue itself have been reported. The limb girdle muscular dystrophies (LGMD) are a heterogeneous group of inherited neuromuscular diseases characterized by proximal muscular weakness and Correspondence: X Xiao, Department of Molecular Genetics and Biochemistry, Room W1213, BST, University of Pittsburgh, Pittsburgh, PA 15261, USA Received 28 July 1998; accepted 30 September 1998 variable progression of symptoms. The disease is caused by mutations in a number of responsible genes, including sarcoglycan genes (LGMD 2D), (LGMD 2E), (LGMD 2C) and (LGMD 2F), respectively. 14,18 24 While the phenotype of the sarcoglycanopathies is variable, patients often show a severe progression, with fatality in the second or third decade. No effective treatment is available. 14,19 28 The sarcoglycans are relatively small (cdna 2 kb), transmembrane glycoproteins. The four commonly known sarcoglycans (,, and ) associate with each other in equal stoichiometry forming a hetero-tetramer, namely the sarcoglycan complex. Immunofluorescent studies of muscle samples from some LGMD patients and dystrophic animals have revealed that a primary deficiency of one component in the sarcoglycan complex leads to partial or complete absence of all the other sarcoglycan proteins on the sarcolemma. This suggests that these proteins are mutually dependent on each other for assembly and stability in the plasma membrane of muscle cells. 20,29 33 The sarcoglycan genes are expressed either exclusively (, and ) or predominantly ( ) in striated muscle. Recently a fifth sarcoglycan ( ) has been identified, however, with a broad gene expression pattern in various tissues including muscle. 34,35 Until recently, the development of gene therapy strategies to treat LGMD have been hampered by the lack of a proper animal model. The newly discovered mutation in the -sarcoglycan gene in a dystrophic hamster has provided a model for LGMD. 30,31 The inbred Syrian hamster Bio14.6 was identified in 1962, and shown to have
2 an autosomal recessive cardiomyopathy. 36 In addition to the pathology of cardiac muscle, the skeletal muscle of Bio14.6 hamsters also displays classical signs of myopathy, such as necrosis, central nucleation and variable size of myofibers. Recently, the genetic cause for the dystrophic disease in the hamster has been identified as a deletion in the promoter and the 5 untranslated region of the -sarcoglycan gene. 30,31 The deletion leads to the loss of mrna and consequently the absence of -sarcoglycan protein on the sarcolemma. 30,31 Consistent with the human sarcoglycanopathies, primary loss of -sarcoglycan also results in deficiency in all four sarcoglycans on the sarcolemma. The similarity of muscle histology, pathology and protein biochemistry between Bio14.6 hamster and human patients renders this animal an excellent model system to explore the possibility of gene therapy strategies for LGMD diseases. In the present study, we utilize the Bio14.6 hamster as the LGMD animal model and raav as the gene delivery vector to test the hypothesis that a genetic defect in muscle tissue can be complemented by means of direct intramuscular gene transfer. We report the first successful intramuscular injection of an raav vector containing the human -sarcoglycan cdna into the deficient Bio14.6 hamsters, and efficient transgene expression in muscle tissue from the vector. In addition, the human -sarcoglycan protein product has been correctly targeted to the muscle cell membrane, leading to the restoration of the sarcoglycan complex to the sarcolemma. Results Efficient transduction of regenerating muscle cells by raav vector Previously, we have demonstrated efficient and longterm transduction by AAV vectors in post-mitotic myofibers in mature muscle tissue of immunocompetent animals. 5,10 Snyder et al 37 have extended the in vivo studies from post-mitotic muscle tissue 5 to acutely regenerating muscle tissue, which was created by administration of a myotoxin, barium chloride. No experiment has been reported to date using raav vectors in pathological muscle caused by inherited defects. To test if raav vector efficiently transduces regenerating muscle in muscular dystrophies, we injected 30 l of raav-lacz vector ( viral particles) into the hindleg gastrocnemius muscle of 40-day-old Bio14.6 hamsters. This muscle suffers extensive degeneration and regeneration caused by sarcoglycan deficiency. Hematoxylin and eosin (H&E) staining revealed profound regeneration with the characteristic centrally localized nuclei (Figure 1b), indicating muscle pathology in the Bio14.6 hamsters. Our in vivo vector injection results showed efficient transduction of regenerating muscle in these pathologic animals (Figure 1c and d), as visualized by X-gal staining, and H&E counterstaining of the muscle sections at 3 weeks after vector injection. As expected, the healthy control hamster F1B muscle was also efficiently transduced (Figure 1a). H&E staining in both dystrophic and normal muscle injected with the raav-lacz vector did not reveal cytotoxicity and lymphocyte infiltration, supporting the notion that raav vector carrying a foreign gene does not cause host CTL reactions. 5,7,38 Expression of -sarcoglycan gene in dystrophic hamster muscle from raav vector Encouraged by the results of efficient transduction in regenerating muscle with the AAV-LacZ reporter vector, we constructed an raav vector (paav-cmv- SG) containing the human -sarcoglycan gene under the control of CMV promoter (for details see Materials and methods). This promoter has been shown to exhibit elevated and sustained activity in muscle tissue in the context of raav. 5 7,39 42 Using this construct, we produced and purified high-titer, Ad-free AAV-CMV- SG viral vector stocks by the three-plasmid cotransfection method we have described previously. 42 To demonstrate the capability of producing -sarcoglycan protein by AAV-CMV- SG vector in infected cells, we initially performed an in vitro assay. Since no -sarcoglycan-defective muscle cell line was available, we tested the AAV-CMV- SG viral stock in human 293 cells, which do not express endogenous -sarcoglycan gene. We examined -sarcoglycan protein synthesis by Western blot using a polyclonal antibody, which recognizes a conserved region of -sarcoglycan in human, mouse and hamster. 31 Mock-infected 293 cells were used as a negative control (Figure 2a, lane 1), while normal mouse muscle tissue was used as a positive control (Figure 2a, lane 3). Human 293 cells infected with AAV-CMV- SG vector produced large quantities of -sarcoglycan at the expected molecular weight (Figure 2a, lane 2) compared with the normal mouse muscle tissue (Figure 2a, lane 3). This suggested that the expression cassette under the control of CMV promoter in 293 cells was highly active. The AAV-CMV- SG vector gene expression was then tested for its ability to complement sarcoglycan deficiency in muscle in vivo by intramuscular injection into the -sarcoglycan-defective Bio14.6 hamsters. Thirty microliters of AAV-CMV- SG vector ( viral particles) was injected into the hindleg muscle (gastrocnemius) of 40-day-old Bio14.6 hamsters. The gastrocnemius muscle tissues were harvested at 3 weeks after vector injection from two hamsters and subjected to Western blot analysis. As shown in Figure 2b, muscle tissues from the two Bio14.6 hamsters injected with the AAV vector produced significant quantities of -sarcoglycan protein (Figure 2b, lanes 1 and 2). As expected, the dystrophic muscle untreated with AAV vector revealed no immunoblot signal for -sarcoglycan (Figure 2b, lane 3), while the control F1B hamster muscle showed a positive immunoblot signal (Figure 2b, lane 4). The -sarcoglycan protein levels from the vector-treated dystrophic muscle were approximately one-third of those of wildtype F1B hamster muscle. For Western blot, we solubilized a large piece of gastrocnemius muscle tissue complex from each animal. Thus, the 30% levels relative to normal muscle reflects localized regions of delivery by intramuscular injection and localized overexpression, and do not reflect the vector gene expression levels in individually transduced myofibers. To determine the extent of raav vector-mediated sarcoglycan expression in individual myofibers, immunofluorescent localization of -sarcoglycan was carried out on cryosections of muscle. The -sarcoglycan protein produced in muscle fibers following intramuscular injection of AAV-CMV- SG vector was correctly localized to sarcolemma in large groups of myofibers (Figure 3a). However, many myofibers showed overexpression of -sarco- 75
3 76 Figure 1 AAV-LacZ transduction in hindleg muscle of normal and Bio14.6 dystrophic hamsters. AAV-LacZ vector (30 l) was injected into the gastrocnemius muscle of hindlegs of 40-day-old animals. Three weeks after vector injection, the animals were killed and muscle sample processed with X-gal and H&E staining. (a) normal F1B hamster transduced with raav-lacz; (b) Bio14.6 hamster muscle, H&E staining. Note the numerous centrally localized nuclei indicative of muscle regeneration. (c) Bio14.6 hamster injected with AAV-LacZ, X-gal and H&E staining. Note that X-gal staining was too prominent to see the centrally localized myofiber nuclei after H&E staining. (d) An enlarged area of (c). Note the numerous LacZ-positive centrally nucleated myofibers. Also not the heterogeneous sizes of the myofibers. Original magnification: (a) and (c) at 4 objective and (b) and (d) at 10 objective. glycan protein, leading to substantial staining in the cytoplasm of these fibers (see leftward arrow in Figure 3a). Overexpression of the human -sarcoglycan gene did not result in any discernable histopathology in these myofibers. Restoration of the sarcoglycan complex To assess the ability of the -sarcoglycan protein to restore the membrane localization of the other components in the sarcoglycan complex, immunofluorescent staining was used to examine further the vector-treated muscle. If the -sarcoglycan gene delivered by the raav vector is functional, the gene product should correctly localize itself to the sarcolemma and form a stable sarcoglycan complex with other sarcoglycan proteins (, and ). Flash-frozen, unfixed muscle samples from Bio14.6 hamsters were cryosectioned at 3 weeks after intramuscular vector injection. To detect vector-mediated -sarcoglycan gene expression, the fresh muscle frozen sections (5 m) were immediately blocked in 10% horse serum/pbs. Monoclonal antibody against human -sarcoglycan was used in conjugation with Cy-3-labeled anti-mouse antibody for detection. Immunostaining of adjacent cryosections for -sarcoglycan (Figure 3a) and -sarcoglycan (Figure 3b) showed that vector-mediated exogenous -sarcoglycan gene expression led to restoration of endogenous -sarcoglycan in all myofibers. This analysis showed a number of important points. First, myofibers expressing relatively low levels of -sarcoglycan still achieved levels of -sarcoglycan, which are indistinguishable from normal muscle (Figures 3 and 4). Second, overexpression of -sarcoglycan in the cytoplasm of some myofibers did not lead to incorrect location of -sarcoglycan (see rightward arrow, Figure 3a and b). Thus, the secondary deficiency of -sarcoglycan 20,29 33 was rescued by raav vector delivery, independent of the levels of -sarcoglycan expression. Adjacent cryosections from normal hamster, dystrophic hamster and dystrophic hamster treated with AAV-CMV- SG vector were immunostained for -, and -sarcoglycan (Figure 4). Secondary deficiency of sarcoglycan was also completely rescued by the vector delivery. Similar to the results of -sarcoglycan, overexpression of -sarcoglycan did not disrupt the normal membrane localization of -sarcoglycan (Figure 4). In
4 Figure 2 Western analysis of -sarcoglycan gene expression in vitro and in vivo. (a) -Sarcoglycan gene expression in human 293 cells infected in vitro with AAV-CMV- SG vector. Normal mouse muscle tissue was used as a positive control. Note the robust gene expression of the raav vector in 293 cells. (b) -Sarcoglycan gene expression in vivo in Bio14.6 hamster gastrocneumius muscle after AAV-CMV- SG vector injection. Normal hamster muscle was used as a positive control. addition, the overexpression of human -sarcoglycan evidently did not appear to cause cytotoxicity and lymphocyte infiltration, consistent with the previous findings that there is a lack of host CTL response to raav-transduced cells. 5 8 Discussion We have shown the successful use of raav as a gene vector for genetic and biochemical rescue of the Bio14.6 hamster, a homologous animal model for LGMD. We have shown efficient gene transfer and expression of the human -sarcoglycan gene in the -sarcoglycan-deficient hamster muscle. Expression of -sarcoglycan from the raav vector led to the restoration of the secondary biochemical defects; specifically, both - and -sarcoglycan were localized to the myofiber membrane in a manner indistinguishable from normal hamster muscle. Although we did not perform immunostaining of the fourth sarcoglycan component ( ) due to the unavailability of a working antibody for this hamster protein, the biochemical property of the sarcoglycan complex suggests that the sarcoglycan must have also been correctly reconstituted into the complex, because the sarcoglycan complex cannot be stably formed without the presence of all four proteins. In fact, successful adenoviral vector-directed human -sarcoglycan gene transfer in Bio14.6 hamster has been recently reported. 43 These experiments indicate that exogenously delivered human -sarcoglycan gene is biochemically functional in the dystrophic hamster muscle cells. Further studies are needed to test for physiological functional improvement of the treated muscle, such as increase of muscle strength and protection of muscle cell membrane integrity, afer raav-mediated -sarcoglycan gene delivery. However, our results prove the concept that a deficiency of muscle function caused by a recessive genetic mutation can be complemented by intramuscular injection of an raav vector carrying the corresponding gene. raav is currently the best available candidate vector for gene therapy of inherited muscle disease. The vector system offers numerous advantages for in vivo muscle gene transfer. However the 5 kb packaging limit precludes its utility for some of the more common muscle diseases. For example, the most common muscular disease is Duchenne muscular dystrophy caused by dystrophin deficiency. 44 The cdna for dystrophin protein is larger than 10 kb. 45 However, all the sarcoglycan genes are small (cdnas 2 kb) and can be readily accommodated into raav vector, as we have shown in the present study. The high efficiency of transduction that we have shown here is probably a consequence of the small particle sizes of AAV (20 nm), which can readily bypass the surrounding basal laminar barrier and infect mature myofibers. Small viral particle size also offers the advantage of bypassing the capillary blood vessel pores when delivered systemically. 41 In contrast, adenoviral and herpes viral vectors have much larger particle size and have encountered difficulties in bypassing the basal laminar barrier to transduce mature muscle cells. 3,4 Besides mature muscle, raav has been shown to transduce efficiently regenerating muscle cells. In this study, we observed no significant difference in terms of transduction efficiency between healthy mature muscle and regenerating muscle in both normal and Bio14.6 hamsters. Consistently, experiments in normal or dystrophic mdx mouse muscle revealed identical transduction efficiency by raav-lacz vector, as quantified by -galactosidase activities (J Huard, personal communications). The ability to transduce efficiently both mature and regenerating muscle cells is important for the success of gene therapy in muscular dystrophies, owing to the fact that the majority of the dystrophic patients are diagnosed at the age when most muscle cells have already matured and manifested variable extents of regeneration. Intramuscular injection of an raav vector containing human -sarcoglycan gene into the defective hamster muscle resulted in efficient gene transfer and expression. The human -sarcoglycan protein was correctly targeted to the muscle cell membrane. Moreover, we showed that 77
5 78 Figure 3 Widespread expression of -sarcoglycan and restoration of -sarcoglycan after intramuscular injection of AAV-CMA- SG vector. (a) -Sarcoglycan antibody staining of AAV-CMV- SG vector injected Bio14.6 dystrophic muscle. (b) -Sarcoglycan antibody staining of an adjacent cryosection showing the same microscopic field as in (a). The -sarcoglycan protein shows variable expression, with some fibers showing overexpression and cytoplasmic storage of the protein (a, leftward arrow) and some fibers showing normal level of the protein (a, rightward arrow). However, the restoration of secondary -sarcoglycan deficiency was seen to be homogeneous, independent of overexpressed levels of -sarcoglycan (b, leftward arrow). (c) A different area of -sarcoglycan antibody staining of AAV-CMV- SG vector injected Bio14.6 dystrophic muscle. In the upper right corner, some positive myofibers (arrow) are surrounded by the negative ones (arrowhead). The cell membrane staining is apparent.
6 79 Figure 4 Restoration of the entire sarcoglycan complex to wild-type levels after -sarcoglycan gene delivery by AAV-CMV- SG vector. Muscle cryosections from normal, dystrophic and AAV-CMV- SG-treated dystrophic hamsters were immunofluorescently stained for -, - and -sarcoglycan ( -SG, -SG and -SG), respectively. Note that the -sarcoglycan monoclonal antibody is human-specific, and barely detects hamster -sarcoglycan. The Bio14.6 dystrophic hamster shows both primary -sarcoglycan deficiency and secondary deficiency of - and -sarcoglycan. raav vector-mediated intramuscular gene delivery results in high-level expression of human -sarcoglycan gene in large regions of the muscle, and leads to the restoration of wild-type levels of - and -sarcoglycan in the sarcoglycan complex to the myofiber membrane. the secondary biochemical deficiencies of - and -sarcoglycan were corrected. Importantly, we found that overexpression of -sarcoglycan by the strong CMV promoter led to apparent saturation of membrane binding sites and cytoplasmic staining for -sarcoglycan in some myofibers. However, this ectopic localization of -sarcoglycan had no apparent effect on the localization of - and sarcoglycan. Immunostaining of these two proteins showed uniform membrane distribution regardless of the variable levels of -sarcoglycan, indicating that oversupply of one component of the sarcoglycan complex, at least in the case of -sarcoglycan, does not interfere with the formation of the entire complex. In this situation, the component shifted from a rate-limiting factor in the untreated dystrophic muscle to a non-rate-limiting factor in the vector-treated muscle. Since the four components are in equal molar ratio in the complex, a physiologically rationed supply of a single component should potentially keep the formation of the entire sarcoglycan complex at the normal level. A second important finding is that overexpression of the human -sarcoglycan protein in the deficient hamster muscle did not cause cytotoxicity of the muscle cells, or detectable immune responses during the 3 week period examined. Lymphocyte infiltration associated with the CTL reactions in normally observed starting in the first 2 weeks of vector injection in the case of other vectors in adult immunocompetent animals. Although further long-term observation is warranted, it is unlikely that CTL reaction will be initiated after this period, especially given the fact that raav vector carrying completely foreign genes, such as bacterial lacz and jellyfish GFP genes, does not illicit any CTL reaction to the transduced cells regardless of the duration of the studies. 5 Based on previous in vivo studies, we anticipate that raav-mediated -sarcoglycan gene transfer in the Bio14.6 hamster muscle will display sustained expression due to vector integration into the host chromosomes. 5,7,46 Even though overexpression of -sarcoglycan gene did not cause detectable adverse effects during the period tested in this study, regulated muscle-specific expression of the transgene is obviously a highly preferable feature for human gene therapy in the future. Recently, we constructed an raav vector containing the human -sarcoglycan gene under the control of a muscle-specific creatine kinase (MCK) promoter. 47 In vivo examination of this construct is underway in the Bio14.6 hamster. The success of gene therapy for LGMD in this relevant animal
7 80 model will bring us one step closer to the genetic treatment of the human disease by means of direct intramuscular injection of the raav vectors. However, future applications directed towards treatment of human patients must address the large target organ (muscle is approximately 30% of body mass) and cell-autonomous nature of the sarcoglycan defect. Systemic delivery and muscle-specific expression should overcome this barrier. Materials and methods Production of raav vectors An raav vector containing human -sarcoglycan cdna under the control of the CMV promoter was constructed as follows. First -sarcoglycan cdna was amplified by RT-PCR from human muscle biopsy cdna, using primers -SG-For (5 TCCTTCAGAGCTGCTGCTCAGCA CGCCC 3 ) and -SG-Rev (5 CCCGTTTGTTCATT GCCCATCAGGCCC 3 ). The amplified cdna was then cloned into their pgem-t Easy Vector (Promega, Madison, WI, USA) and subsequently excised by NotI digestion. The gel purified NotI fragment was subcloned into the NotI sites of an AAV vector plasmid pxx-uf1, which is a derivative of an raav vector plasmid ptr-uf1 48 with the substitution of the original plasmid backbone pbluescript by pembo. The resulting vector plasmid was named paav-cmv- SG. AAV-CMV- SG viral vector stocks were produced by cotransfection methods as previously described. 42 Briefly, 1 2 h before transfection, each 15-cm plate of human 293 cells, at 70 80% confluence, was fed with 25 ml fresh IMDM medium (Gibco, Gaithersburg, MD, USA) containing 10% fetal bovine serum (Hyclone, Logan, UT, USA) without antibiotics. A total of 50 g plasmid DNA (25 g of XX6, 6 g of XX2 and 19 g of AAV-CMV- SG) was dissolved in 2 ml of 0.25 m CaCl 2 and then quickly mixed with 2 ml of HBS buffer (50 mm Hepes, 280 mm NaCl and 1.5 mm Na 2 HPO 4, ph 7.12) and added to the cells. At 8 12 h after transfection, the medium was replaced with fresh DMEM medium (Gibco) containing 10% FBS and antibiotics. The transfected cells containing raav viral particles were harvested at 48 h after transfection. The raav viral vector was purified twice through CsCl density gradient purification according to the perviously published methods. 49 The vector titers of viral particle number were determined by the DNA dot-blot method, 49 and were in the range of viral particles per milliliter. In vivo vector delivery into muscle tissue The dystrophic hamster Bio14.6 and the normal control hamster F1B were purchased from Bio Breeders (Fitchburg, MA, USA) and handled in accordance with the institutional guidelines of the University of Pittsburgh. Before virus injection, 40-day-old hamsters were anesthetized with 2.5% Avertin (Aldrich, Milwaukee, WI, USA) intraperitoneally. Either 30 l of AAV-Lacz ( viral particles) or 30 l of AAV-CMV- SG ( viral particles) was injected into the hind leg gastrocnemius muscles percutaneously. At 3 weeks after intramuscular vector injection, the hamsters were killed and the muscle tissues were harvested and rapidly frozen in isopentane cooled in liquid nitrogen for further analysis. Western analysis Western analysis was carried out according to previously published methods. 50 Briefly, 293 cells injected with AAV-CMV- SG were lysed in RIPA buffer (10 mm Tris- Cl, ph 8.2, 1% Triton X-100, 1% SDS and 150 mm NaCl). For hamster muscle samples, 100 mg gastrocnemius muscle was homogenized and lysed in the RIPA buffer. The samples were separated on 10% SDS-PAGE and transferred on to nitrocellulose membrane. After blocking in 10% nonfat dry milk in TBS buffer (50 mm Tris-Cl, ph 7.5, 200 mm NaCl) for 1 h, the membranes were incubated with primary antibodies in TBS containing 0.5% Tween- 20 at room temperature for 1 h. The polyclonal antibody recognizing a conserved epitope of human, mouse and hamster -sarcoglycan was used in this experiment with a 1:5000 dilution. 31 Following primary antibody incubation and rinses, the membranes were incubated with the secondary antibody, a goat anti-rabbit antibody conjugated with horseradish peroxidase (Sigma, St Louis, MD, USA) with 1:5000 dilution in 2% dry milk and TBS buffer. After 1 h of antibody incubation and three washes with TBS buffer containing 0.5% Tween-20 and once with TBS, the -sarcoglycan protein band was visualized with chemiluminescence reagent (DuPont, Boston, MA, USA) and exposed to radiographic film. Immunofluorescent and X-gal staining Cryostat sectioning of the muscle tissue was performed at 5 m thickness with an IECMinotone (International Equipment Company, Needham Heights, MA, USA). The sections were then fixed for X-gal staining according to a published method. 5 For immunofluorescent staining, 22 the unfixed muscle cryosections were immediately blocked in 10% horse serum and PBS at room temperature for 1 h without fixation. Monoclonal antibodies against - and -sarcoglycans (Novocatra Laboratories, Newcastle, UK), or polyclonal antibody to -sarcoglycan 29 were diluted 1:100 in 10% horse serum/pbs, and incubated with cryosections 3 h at room temperature. After washes, the sections were incubated with Cy-3-labeled anti-mouse or anti-rabbit secondary antibodies at 1:500 dilution in 10% horse serum/pbs (Jackson Immunoresearch Laboratories). After washes, the samples were mounted in 90% glycerol/pbs or Gelmount (Fisher, Pittsburgh, PA, USA). Photographs were taken with a Nikon Microphot-FXA microscope, using an Optronics DE1750 color integrating digital camera. Acknowledgements We thank Dr Eijiro Ozawa for the polyclonal antibody to -sarcoglycan and Dr T Toyo-Oka for the polyclonal antibody to -sarcoglycan. We thank Dr Johny Huard and Mr Ryan Pruchnic for assistance with photography. This work is supported by the University of Pittsburgh (X Xiao), and Muscular Dystrophy Association USA (EP Hoffman). EP Hoffman is an Established Investigator of the American Heart Association. References 1 Berns KI, Linden RM. The cryptic life style of adeno-associated virus. Bioessays 1995; 17: Berns KI. Parvoviridae: the viruses and their replication. In: Fields BN, Knipe DM, Howley PM (eds). Virology. Lippincott- Raven: Philadelphia, 1996, pp
8 3 Feero WG et al. Viral gene delivery to skeletal muscle: insights on maturation-dependent loss of fiber infectivity for adenovirus and herpes simplex type 1 viral vectors. Hum Gene Ther 1997; 8: Huard J et al. The basal lamina is a physical barrier to herpes simplex virus-mediated gene delivery to mature muscle fibers. J Virol 1996; 70: Xiao X, Li J, Samulski RJ. Efficient long-term gene transfer into muscle tissue of immunocompetent mice by adeno-associated virus vector. J Virol 1996; 70: Clark KR, Sferra TJ, Johnson PR. Recombinant adeno-associated viral vectors mediate long-term transgene expression in muscle. Hum Gene Ther 1997; 8: Fisher KJ et al. Recombinant adeno-associated virus for muscle directed gene therapy. Nature Med 1997; 3: Kessler PD et al. Gene delivery to skeletal muscle results in sustained expression and systemic delivery of a therapeutic protein. Proc Nat Acad Sci USA 1996; 93: Herzog RW et al. Stable gene transfer and expression of human blood coagulation factor IX after intramuscular injection of recombinant adeno-associated virus. Proc Nat Acad Sci USA 1997; 94: Monahan PE et al. Direct intramuscular injection with recombinant AAV vectors results in sustained expression in a dog model of hemophilia. Gene Therapy 1998; 5: Murphy JE et al. Long-term correction of obesity and diabetes in genetically obese mice by a single intramuscular injection of recombinant adeno-associated virus encoding mouse leptin. Proc Nat Acad Sci USA 1997; 94: Zhou S et al. Adeno-associated virus-mediated delivery of erythropoietin leads to sustained elevation of hematocrit in nonhuman primates. Gene Therapy 1998; 5: Ozawa E et al. From dystrophinopathy to sarcoglycanopathy: evolution of a concept of muscular dystrophy. Musc Nerve 1998; 21: Bonnemann CG, McNally EM, Kunkel LM. Beyond dystrophin: current progress in the muscular dystrophies (published erratum appears in Curr Opin Pediatr 1997; 9: 196). Curr Opin Pediatr 1996; 8: Hoffman EP, Clemens PR. HyperCKemic, proximal muscular dystrophies and the dystrophin membrane cytoskeleton, including dystrophinopathies, sarcoglycanopathies, and merosinopathies. Curr Opin Rheumatol 1996; 8: Duggan DJ et al. Mutations in the delta-sarcoglycan gene are a rare cause of autosomal recessive limb-girdle muscular dystrophy (LGMD2). Neurogenetics 1996; 1: Duggan DJ et al. Mutations in the sarcoglycan genes in patients with myopathy (see comments). New Engl J Med 1997; 336: Bonnemann CG et al. Beta-sarcoglycan (A3b) mutations cause autosomal recessive muscular dystrophy with loss of the sarcoglycan complex (published erratum appears in Nat Genet 1996; 12: 110). Nat Genet 1995; 11: Bonnemann CG et al. Genomic screening for beta-sarcoglycan gene mutations: missense mutations may cause severe limbgirdle muscular dystrophy type 2E (LGMD 2E). Hum Mol Genet 1996; 5: Duggan DJ, Hoffman EP. Autosomal recessive muscular dystrophy and mutations of the sarcoglycan complex. Neuromus Disorders 1996; 6: Nigro V et al. Autosomal recessive limb-girdle muscular dystrophy, LGMD2F, is caused by a mutation in the delta-sarcoglycan gene. Nat Genet 1996; 14: Lim LE et al. Beta-sarcoglycan: characterization and role in limbgirdle muscular dystrophy linked to 4q12. Nat Genet 1995; 11: Jung D et al. Characterization of delta-sarcoglycan, a novel component of the oligomeric sarcoglycan complex involved in limb-girdle muscular dystrophy. J Biol Chem 1996: 271: Dincer P et al. A biochemical, genetic, and clinical survey of autosomal recessive limb girdle muscular dystrophies in Turkey. Ann Neurol 1997; 42: Fanin M et al. Genetic epidemiology of muscular dystrophies resulting from sarcoglycan gene mutations. J Med Genet 1997; 34: Mizuno Y et al. Selective defect of sarcoglycan complex in severe childhood autosomal recessive muscular dystrophy muscle. Biochem Biophys Res Commun 1994; 203: Noguchi S et al. Mutations in the dystrophin-associated protein gamma-sarcoglycan in chromosome 13 muscular dystrophy (see comments). Science 1995; 270: Matsumura K et al. Deficiency of the 50K dystrophin-associated glycoprotein in severe childhood autosomal recessive muscular dystrophy. Nature 1992; 359: Mizuno Y et al. Sarcoglycan complex is selectively lost in dystrophic hamster muscle. Am J Pathol 1995; 146: Nigro V et al. Identification of the Syrian hamster cardiomyopathy gene. Hum Mol Genet 1997; 8: Sakamoto A et al. Both hypertrophic and dilated cardiomyopathies are caused by mutation of the same gene, delta-sarcoglycan, in hamster: an animal model of disrupted dystrophinassociated glycoprotein complex. Proc Natl Acad Sci USA 1997; 94: Carrie A et al. Mutational diversity and hot spots in the alphasarcoglycan gene in autosomal recessive muscular dystrophy (LGMD2D). J Med Genet 1997; 34: Chamberlain JS et al. Interactions between dystrophin and the sarcolemma membrane. Soc Gen Physiol Series 1997; 52: Ettinger AJ, Feng G, Sanes JR. Epsilon-Sarcoglycan, a broadly expressed homologue of the gene mutated in limb-girdle muscular dystrophy 2D. J Biol Chem 1997; McNally EM, Ly CT, Kunkel LM. Human epsilon-sarcoglycan is highly related to alpha-sarcoglycan (adhalin), the limb girdle muscular dystrophy 2D gene. FEBS Lett 1998; 422: Homburger F et al. Primary, generalized polymyopathy and cardiac necrosis in an inbred line of Syrian hamsters. Med Exp 1962; 6: Snyder R et al. Efficient and stable AAV-mediated transduction in the skeletal muscle of adult immuncompetent mice. Hum Gene Ther 1997; 8: Jooss K et al. Transduction of dendritic cells by DNA viral vectors directs the immune response to transgene products in muscle fibers. J Virol 1998; 72: Kaczmarek L et al. Induction of cellular DNA synthesis by purified adenovirus E1A proteins. Virology 1986; 152: Kaplitt MG et al. Long-term gene expression and phenotypic correction using adeno-associated virus vectors in the mammalian brain. Nat Genet 1994; 8: Kaplitt MG et al. Long-term gene transfer in porcine myocardium after coronary infusion of an adeno-associated virus vector. Ann Thor Surg 1996; 62: Xiao X, Li J, Samulski RJ. Production of high-titer recombinant adeno-associated virus vectors in the absence of helper adenovirus. J Virol 1998; 72: Holt KH et al. Functional rescue of the sarcoglycan complex in the BIO 14.6 hamster using delta-sarcoglycan gene transfer. Mol Cell 1998; 1: Hoffman EP, Brown Jr RH, Kunkel LM. Dystrophin: the protein product of the Duchenne muscular dystrophy locus. Cell 1987; 51: Koenig M, et al. Complete cloning of the Duchenne muscular dystrophy (DMD) cdna and preliminary genomic organization of the DMD gene in normal and affected individuals. Cell 1987; 50: Wu P et al. Adeno-associated virus vector-mediated transgene integration into neurons and other nondividing cell targets. J Virol 1998; 72: Jaynes JB et al. The muscle creatine kinase gene is regulated by multiple upstream elements, including a muscle-specific enhancer. Mol Cell Biol 1988; 8:
9 82 48 Zolotukhin S et al. A humanized green fluorescent protein cdna adapted for high-level expression in mammalian cells. J Virol 1996; 70: Snyder R, Xiao X, Samulski RJ. Production of recombinant adeno-associated viral vectors. In: N. Dracopoli et al. (eds). Current Protocols in Human Genetics. John Wiley & Sons: New York, 1995, pp Li J, Samulski RJ, Xiao X. Role for highly regulated rep gene expression in adeno-associated virus vector production. J Virol 1997; 71:
Muscular Dystrophy. Biol 405 Molecular Medicine
Muscular Dystrophy Biol 405 Molecular Medicine Duchenne muscular dystrophy Duchenne muscular dystrophy is a neuromuscular disease that occurs in ~ 1/3,500 male births. The disease causes developmental
More informationREAD ORPHA.NET WEBSITE ABOUT BETA-SARCOGLYOCANOPATHY LIMB-GIRDLE MUSCULAR DYSTROPHIES
READ ORPHA.NET WEBSITE ABOUT BETA-SARCOGLYOCANOPATHY LIMB-GIRDLE MUSCULAR DYSTROPHIES (LGMD) Limb-girdle muscular dystrophies (LGMD) are a heterogeneous group of genetically determined disorders with a
More informationChoosing Between Lentivirus and Adeno-associated Virus For DNA Delivery
Choosing Between Lentivirus and Adeno-associated Virus For DNA Delivery Presenter: April 12, 2017 Ed Davis, Ph.D. Senior Application Scientist GeneCopoeia, Inc. Outline Introduction to GeneCopoeia Lentiviral
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More informationViral Vectors In The Research Laboratory: Just How Safe Are They? Dawn P. Wooley, Ph.D., SM(NRM), RBP, CBSP
Viral Vectors In The Research Laboratory: Just How Safe Are They? Dawn P. Wooley, Ph.D., SM(NRM), RBP, CBSP 1 Learning Objectives Recognize hazards associated with viral vectors in research and animal
More informationSupplementary data Supplementary Figure 1 Supplementary Figure 2
Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna
More informationHIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates
HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates Department of Microbiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, USA
More informationA protocol for enhancement of the AAV-mediated expression of transgenes
A protocol for enhancement of the AAV-mediated expression of transgenes Hiroaki Mizukami, Takeharu Kanazawa, Takashi Okada, and Keiya Ozawa Division of Genetic Therapeutics, Center for Molecular Medicine,
More informationThe New England Journal of Medicine MUTATIONS IN THE SARCOGLYCAN GENES IN PATIENTS WITH MYOPATHY
MUTATIONS IN THE SARCOGLYCAN GENES IN PATIENTS WITH MYOPATHY DAVID J. DUGGAN, B.S., J. RAFAEL GOROSPE, M.D., PH.D., MARINA FANIN, M.S., ERIC P. HOFFMAN, PH.D., A CORRADO ANGELINI, M.D. ABSTRACT Background
More informationImmunohistochemical Study of Dystrophin Associated Glycoproteins in Limb-girdle Muscular Dystrophies
Dystrophin Immunohistochemical Study of Dystrophin Associated Glycoproteins in Limb-girdle Muscular Dystrophies NSC 89-2314-B-002-111 88 8 1 89 7 31 ( Peroxidase -AntiPeroxidase Immnofluorescence) Abstract
More informationReady-to-use Lentiviral Particles for intracelular labeling
Ready-to-use Lentiviral Particles for intracelular labeling (LocLight TM Living cell imaging lentivirus for sub-cellular localization) LocLight TM cell organelle labeling lentivirus are provided as 200ul/per
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationVIROLOGY. Engineering Viral Genomes: Retrovirus Vectors
VIROLOGY Engineering Viral Genomes: Retrovirus Vectors Viral vectors Retrovirus replicative cycle Most mammalian retroviruses use trna PRO, trna Lys3, trna Lys1,2 The partially unfolded trna is annealed
More informationMicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells
MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on
More informationGene therapy and genome editing technologies for the study and potential treatment of :
WORKSHOP ON GENOME EDITING Gene therapy and genome editing technologies for the study and potential treatment of : Duchenne Muscular Dystrophy by Dr France Piétri-Rouxel, Institut de Myologie Centre de
More informationThis training module is required for all personnel listed on an IBC protocol that describes work utilizing viral vectors (both replication competent
This training module is required for all personnel listed on an IBC protocol that describes work utilizing viral vectors (both replication competent and incompetent) regardless of the biosafety level used
More informationFeb 11, Gene Therapy. Sam K.P. Kung Immunology Rm 417 Apotex Center
Gene Therapy Sam K.P. Kung Immunology Rm 417 Apotex Center Objectives: The concept of gene therapy, and an introduction of some of the currently used gene therapy vector Undesirable immune responses to
More informationCurrent Strategies in HIV-1 Vaccine Development Using Replication-Defective Adenovirus as a Case Study
Note: I have added some clarifying comments to the slides -- please click on Comments under View to see them. Current Strategies in HIV-1 Vaccine Development Using Replication-Defective Adenovirus as a
More informationTFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry
TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi
More information18 (2), DOI: /bjmg
18 (2), 2015 71-76 DOI: 10.1515/bjmg-2015-0088 CASE REPORT SARCOLEMMAL DEFICIENCY OF SARCOGLYCAN COMPLEX IN AN 18-MONTH-OLD TURKISH BOY WITH A LARGE DELETION IN THE BETA SARCOGLYCAN GENE Diniz G 1,*, Tekgul
More informationDMD Genetics: complicated, complex and critical to understand
DMD Genetics: complicated, complex and critical to understand Stanley Nelson, MD Professor of Human Genetics, Pathology and Laboratory Medicine, and Psychiatry Co Director, Center for Duchenne Muscular
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationDNA context and promoter activity affect gene expression in lentiviral vectors
ACTA BIOMED 2008; 79: 192-196 Mattioli 1885 O R I G I N A L A R T I C L E DNA context and promoter activity affect gene expression in lentiviral vectors Gensheng Mao 1, Francesco Marotta 2, Jia Yu 3, Liang
More informationPre-made Reporter Lentivirus for JAK-STAT Signaling Pathway
Pre-made Reporter for JAK-STAT Signaling Pathway Cat# Product Name Amounts LVP937-P or: LVP937-P-PBS ISRE-GFP (Puro) LVP938-P or: LVP938-P-PBS ISRE-RFP (Puro) LVP939-P or: LVP939-P-PBS ISRE-Luc (Puro)
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationJumpstart your research with ViraPower Lentiviral Expression Systems
ViraPower Lentiviral Expression Systems Jumpstart your research with ViraPower Lentiviral Expression Systems With ViraPower Lentiviral Systems you can: Efficiently transduce both dividing and non-dividing
More informationLIST OF ORGANS FOR HISTOPATHOLOGICAL ANALYSIS:!! Neural!!!!!!Respiratory:! Brain : Cerebrum,!!! Lungs and trachea! Olfactory, Cerebellum!!!!Other:!
LIST OF ORGANS FOR HISTOPATHOLOGICAL ANALYSIS:!! Neural!!!!!!Respiratory:! Brain : Cerebrum,!!! Lungs and trachea! Olfactory, Cerebellum!!!!Other:! Spinal cord and peripheral nerves! Eyes, Inner ear, nasal
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationSupporting Information
Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)
More information~Lentivirus production~
~Lentivirus production~ May 30, 2008 RNAi core R&D group member Lentivirus Production Session Lentivirus!!! Is it health threatening to lab technician? What s so good about this RNAi library? How to produce
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2566 Figure S1 CDKL5 protein expression pattern and localization in mouse brain. (a) Multiple-tissue western blot from a postnatal day (P) 21 mouse probed with an antibody against CDKL5.
More informationOncolytic Immunotherapy: A Local and Systemic Antitumor Approach
Oncolytic Immunotherapy: A Local and Systemic Antitumor Approach Oncolytic immunotherapy Oncolytic immunotherapy the use of a genetically modified virus to attack tumors and induce a systemic immune response
More informationSMA IS A SEVERE NEUROLOGICAL DISORDER [1]
SMA OVERVIEW SMA IS A SEVERE NEUROLOGICAL DISORDER [1] Autosomal recessive genetic inheritance 1 in 50 people (approximately 6 million Americans) are carriers [2] 1 in 6,000 to 1 in 10,000 children born
More informationLai et al 2008 JCI RG-Revision 2
Lai et al 2008 JCI 36612-RG-Revision 2 Suppmentary Table 1. Epitope specific dystrophin antibodies Name Epitope Dilution Source Dys-3* Hinge 1 1:20 Novocastra Dys-1 Repeats 6-8 1:100 Novocastra Mandys8
More informationB19, see Parvovirus B19 Bone marrow, gene transfer with parvovirus. Erythrovirus, see Parvovirus B19, Simian parvovirus
... Subject Index Adeno-associated virus Cap and genome encapsidation 87 DNA integration homologous recombination 90, 91 latency vs replication 77, 78 mechanism 79 requirements 78, 79 site in human genome
More informationPre-made Lentiviral Particles for Fluorescent Proteins
Pre-made Lentiviral Particles for Fluorescent Proteins Catalog# Product Name Amounts Fluorescent proteins expressed under sucmv promoter: LVP001 LVP001-PBS LVP002 LVP002-PBS LVP011 LVP011-PBS LVP012 LVP012-PBS
More informationOxford Expression Technologies Ltd
Oxford Expression Technologies Ltd Founded in 2007 as a spin out from Oxford Brookes University and Natural Environment Research Council Technology based on the insect baculovirus expression vectors (BEVs)
More informationBIT 120. Copy of Cancer/HIV Lecture
BIT 120 Copy of Cancer/HIV Lecture Cancer DEFINITION Any abnormal growth of cells that has malignant potential i.e.. Leukemia Uncontrolled mitosis in WBC Genetic disease caused by an accumulation of mutations
More informationExpression of acid base transporters in the kidney collecting duct in Slc2a7 -/-
Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.
More informationPre-made Reporter Lentivirus for MAPK/ERK Signal Pathway
Pre-made Reporter for MAPK/ERK Signal Pathway Cat# Product Name Amounts LVP957-P or: LVP957-P-PBS SRE-GFP (Puro) LVP958-P or: LVP958-P-PBS SRE-RFP (Puro) LVP959-P or: LVP959-P-PBS SRE-Luc (Puro) LVP960-P
More informationProduct Datasheet. HLA ABC Antibody (W6/32) NB Unit Size: 0.25 mg. Store at -20C. Avoid freeze-thaw cycles. Reviews: 1 Publications: 22
Product Datasheet HLA ABC Antibody (W6/32) NB100-64775 Unit Size: 0.25 mg Store at -20C. Avoid freeze-thaw cycles. Reviews: 1 Publications: 22 Protocols, Publications, Related Products, Reviews, Research
More informationSoft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v)
SUPPLEMENTARY MATERIAL AND METHODS Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) top agar (LONZA, SeaKem LE Agarose cat.5004) and plated onto 0.5% (w/v) basal agar.
More informationConstitutive Reporter Lentiviral Vectors Expressing Fluorescent Proteins
Constitutive Reporter Lentiviral Vectors Expressing Fluorescent Proteins www.vectalys.com/products/ Constitutive Reporter Lentiviral Vectors Catalog Number referring to this User Manual: 0008VCT; 0009VCT;
More informationProtocol for Gene Transfection & Western Blotting
The schedule and the manual of basic techniques for cell culture Advanced Protocol for Gene Transfection & Western Blotting Schedule Day 1 26/07/2008 Transfection Day 3 28/07/2008 Cell lysis Immunoprecipitation
More informationMouse C-peptide EIA. Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY
Mouse C-peptide EIA Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY TOYO 2CHOME, KOTO-KU, TOKYO, 135-0016, JAPAN http://www.cosmobio.co.jp e-mail : export@cosmobio.co.jp Phone : +81-3-5632-9617 FAX : +81-3-5632-9618
More informationTITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer
AD Award Number: TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer PRINCIPAL INVESTIGATOR: Audrey van Drogen, Ph.D. CONTRACTING ORGANIZATION: Sidney
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationProtein MultiColor Stable, Low Range
Product Name: DynaMarker Protein MultiColor Stable, Low Range Code No: DM670L Lot No: ******* Size: 200 μl x 3 (DM670 x 3) (120 mini-gel lanes) Storage: 4 C Stability: 12 months at 4 C Storage Buffer:
More informationSupplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved
1 Supplemental Figure Legends Supplemental Figure 1 ELISA scheme to measure plasma total, mature and furin-cleaved PCSK9 concentrations. 4 Plasma mature and furin-cleaved PCSK9s were measured by a sandwich
More informationCertificate of Analysis
Certificate of Analysis Catalog No. Amount Lot Number 631987 10 μg Specified on product label. Product Information plvx-ef1α-ires-mcherry is a bicistronic lentiviral expression vector that can be used
More informationGeneral information. Cell mediated immunity. 455 LSA, Tuesday 11 to noon. Anytime after class.
General information Cell mediated immunity 455 LSA, Tuesday 11 to noon Anytime after class T-cell precursors Thymus Naive T-cells (CD8 or CD4) email: lcoscoy@berkeley.edu edu Use MCB150 as subject line
More informationIII./10.4. Diagnosis. Introduction. A.) Laboratory tests. Laboratory tests, electrophysiology, muscle biopsy, genetic testing, imaging techniques
III./10.4. Diagnosis Laboratory tests, electrophysiology, muscle biopsy, genetic testing, imaging techniques After studying this chapter, you will become familiar with the most commonly used diagnostic
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationThe humoral immune responses to IBV proteins.
The humoral immune responses to IBV proteins. E. Dan Heller and Rosa Meir The Hebrew University of Jerusalem, Israel COST FA1207 meeting WG2 + WG3, Budapest, Jan. 2015 1 IBV encodes four major structural
More informationRecombinant Protein Expression Retroviral system
Recombinant Protein Expression Retroviral system Viruses Contains genome DNA or RNA Genome encased in a protein coat or capsid. Some viruses have membrane covering protein coat enveloped virus Ø Essential
More informationHuman Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set
Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Catalog Number : SEK11233 To achieve the best assay results, this manual must be read carefully before using this product
More informationE.Z.N.A. SQ Blood DNA Kit II. Table of Contents
E.Z.N.A. SQ Blood DNA Kit II Table of Contents Introduction and Overview...2 Kit Contents/Storage and Stability...3 Blood Storage and DNA Yield...4 Preparing Reagents...5 100-500 μl Whole Blood Protocol...6
More informationLDL Uptake Cell-Based Assay Kit
LDL Uptake Cell-Based Assay Kit Item No. 10011125 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL INFORMATION
More informationAnti-Lamin B1/LMNB1 Picoband Antibody
Anti-Lamin B1/LMNB1 Picoband Antibody Catalog Number:PB9611 About LMNB1 Lamin-B1 is a protein that in humans is encoded by the LMNB1 gene. The nuclear lamina consists of a two-dimensional matrix of proteins
More informationHuman Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set
Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Catalog Number : SEK11695 To achieve the best assay results, this manual must be read carefully before using this product
More informationHCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation
SUPPLEMENTARY INFORMATION Materials and Methods Human cell lines and culture conditions HCC1937 is the HCC1937-pcDNA3 cell line, which was derived from a breast cancer with a mutation in exon 20 of BRCA1
More informationZhu et al, page 1. Supplementary Figures
Zhu et al, page 1 Supplementary Figures Supplementary Figure 1: Visual behavior and avoidance behavioral response in EPM trials. (a) Measures of visual behavior that performed the light avoidance behavior
More informationSupplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T
More informationSupplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal
More informationLuminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2016 Contents Supporting Information Luminescent platforms for monitoring changes in the
More informationSupporting Information
Supporting Information Muraski et al. 10.1073/pnas.0709135105 SI Text Generation of Transgenic Animals. Pim-WT and Pim-DN cdnas were subcloned NheI/SmaI from pegfp-c1 Pim-1 and pegfp-c1 Pim-DN plasmids
More informationSustained Whole-Body Functional Rescue in Congestive Heart Failure and Muscular Dystrophy Hamsters by Systemic Gene Transfer
Sustained Whole-Body Functional Rescue in Congestive Heart Failure and Muscular Dystrophy Hamsters by Systemic Gene Transfer Tong Zhu, MD, PhD*; Liqiao Zhou, VMD*; Satsuki Mori, MD; Zhong Wang, MD, PhD;
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationMammalian Tissue Protein Extraction Reagent
Mammalian Tissue Protein Extraction Reagent Catalog number: AR0101 Boster s Mammalian Tissue Protein Extraction Reagent is a ready-to-use Western blot related reagent solution used for efficient extraction
More informationab LDL Uptake Assay Kit (Cell-Based)
ab133127 LDL Uptake Assay Kit (Cell-Based) Instructions for Use For the detection of LDL uptake into cultured cells. This product is for research use only and is not intended for diagnostic use. Version
More informationPre-made Reporter Lentivirus for NF-κB Signal Pathway
Pre-made Reporter for NF-κB Signal Pathway Cat# Product Name Amounts LVP965-P or: LVP965-P-PBS NFKB-GFP (Puro) LVP966-P or: LVP966-P-PBS NFKB-RFP (Puro) LVP967-P or: LVP967-P-PBS NFKB-Luc (Puro) LVP968-P
More informationProblem Set 8 Key 1 of 8
7.06 2003 Problem Set 8 Key 1 of 8 7.06 2003 Problem Set 8 Key 1. As a bright MD/PhD, you are interested in questions about the control of cell number in the body. Recently, you've seen three patients
More informationHIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual)
HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) BACKGROUND Human Immunodeficiency Virus ( HIV ) can be divided into two major types, HIV type 1 (HIV-1) and HIV type 2 (HIV-2). HIV-1 is related to
More informationNeutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury
Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to
More informationReplication Defective Enterovirus Infections: Implications for Type I Diabetes
Replication Defective Enterovirus Infections: Implications for Type I Diabetes N. M. Chapman Department of Pathology & Microbiology University of Nebraska Medical Center Enterovirus Genome and 2 Capsid
More informationTSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Details
More informationMammalian Membrane Protein Extraction Kit
Mammalian Membrane Protein Extraction Kit Catalog number: AR0155 Boster s Mammalian Membrane Protein Extraction Kit is a simple, rapid and reproducible method to prepare cellular protein fractions highly
More informationRabies virus-like particles expressed in HEK293 cells
Engineering Conferences International ECI Digital Archives Vaccine Technology IV Proceedings Spring 5-21-2012 Rabies virus-like particles expressed in HEK293 cells Diego Fontana Cell Culture Laboratory
More informationThe Schedule and the Manual of Basic Techniques for Cell Culture
The Schedule and the Manual of Basic Techniques for Cell Culture 1 Materials Calcium Phosphate Transfection Kit: Invitrogen Cat.No.K2780-01 Falcon tube (Cat No.35-2054:12 x 75 mm, 5 ml tube) Cell: 293
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationInfluenza A H1N1 (Swine Flu 2009) Hemagglutinin / HA ELISA Pair Set
Influenza A H1N1 (Swine Flu 2009) Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK001 To achieve the best assay results, this manual must be read carefully before using this product and the assay
More informationSestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury
Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada
More informationSupplementary Information
Supplementary Information HBV maintains electrostatic homeostasis by modulating negative charges from phosphoserine and encapsidated nucleic acids Authors: Pei-Yi Su 1,2,3, Ching-Jen Yang 2, Tien-Hua Chu
More informationLaboratory diagnosis of congenital infections
Laboratory diagnosis of congenital infections Laboratory diagnosis of HSV Direct staining Tzanck test Immunostaining HSV isolation Serology PCR Tzanck test Cell scrape from base of the lesion smear on
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationThe dystrophin glycoprotein complex (DGC)1 consists
Molecular Organization of Sarcoglycan Complex in Mouse Myotubes in Culture Yiu-mo Chan,* Carsten G. Bönnemann,* Hart G.W. Lidov, and Louis M. Kunkel* *Howard Hughes Medical Institute, Division of Genetics,
More informationFIG S1 Examination of eif4b expression after virus infection. (A) A549 cells
Supplementary Figure Legends FIG S1 Examination of expression after virus infection. () 549 cells were infected with herpes simplex virus (HSV) (MOI = 1), and harvested at the indicated times, followed
More informationInfluenza A H1N1 HA ELISA Pair Set
Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the
More informationSupplementary Figure 1. Blood glucose and insulin levels in mice during 4-day infusion.
Supplementary Figure 1. Blood glucose and insulin levels in mice during 4-day infusion. (A-B) WT and HT mice infused with saline or glucose had overlapping achieved blood glucose and insulin levels, necessitating
More informationThird line of Defense
Chapter 15 Specific Immunity and Immunization Topics -3 rd of Defense - B cells - T cells - Specific Immunities Third line of Defense Specific immunity is a complex interaction of immune cells (leukocytes)
More informationIowa Wellstone Center Muscle Tissue and Cell Culture Repository
Iowa Wellstone Center Muscle Tissue and Cell Culture Repository Steven A. Moore, M.D., Ph.D. The University of Iowa Department of Pathology and Iowa Wellstone Muscular Dystrophy Cooperative Research Center
More informationPRODUCT INFORMATION & MANUAL
PRODUCT INFORMATION & MANUAL 0.4 micron for Overall Exosome Isolation (Cell Media) NBP2-49826 For research use only. Not for diagnostic or therapeutic procedures. www.novusbio.com - P: 303.730.1950 - P:
More informationCHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000)
CHAPTER 4 RESULTS 4.1 Growth Characterization of C. vulgaris 4.1.1 Optical Density Growth study of Chlorella vulgaris based on optical density at 620 nm (OD 620 ) showed that all three replicates had similar
More information(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment
SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.
More informationMouse Myeloperoxidase/MPO ELISA Kit
OriGene Technologies, Inc 9620 Medical Center Dr., Suite 200, Rockville, MD 20850 Phone: 1.888.267.4436 Fax: 301-340-9254 Email: techsupport@origene.com Web: Mouse Myeloperoxidase/MPO ELISA Kit Catalog
More informationSignificance of the MHC
CHAPTER 7 Major Histocompatibility Complex (MHC) What is is MHC? HLA H-2 Minor histocompatibility antigens Peter Gorer & George Sneell (1940) Significance of the MHC role in immune response role in organ
More informationCertificate of Analysis
Certificate of Analysis plvx-ef1α-ires-puro Vector Table of Contents Product Information... 1 Description... 2 Location of Features... 3 Additional Information... 3 Quality Control Data... 4 Catalog No.
More information