S1a S1b S1c. S1d. S1f S1g S1h SUPPLEMENTARY FIGURE 1. - si sc Il17rd Il17ra bp. rig/s IL-17RD (ng) -100 IL-17RD
|
|
|
- Bonnie Bond
- 6 years ago
- Views:
Transcription
1 SUPPLEMENTARY FIGURE IL-17RD (ng) S1a S1b S1c IL-17RD β-actin kda S1d - si sc Il17rd Il17ra rig/s bp S1f S1g S1h
2 S1i S1j Supplementary Figure 1. Knockdown of IL-17RD enhances TLR-induced pro-inflammatory signalling. (a-c) Assay of luciferase reporter activity in HEK293 cells transfected with (a) MyD88, Mal, TRIF, TRAM and Myc-tagged IL-17RD (0 ng) with a NF-κB luciferase reporter plasmid (60 ng) or (b,c) IKKi, TBK1 and IL-17RD (0 ng) and PFR-luciferase (60 ng) with (b) IRF3- Gal4 (30 ng) or (c) IRF7-Gal4 (25 ng) constructs. TK Renilla was measured to determine transfection efficiency. (a, top panel) Immunoblotting of cell lysates with indicated antibodies to show IL-17RD expression. (d) Assay of NF-κB reporter activity in HEK293 TLR4 or TLR3 cells transfected with scrambled or IL-17RD-specific sirna for 48 h followed by stimulation with LPS (100 ng/ml) or poly(i:c) (25 μg/ml). (d, inset) RT-PCR indicating knockdown with IL-17RD sirna specifically targets Il17rd mrna. (f) Knockdown of Il17rd mrna in (left panel) U373 and (right panel) THP-1 cells stably transduced with lentiviral constructs encoding control or IL-17RD-specific shrna. (g,h) Levels of (g) Il8 mrna in THP-1 knockdown cells treated with LPS (100 ng/ml) and (h) Ifnb1 mrna in U373 knockdown cells treated with poly(i:c) (25 μg/ml) for 6 h were evaluated by qpcr. (i) qpcr indicating knockdown of Il17rd mrna in PBMCs. (j) Supernatants from PBMCs transfected with scrambled or IL-17RD-specific sirna for 48 h followed by stimulation with LPS (100 ng/ml) and poly(i:c) (5 μg/ml) measured for IL-8 and IFN-β production by sandwich ELISA. Data are presented as the mean +/- S.E.M. of three independent experiments and were subjected to two-tailed paired Student's t test, *, p < 0.05; **, p < 0.01; ***, p < Images have been cropped for presentation. Full size images are presented in Supplementary Fig. S12.
3 SUPPLEMENTARY FIGURE 2 S2a S2b S2c S2d Il17rd +/+ Il17rd / Probe comp LPS (min) NF-κB/Oligo binding Free Probe Supplementary Figure 2. IL-17RD-deficient cells show increased production of pro-inflammatory cytokines upon TLR stimulation. (a) WT and Il17rd / MEFs were infected with EMCV for 24 h and IL-6, KC and RANTES levels in supernatants were measured by ELISA. (b) Cxcl1 and Il6 mrna levels in WT and Il17rd / BMDMs treated with LPS (100 ng/ml) for 6 h. (c) Ifnb1 mrna levels in WT and Il17rd / MEFs infected with EMCV for 24 h were assayed by qpcr. (d) WT and Il17rd / MEFs were stimulated with LPS (100 ng/ml) for 0, 30, 60 and 120 mins and nuclear extracts assayed by EMSA for NF-κB/DNA binding. Nuclear extracts (from Il17rd / cells stimulated with LPS for 30 min) were also pre-incubated for 15 min with the unlabelled competitor (comp) oligonucleotide. (a-c) Data are presented as the mean +/- S.E.M. of three independent experiments and were subjected to two-tailed paired Student's t test, *, p < 0.05; **, p < 0.01; ***, p < or is a representative (d) of 3 independent experiments. Full size images are presented in Supplementary Fig. S13.
4 SUPPLEMENTARY FIGURE 3 S3a Il17rd +/+ Il17rd / LPS (min) S3b p-erk ERK β-actin Il17rd +/+ Il17rd / LPS (min) p-erk ERK β-actin kda kda Supplementary Figure 3. IL-17RD inhibits TLR4-induced phosphorylation of ERK. (a,b) WT and Il17rd / (a) MEFs and (b) BMDCs were treated with LPS (100 and 10 ng/ml, respectively) for 0, 5, 15, 30, 60 and 240 mins. Cell lysates were subject to SDS-PAGE followed by immunoblotting with indicated antibodies. Data are representative of 3 independent experiments. Images have been cropped for presentation. Full size images are presented in Supplementary Fig. S14.
5 S4a SUPPLEMENTARY FIGURE 4 IL-17RD Full Length IL-17RD ΔC S4b N N C SEFIR IL-17RD SEFIR N SEFIR C TLR3-FLAG IL-17RD WT-Myc IL-17RD ΔC -Myc C S4c Mal -FLAG IL-17RD -Myc IL-17RD ΔC -Myc IL-17RD SEFIR -Myc kda S4d TRIF -FLAG IL-17RD -Myc IL-17RD ΔC -Myc IL-17RD SEFIR -Myc S4e kda TLR3 -FLAG IL-17RD SEFIR -Myc kda kda
6 S4f S4g S4h MyD88 -FLAG IL-17RD WT-Myc IL-17RD E350A-Myc kda S4i S4j MyD88 -FLAG IL-17RD WT-Myc IL-17RD Y330F-Myc Supplementary Figure 4. The SEFIR domain is critical for the inhibitory function of IL-17RD. (a) Schematic depicting structure of wild-type IL-17RD and generated mutants. (b) HEK293 cells were transfected for 24 h with TLR3-FLAG and IL-17RD-Myc or IL-17RD ΔC-Myc (1 μg). Cell lysates were immunoprecipitated with an anti-flag antibody, followed by immunoblotting with indicated antibodies. (c,d) HEK293 cells were transfected for 24 h with (c) Mal-FLAG or (d) TRIF- FLAG with IL-17RD-Myc, IL-17RD ΔC-Myc or IL-17RD SEFIR-Myc (1 μg). Cell lysates were immunoprecipitated with an anti-flag antibody, followed by immunoblotting with indicated antibodies. (e) HEK293 cells were transfected for 24 h with IL-17RD SEFIR-Myc and TLR3-FLAG. Cell lysates were immunoprecipitated with an anti-flag antibody, followed by immunoblotting with indicated antibodies. (f,g,i) Assay of luciferase reporter activity in HEK293 cells transfected with MyD88 (50 ng) with a NF-κB luciferase reporter plasmid (60 ng) and (f) IL-17RA, IL-17RA SEFIR, Act1, Act1 SEFIR, IL-17RD or IL-17RD SEFIR (50 ng) or (g) IL-17RD and IL-17RD E350A or (i) IL-17RD and IL-17RD Y330F. (h,j) HEK293 cells were transfected for 24 h with MyD88-FLAG with IL-17RD- Myc and (h) IL-17RD E350A-Myc or (j) IL-17RD Y330F-Myc. Cell lysates were immunoprecipitated with an anti-flag antibody, followed by immunoblotting with indicated antibodies. Data are (b-e,h,j) representative of 3 independent experiments or (f,g,i) presented as the mean +/- S.E.M. of three independent experiments and were subjected to two-tailed paired Student's t test, *, p < 0.05; **, p < 0.01; ***, p < Full size images are presented in Supplementary Fig. S15. kda
7 S5a MyD88-FLAG MyD88 TIR-FLAG IL17RD SEFIR-Myc SUPPLEMENTARY FIGURE 5 S5b kda S5c MyD88+ TRAF MyD88 TIR-FLAG EV - - RA RASEF Act ActSEF RD RDSEF IB: HA IB: HA TRAF6-HA IL-17RD SEFIR-Myc IP: MyD88 IB: TRAF6 IP: MyD88 IB: MyD88 IP: MyD IL-17RA Act1 Act1 SEFIR IL-17RA SEFIR MyD88 kda IB: HA IL-17RD IL-17RD SEFIR TRAF6-45 kda
8 S5d hil-17rd MyD88 IL-17RD SEFIR ΔBox1 Box1 Box2 355 RPKVFLCYSSKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCREGQREWVIQKIHE 160 RFDAFICYCPSD----IQFVQEMIRQLEQTN-YRLKLCVSDRDVLP--GTCVWSIA---- S5e hil-17rd MyD88 hil-17rd MyD88 hil-17ra MyD SQFIIVVCSKGMKYFVDKKNYKHKGGGRGSGKGELFLVAVSAIAEKLRQAKQSSSAALSK 209 SELIEKRCRR-MVVVVSDDYLQSKE----CDFQTKFALSLSPGAHQKRLIPIKYKAMKKE IL-17RD SEFIR ΔBox3 Box3 * * * 475 FIAVY-FDYSCEGDVPGILDLSTKYRLMDNLPQLC 264 FPSILRFITVCDYTNP-----CTKSWFWTRLAKAL Box1 Box2 377 PRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAISEAGVMTWVGRQKQEM 160 RFDAFICYCPSDIQFVQEMIR----QLEQTNYRLKLCVSDRDVLPGTCVWSIAS----EL hil-17ra MyD VESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDFKRPACF 212 IEKRCRRMVVVVSDD-----YLQSKECDFQTKFALSLSPG----AHQKRLIP-IKYKAMK Box3 hil-17ra MyD GTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVY 262 KEFPSILRFITVCDYTNP-----CTKSWFWTRLAKAL Supplementary Figure 5. Selective Targeting of MyD88 by the SEFIT domain of IL-17RD (a-c) HEK293 cells were transfected for 24 h with (a) MyD88-FLAG or MyD88-TIR-FLAG with IL-17RD SEFIR-Myc or (b) MyD88- TIR-FLAG with TRAF6-HA and IL-17RD SEFIR-Myc or (c) MyD88, TRAF6-HA with IL-17RA-FLAG (RA), IL-17RA SEFIR-FLAG (RASEF), Act1-FLAG (Act), Act1 SEFIR-FLAG (ActSEF), IL-17RD-Myc (RD) and IL-17RD SEFIR-Myc (RDSEF). Cell lysates were subject to SDS-PAGE followed by immunoblotting with indicated antibodies. (d,e) Sequence allignment of (d) the IL-17RD SEFIR and MyD88 TIR domains or (e) the IL-17RA SEFIR and MyD88 TIR domains using ClustalW2 ( and BoxShade software ( Boxes 1, 2 and 3 of TIR and SEFIR domains are labelled and outlined. The black and grey shading represent amino acid identity and similarity respectively. Forward arrow indicates starting amino acid (after Start site) of IL-17RD SEFIR Box1 truncation mutant and reverse arrow indicates last amino acid of IL-17RD SEFIR Box3 truncation mutant (before STOP codon). Asterisks indicate mutated residues found in IL-17RD SEFIR T496P, IL-17RD SEFIR K497R and IL-17RD SEFIR L504Fpoint mutants. Data (a-c) are representative of 3 independent experiments. Full size images are presented in Supplementary Fig. S16.
9 S6 Wash #1 Wash #2 Wash # rmyd88 -GST ril-17rd -Myc SUPPLEMENTARY FIGURE 6 IP: GST IP: GST IB: GST - 35 kda Supplementary Figure 6. Recombinant IL-17RD fails to interact with recombinant MyD88 in vitro. Myc-tagged recombinant IL-17RD (ril-17rd-myc) was incubated with recombinant MyD88 (rmyd88-gst) for 1 h at 4 o C, followed by 1 h incubation with a specific anti-gst antibody prior to incubation for 1 h with agarose A/G beads. Immunoprecipitates were washed 3 times and washes were saved and protein concentrated using Amicon Ultra filters. Sample buffer was added to immunoprecipitates (beads) and flow-through wash samples, the samples were boiled and subject to SDS- PAGE followed by immunoblotting with indicated antibodies. Data are representative of 2 independent experiments. Images have been cropped for presentation. Full size images are presented in Supplementary Fig. S17.
10 Fig. 1h Control shrna IL-17RD shrna LPS (min) p-iκbα - 36 shrna Ctrl oe (Hek) IκBα IB: IL-17RD p-ikk - 85 IB: IL-17RD (lighter exposure) IKK β-actin - 45 Supplementary Figure 7: Full blots relating to Figure 1
11 Fig. 1i Control shrna IL-17RD shrna Poly(I:C) (min) p-irf3-55 IRF3-55 shrna Ctrl oe IB: IL-17RD p-tbk TBK1-84 β-actin Supplementary Figure 7 (continued) : Full blots relating to Figure 1
12 2d Il17rd +/+ Il17rd / LPS (min) polyubiquitinated IκBα Il17rd +/+ Il17rd / p-iκbα -36 IB: IL-17RD -80 p-ikk -85 IKK -85 p-irf3-50 IRF3-50 β-actin Supplementary Figure 8: Full blots relating to Figure 2
13 2e Il17rd Il17rd 2f +/+ / Poly(IC) Probe IgG SS LPS (min) (min) pirf3 Il17rd +/+ Il17rd / -50 NF-κB/Oligo binding p-iκbα -36 Free Probe IκBα -36 2g Il17rd +/+ Il17rd / Probe Comp Poly(I:C) (min) p-ikk -85 PRD I/III binding IKK -85 Free Probe β-actin IκBα Supplementary Figure 8 (continued): Full blots relating to Figure 2
14 2h 2i Il17rd +/+ EV Il17rd / EV mil-17rd Poly(I:C) (min) p-tbk1-84 TBK1-84 p-irf3-55 IRF3-55 Myc β-actin Supplementary Figure 8 (continued): Full blots relating to Figure 2
15 4a 4c MyD88-FLAG IL-17RD Full length -Myc IL-17RD ΔC -Myc 4e TLR4-FLAG IL-17RD WT-Myc IL-17RD ΔC -Myc Supplementary Figure 9: Full blots relating to Figure 4
16 4f MyD88 -FLAG IL-17RD -Myc IL-17RD ΔC -Myc 4g TLR4 -FLAG IL-17RD SEFIR -Myc IL-17RD SEFIR -Myc Supplementary Figure 9 (continued): Full blots relating to Figure 4
17 5a Il17rd 5b 5c +/+ Il17rd / LPS (min) IP: MyD88 IB: TLR4-110 Il17rd +/+ Il17rd / LPS(min) Il17rd +/+ Il17rd / Poly(I:C) (min) IP: MyD88 IB: TRAF6-60 IP: TRAF6 IB: Ub - 50 IP: TRAF6 IB: Ub IP: MyD88 IB: MyD88 IP: TRAF6 IB: TRAF6-50 IP: TRAF6 IB: TRAF6 IB: TLR4-110 IB: TRAF6-50 IB: TRAF6 IB: MyD88-40 IB: TRAF Supplementary Figure 10: Full blots relating to Figure 5
18 5d IB: HA/Myc MyD88 -FLAG TRAF6 -HA IL-17RD -Myc IL-17RD ΔC -Myc IL-17RD SEFIR -Myc e MyD88 -FLAG IL-17RD SEFIR-Myc IL-17RD SEFIR ΔBox1-Myc IL-17RD SEFIR ΔBox3-Myc 5g MyD88 -FLAG IL-17RD SEFIR -Myc IL-17RD SEFIR T496P -Myc IL-17RD SEFIR K497R -Myc IL-17RD SEFIR L504F -Myc IL-17RD SEFIR T496P/K497R -Myc IB: HA Supplementary Figure 10 (continued): Full blots relating to Figure 5
19 6a LPS (min) b IP: IL-17RD IB: MyD88-25 IL-17RD sirna Scrambled sirna LPS (min) IP: IL-17RD IB: IL-17RD IB: IL-17RD IP: IL-17RD IB: TLR4-110 IB: TLR4-110 IB: MyD Supplementary Figure 11: Full blots relating to Figure 6
20 Fig. S1a NT IL-17RD (ng) IL-17RD β-actin Supplementary Figure 12: Full blots relating to Figure S1
21 Fig. S2d Il17rd +/+ Il17rd / Probe comp LPS (min) NF-κB/Oligo binding Free Probe Supplementary Figure 13: Full blots relating to Figure S2
22 Fig. S3a Fig. S3b Il17rd +/+ Il17rd / Il17rd +/+ Il17rd / LPS (min) LPS (min) p-erk p-erk ERK ERK β-actin β-actin Supplementary Figure 14: Full blots relating to Figure S3
23 Fig. S4b TLR3-FLAG IL-17RD WT-Myc IL-17RD ΔC -Myc Fig. S4C Mal -FLAG IL-17RD -Myc IL-17RD ΔC -Myc IL-17RD SEFIR -Myc Supplementary Figure 15: Full blots relating to Figure S4
24 Fig. S4d TRIF -FLAG IL-17RD -Myc IL-17RD ΔC -Myc IL-17RD SEFIR -Myc Fig. S4e TLR3 -FLAG IL-17RD SEFIR -Myc Supplementary Figure 15 (continued): Full blots relating to Figure S4
25 Fig. S4h MyD88 -FLAG IL-17RD WT-Myc Fig. S4j MyD88 -FLAG IL-17RD WT-Myc IL-17RD E350A-Myc IL-17RD Y330F-Myc Supplementary Figure 15 (continued): Full blots relating to Figure S4
26 Fig. S5a MyD88-FLAG MyD88 TIR-FLAG IL17RD SEFIR-Myc Fig. S5b MyD88 TIR-FLAG TRAF6-HA IL-17RD SEFIR-Myc IB: HA -35 IB: HA -35 Supplementary Figure 16: Full blots relating to Figure S5
27 Fig. S5c MyD88+ TRAF6+ EV - - RA RASEF Act ActSEF RD RDSEF IP: MyD88 IB: TRAF6 IP: MyD IP: MyD88 IB: MyD IB: HA Supplementary Figure 16 (continued): Full blots relating to Figure S5
28 Fig. S6 Wash #1 Wash #2 Wash # rmyd88 -GST ril-17rd -Myc IP: GST IP: GST IB: GST - 35 Supplementary Figure 17: Full blots relating to Figure S6
RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh-
1 a b Supplementary Figure 1. Effects of GSK3b knockdown on poly I:C-induced cytokine production. RAW264.7 cells stably expressing control shrna (Con) or GSK3b-specific shrna (sh- GSK3b) were stimulated
Intracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation
Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining Btk activation Xingguang Liu, Zhenzhen Zhan, Dong Li, Li Xu, Feng Ma, Peng Zhang, Hangping Yao and Xuetao
Supplementary Figure 1
Supplementary Figure 1 YAP negatively regulates IFN- signaling. (a) Immunoblot analysis of Yap knockdown efficiency with sh-yap (#1 to #4 independent constructs) in Raw264.7 cells. (b) IFN- -Luc and PRDs
Tbk1-TKO! DN cells (%)! 15! 10!
a! T Cells! TKO! B Cells! TKO! b! CD4! 8.9 85.2 3.4 2.88 CD8! Tbk1-TKO! 1.1 84.8 2.51 2.54 c! DN cells (%)! 4 3 2 1 DP cells (%)! 9 8 7 6 CD4 + SP cells (%)! 5 4 3 2 1 5 TKO! TKO! TKO! TKO! 15 1 5 CD8
Supplementary Material
Supplementary Material accompanying the manuscript Interleukin 37 is a fundamental inhibitor of innate immunity Marcel F Nold, Claudia A Nold-Petry, Jarod A Zepp, Brent E Palmer, Philip Bufler & Charles
Supplementary Figure S1 Supplementary Figure S2
Supplementary Figure S A) The blots shown in Figure B were qualified by using Gel-Pro analyzer software (Rockville, MD, USA). The ratio of LC3II/LC3I to actin was then calculated. The data are represented
Supplementary Information
Supplementary Information mediates STAT3 activation at retromer-positive structures to promote colitis and colitis-associated carcinogenesis Zhang et al. a b d e g h Rel. Luc. Act. Rel. mrna Rel. mrna
condition. Left panel, the HCT-116 cells were lysed with RIPA buffer containing 0.1%
FIGURE LEGENDS Supplementary Fig 1 (A) sumoylation pattern detected under denaturing condition. Left panel, the HCT-116 cells were lysed with RIPA buffer containing 0.1% SDS in the presence and absence
SUPPLEMENTARY INFORMATION
Supplementary Table 1. Cell sphingolipids and S1P bound to endogenous TRAF2. Sphingolipid Cell pmol/mg TRAF2 immunoprecipitate pmol/mg Sphingomyelin 4200 ± 250 Not detected Monohexosylceramide 311 ± 18
SUPPLEMENTAL FIGURE LEGENDS
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure S1: Endogenous interaction between RNF2 and H2AX: Whole cell extracts from 293T were subjected to immunoprecipitation with anti-rnf2 or anti-γ-h2ax antibodies
SUPPLEMENTARY INFORMATION
doi: 10.1038/nature05732 SUPPLEMENTARY INFORMATION Supplemental Data Supplement Figure Legends Figure S1. RIG-I 2CARD undergo robust ubiquitination a, (top) At 48 h posttransfection with a GST, GST-RIG-I-2CARD
Integrin CD11b negatively regulates TLR-triggered inflammatory responses by. activating Syk and promoting MyD88 and TRIF degradation via cbl-b
Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting MyD88 and TRIF degradation via cbl-b Chaofeng Han, Jing Jin, Sheng Xu, Haibo Liu, Nan Li, and Xuetao
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:1.138/nature9814 a A SHARPIN FL B SHARPIN ΔNZF C SHARPIN T38L, F39V b His-SHARPIN FL -1xUb -2xUb -4xUb α-his c Linear 4xUb -SHARPIN FL -SHARPIN TF_LV -SHARPINΔNZF -SHARPIN
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO
Supplementary Information p47 negatively regulates IKK activation by inducing the lysosomal degradation of polyubiquitinated NEMO Yuri Shibata, Masaaki Oyama, Hiroko Kozuka-Hata, Xiao Han, Yuetsu Tanaka,
Reviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): In this manuscript, Song et al. identified FBXW7 as a new positive regulator for RIG-Itriggered type I IFN signaling pathway. The authors observed
Table S1. Primer sequences used for qrt-pcr. CACCATTGGCAATGAGCGGTTC AGGTCTTTGCGGATGTCCACGT ACTB AAGTCCATGTGCTGGCAGCACT ATCACCACTCCGAAGTCCGTCT LCOR
Table S1. Primer sequences used for qrt-pcr. ACTB LCOR KLF6 CTBP1 CDKN1A CDH1 ATF3 PLAU MMP9 TFPI2 CACCATTGGCAATGAGCGGTTC AGGTCTTTGCGGATGTCCACGT AAGTCCATGTGCTGGCAGCACT ATCACCACTCCGAAGTCCGTCT CGGCTGCAGGAAAGTTTACA
Title: Cytosolic DNA-mediated, STING-dependent pro-inflammatory gene. Fig. S1. STING ligands-mediated signaling response in MEFs. (A) Primary MEFs (1
1 Supporting Information 2 3 4 Title: Cytosolic DNA-mediated, STING-dependent pro-inflammatory gene induction necessitates canonical NF-κB activation through TBK1 5 6 Authors: Abe et al. 7 8 9 Supporting
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
Supplementary Figure 1. MAT IIα is Acetylated at Lysine 81.
IP: Flag a Mascot PTM Modified Mass Error Position Gene Names Score Score Sequence m/z [ppm] 81 MAT2A;AMS2;MATA2 35.6 137.28 _AAVDYQK(ac)VVR_ 595.83-2.28 b Pre-immu After-immu Flag- WT K81R WT K81R / Flag
Supplementary information. MARCH8 inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins
Supplementary information inhibits HIV-1 infection by reducing virion incorporation of envelope glycoproteins Takuya Tada, Yanzhao Zhang, Takayoshi Koyama, Minoru Tobiume, Yasuko Tsunetsugu-Yokota, Shoji
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
NOD1 contributes to mouse host defense against Helicobacter pylori via induction of type I IFN and activation of the ISGF3 signaling pathway
Research article NOD1 contributes to mouse host defense against Helicobacter pylori via induction of type I IFN and activation of the ISGF3 signaling pathway Tomohiro Watanabe, 1,2 Naoki Asano, 1 Stefan
supplementary information
DOI: 10.1038/ncb1875 Figure S1 (a) The 79 surgical specimens from NSCLC patients were analysed by immunohistochemistry with an anti-p53 antibody and control serum (data not shown). The normal bronchi served
Peli1 negatively regulates T-cell activation and prevents autoimmunity
Peli1 negatively regulates T-cell activation and prevents autoimmunity Mikyoung Chang 1,*, Wei Jin 1,5,*, Jae-Hoon Chang 1, Yi-chuan Xiao 1, George Brittain 1, Jiayi Yu 1, Xiaofei Zhou 1, Yi-Hong Wang
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin
Supplementary Figure 1. Procedures for p38 activity imaging in living cells. (a) Schematic model of the p38 activity reporter. The reporter consists
Supplementary Figure 1. Procedures for p38 activity imaging in living cells. (a) Schematic model of the p38 activity reporter. The reporter consists of: (i) the YPet domain (an enhanced YFP); (ii) the
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/10/471/eaah5085/dc1 Supplementary Materials for Phosphorylation of the exocyst protein Exo84 by TBK1 promotes insulin-stimulated GLUT4 trafficking Maeran Uhm,
Stewart et al. CD36 ligands promote sterile inflammation through assembly of a TLR 4 and 6 heterodimer
NFκB (fold induction) Stewart et al. ligands promote sterile inflammation through assembly of a TLR 4 and 6 heterodimer a. mrna (fold induction) 5 4 3 2 1 LDL oxldl Gro1a MIP-2 RANTES mrna (fold induction)
T H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Chairoungdua et al., http://www.jcb.org/cgi/content/full/jcb.201002049/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Expression of CD9 and CD82 inhibits Wnt/ -catenin
A. List of selected proteins with high SILAC (H/L) ratios identified in mass
Supplementary material Figure S1. Interaction between UBL5 and FANCI A. List of selected proteins with high SILAC (H/L) ratios identified in mass spectrometry (MS)-based analysis of UBL5-interacting proteins,
Nature Immunology doi: /ni Supplementary Figure 1. Raf-1 inhibition does not affect TLR4-induced type I IFN responses.
Supplementary Figure 1 Raf-1 inhibition does not affect TLR4-induced type I IFN responses. Real-time PCR analyses of IFNB, ISG15, TRIM5, TRIM22 and APOBEC3G mrna in modcs 6 h after stimulation with TLR4
Supplements. Figure S1. B Phalloidin Alexa488
Supplements A, DMSO, PP2, PP3 Crk-myc Figure S1. (A) Src kinase activity is necessary for recruitment of Crk to Nephrin cytoplasmic domain. Human podocytes expressing /7-NephrinCD () were treated with
Nature Immunology: doi: /ni.3866
Nature Immunology: doi:10.1038/ni.3866 Supplementary Figure 1 The effect of TIPE2 on chemotaxis. a, The expression of TIPE2 in dhl-60c, dhl-60t, TIPE2-expressing and 15/16Q-expressing dhl-60t neutrophils
Supplementary Figure 1
Supplementary Figure 1 Constitutive EGFR signaling does not activate canonical EGFR signals (a) U251EGFRInd cells with or without tetracycline exposure (24h, 1µg/ml) were treated with EGF for 15 minutes
NLRC5 Negatively Regulates the NF-kB and Type I Interferon Signaling Pathways
NLRC5 Negatively Regulates the NF-kB and Type I Interferon Signaling Pathways Jun Cui, 1,2,5 Liang Zhu, 1,3,5 Xiaojun Xia, 1,5 Helen Y. Wang, 1 Xavier Legras, 1 Jun Hong, 1 Jiabing Ji, 1 Pingping Shen,
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with
TNFα- and IKKβ-mediated TANK/I-TRAF phosphorylation: implications for interaction with NEMO/IKKγ and NF-κB activation
Biochem. J. (2006) 394, 593 603 (Printed in Great Britain) doi:10.1042/bj20051659 593 TNFα- and IKKβ-mediated TANK/I-TRAF phosphorylation: implications for interaction with NEMO/IKKγ and NF-κB activation
Supplementary Figure 1. PAQR3 knockdown inhibits SREBP-2 processing in CHO-7 cells CHO-7 cells were transfected with control sirna or a sirna
Supplementary Figure 1. PAQR3 knockdown inhibits SREBP-2 processing in CHO-7 cells CHO-7 cells were transfected with control sirna or a sirna targeted for hamster PAQR3. At 24 h after the transfection,
Pro-apoptotic signalling through Toll-like receptor 3 involves TRIF-dependent
Pro-apoptotic signalling through Toll-like receptor 3 involves TRIF-dependent activation of caspase-8 and is under the control of inhibitor of apoptosis proteins in melanoma cells Arnim Weber, Zofia Kirejczyk,
(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
fig. S1 Gene silencing of LC3B by sirna enhances IL-1β secretion. Peritoneal
15 Scramble sirna LC3B sirna IL-1β (pg/ml) 1 5 LC3B (kda) - 18 (LC3B I) - 16 (LC3B II) β-actin - 42 ( _ ) LPS LPS ATP fig. S1 Gene silencing of LC3B by sirna enhances IL-1β secretion. Peritoneal macrophages
SUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2566 Figure S1 CDKL5 protein expression pattern and localization in mouse brain. (a) Multiple-tissue western blot from a postnatal day (P) 21 mouse probed with an antibody against CDKL5.
SUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
Type of file: PDF Title of file for HTML: Supplementary Information Description: Supplementary Figures
Type of file: PDF Title of file for HTML: Supplementary Information Description: Supplementary Figures Type of file: MOV Title of file for HTML: Supplementary Movie 1 Description: NLRP3 is moving along
SUPPLEMENTARY INFORMATION
Figure S1. Silver staining and immunoblotting of the purified TAK1 kinase complex. The TAK1 kinase complex was purified through tandem affinity methods (Protein A and FLAG), and aliquots of the purified
SUPPLEMENTARY INFORMATION
DOI:.38/ncb2822 a MTC02 FAO cells EEA1 b +/+ MEFs /DAPI -/- MEFs /DAPI -/- MEFs //DAPI c HEK 293 cells WCE N M C P AKT TBC1D7 Lamin A/C EEA1 VDAC d HeLa cells WCE N M C P AKT Lamin A/C EEA1 VDAC Figure
Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
Live cell imaging of trafficking of the chaperone complex vaccine to the ER. BMDCs were incubated with ER-Tracker Red (1 M) in staining solution for
Live cell imaging of trafficking of the chaperone complex vaccine to the ER. BMDCs were incubated with ER-Tracker Red (1 M) in staining solution for 15 min at 37 C and replaced with fresh complete medium.
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/9/439/ra78/dc1 Supplementary Materials for Small heterodimer partner mediates liver X receptor (LXR) dependent suppression of inflammatory signaling by promoting
Supplementary information
Supplementary information Exosomes mediate the cell-to-cell transmission of interferon alpha-induced antiviral activity Jianhua Li, Kuancheng Liu, Yang Liu, Yan Xu, Fei Zhang, Huijuan Yang, Jiangxia Liu,
Supplementary Data Table of Contents:
Supplementary Data Table of Contents: - Supplementary Methods - Supplementary Figures S1(A-B) - Supplementary Figures S2 (A-B) - Supplementary Figures S3 - Supplementary Figures S4(A-B) - Supplementary
Supplementary Information
Supplementary Information An orally available, small-molecule interferon inhibits viral replication Hideyuki Konishi 1, Koichi Okamoto 1, Yusuke Ohmori 1, Hitoshi Yoshino 2, Hiroshi Ohmori 1, Motooki Ashihara
A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS
A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar
Supplemental Figure 1
Supplemental Figure 1 1a 1c PD-1 MFI fold change 6 5 4 3 2 1 IL-1α IL-2 IL-4 IL-6 IL-1 IL-12 IL-13 IL-15 IL-17 IL-18 IL-21 IL-23 IFN-α Mut Human PD-1 promoter SBE-D 5 -GTCTG- -1.2kb SBE-P -CAGAC- -1.kb
Supplementary Figure 1
Supplementary Figure 1 a γ-h2ax MDC1 RNF8 FK2 BRCA1 U2OS Cells sgrna-1 ** 60 sgrna 40 20 0 % positive Cells (>5 foci per cell) b ** 80 sgrna sgrna γ-h2ax MDC1 γ-h2ax RNF8 FK2 MDC1 BRCA1 RNF8 FK2 BRCA1
SUPPLEMENTARY INFORMATION
doi:10.1038/nature11700 Figure 1: RIP3 as a potential Sirt2 interacting protein. Transfected Flag-tagged Sirt2 was immunoprecipitated from cells and eluted from the Sepharose beads using Flag peptide.
Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS
Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS nucleotide sequences (a, b) or amino acid sequences (c) from
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature11429 S1a 6 7 8 9 Nlrc4 allele S1b Nlrc4 +/+ Nlrc4 +/F Nlrc4 F/F 9 Targeting construct 422 bp 273 bp FRT-neo-gb-PGK-FRT 3x.STOP S1c Nlrc4 +/+ Nlrc4 F/F casp1
Predictive PP1Ca binding region in BIG3 : 1,228 1,232aa (-KAVSF-) HEK293T cells *** *** *** KPL-3C cells - E E2 treatment time (h)
Relative expression ERE-luciferase activity activity (pmole/min) activity (pmole/min) activity (pmole/min) activity (pmole/min) MCF-7 KPL-3C ZR--1 BT-474 T47D HCC15 KPL-1 HBC4 activity (pmole/min) a d
SUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis
Supplementary Figure 1. PD-L1 is glycosylated in cancer cells. (a) Western blot analysis of PD-L1 in breast cancer cells. (b) Western blot analysis of PD-L1 in ovarian cancer cells. (c) Western blot analysis
Supplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1 Schematic depiction of the tandem Fc GDF15. Supplementary Figure 2 Supplementary Figure 2 Gfral mrna levels in the brains of both wild-type and knockout Gfral
William C. Comb, Jessica E. Hutti, Patricia Cogswell, Lewis C. Cantley, and Albert S. Baldwin
Molecular Cell, Volume 45 Supplemental Information p85 SH2 Domain Phosphorylation by IKK Promotes Feedback Inhibition of PI3K and Akt in Response to Cellular Starvation William C. Comb, Jessica E. Hutti,
TACI triggers immunoglobulin class switching by activating B cells through the adaptor protein MyD88
Revised NI-A13051-T, He et al. TACI triggers immunoglobulin class switching by activating B cells through the adaptor protein MyD88 Bing He, 1* Raul antamaria, 2* Weifeng Xu, 1 Montserrat Cols, 1 Kang
SUPPLEMENTARY INFORMATION
doi: 1.138/nature89 IFN- (ng ml ) 5 4 3 1 Splenocytes NS IFN- (ng ml ) 6 4 Lymph node cells NS Nfkbiz / Nfkbiz / Nfkbiz / Nfkbiz / IL- (ng ml ) 3 1 Splenocytes IL- (ng ml ) 1 8 6 4 *** ** Lymph node cells
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
Nature Medicine: doi: /nm.3922
Title: Glucocorticoid-induced tumor necrosis factor receptor-related protein co-stimulation facilitates tumor regression by inducing IL-9-producing helper T cells Authors: Il-Kyu Kim, Byung-Seok Kim, Choong-Hyun
Nature Immunology doi: /ni.3268
Supplementary Figure 1 Loss of Mst1 and Mst2 increases susceptibility to bacterial sepsis. (a) H&E staining of colon and kidney sections from wild type and Mst1 -/- Mst2 fl/fl Vav-Cre mice. Scale bar,
p = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG
A.. Relative # of ECs associated with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 ol b p < 0.001 Relative # of blood vessels that formed with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 l b p = 0.002 Control IHC:
Nature Immunology: doi: /ni Supplementary Figure 1. IC261 inhibits a virus-induced type I interferon response.
Supplementary Figure 1 IC261 inhibits a virus-induced type I interferon response. (a) HEK293T cells were cultured in 384 wells and transiently transfected with 50 ng of the IFN-β promoter-luc construct
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette
Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk
Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk Xingguang Liu 1, Zhenzhen Zhan 1, Dong Li, Li Xu 1, Feng Ma, Peng Zhang 1,
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/4/199/ra75/dc1 Supplementary Materials for Signaling by the Matrix Proteoglycan Decorin Controls Inflammation and Cancer Through PDCD4 and MicroRNA-21 Rosetta
Brd4 Coactivates Transcriptional Activation of NF- B via Specific Binding to Acetylated RelA
MOLECULAR AND CELLULAR BIOLOGY, Mar. 2009, p. 1375 1387 Vol. 29, No. 5 0270-7306/09/$08.00 0 doi:10.1128/mcb.01365-08 Copyright 2009, American Society for Microbiology. All Rights Reserved. Brd4 Coactivates
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/366/ra25/dc1 Supplementary Materials for Viral entry route determines how human plasmacytoid dendritic cells produce type I interferons Daniela Bruni, Maxime
Muramyl dipeptide activation of nucleotidebinding oligomerization domain 2 protects mice from experimental colitis
Research article Muramyl dipeptide activation of nucleotidebinding oligomerization domain 2 protects mice from experimental colitis Tomohiro Watanabe, 1,2 Naoki Asano, 1 Peter J. Murray, 3 Keiko Ozato,
Trim29 gene-targeting strategy. (a) Genotyping of wildtype mice (+/+), Trim29 heterozygous mice (+/ ) and homozygous mice ( / ).
Supplementary Figure 1 Trim29 gene-targeting strategy. (a) Genotyping of wildtype mice (+/+), Trim29 heterozygous mice (+/ ) and homozygous mice ( / ). (b) Immunoblot analysis of TRIM29 in lung primary
SUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
Supplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
Supplemental Fig. 1. Relative mrna Expression. Relative mrna Expression WT KO WT KO RT 4 0 C
Supplemental Fig. 1 A 1.5 1..5 Hdac11 (ibat) n=4 n=4 n=4 n=4 n=4 n=4 n=4 n=4 WT KO WT KO WT KO WT KO RT 4 C RT 4 C Supplemental Figure 1. Hdac11 mrna is undetectable in KO adipose tissue. Quantitative
Supplementary Materials
Supplementary Materials Figure S1. MTT Cell viability assay. To measure the cytotoxic potential of the oxidative treatment, the MTT [3-(4,5-dimethylthiazol- 2-yl)-2,5-diphenyl tetrazolium bromide] assay
SUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3076 Supplementary Figure 1 btrcp targets Cep68 for degradation during mitosis. a) Cep68 immunofluorescence in interphase and metaphase. U-2OS cells were transfected with control sirna
File Name: Supplementary Information Description: Supplementary Figures and Supplementary Tables. File Name: Peer Review File Description:
File Name: Supplementary Information Description: Supplementary Figures and Supplementary Tables File Name: Peer Review File Description: Primer Name Sequence (5'-3') AT ( C) RT-PCR USP21 F 5'-TTCCCATGGCTCCTTCCACATGAT-3'
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/364/ra18/dc1 Supplementary Materials for The tyrosine phosphatase (Pez) inhibits metastasis by altering protein trafficking Leila Belle, Naveid Ali, Ana Lonic,
HEK293FT cells were transiently transfected with reporters, N3-ICD construct and
Supplementary Information Luciferase reporter assay HEK293FT cells were transiently transfected with reporters, N3-ICD construct and increased amounts of wild type or kinase inactive EGFR. Transfections
SUPPLEMENTARY INFORMATION
doi:10.1038/nature11095 Supplementary Table 1. Summary of the binding between Angptls and various Igdomain containing receptors as determined by flow cytometry analysis. The results were summarized from
Supplementary Figure 1 Maschalidi et al.
a 1% 5% % 1% 5% % OVAb βgal activity A.U. (x1 4 ) 2 1 5 βgal activity A.U. (x1 4 ) 2 1 BSAb 2 hours 4 hours OVAb BSAb OVAb BSAb,1 1 1 1 SIINFEKL (ng/ml) CFSE b Beads Alexa488 (%) 8 6 4 2 ** ** 1:1 5:1
Impact of hyper-o-glcnacylation on apoptosis and NF-κB activity SUPPLEMENTARY METHODS
SUPPLEMENTARY METHODS 3D culture and cell proliferation- MiaPaCa-2 cell culture in 3D was performed as described previously (1). Briefly, 8-well glass chamber slides were evenly coated with 50 µl/well
Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression
Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan
Tumor stage : I II III IV. well differentiated. moderately differentiated. adenocarcinoma. normal colon (adjacent to cancer) Log (T/H) SLAP mrna level
moderately differentiated well differentiated Log (T/H) mrna level a Tumor stage : I II III IV.4.4.8 1.2 1.6 2. 2.4 2.8 3.2 N 1 2 3 4 5 6 7 8 9 1 11 12 13 14 15 16 17 # patient b normal colon (adjacent
Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells
Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Immunofluorescence staining of H3K9me3 and 53BP1 in PH and HGADFN003 (HG003) cells at 24 h after γ-irradiation. Scale bar,
RIG-I dependent sensing of poly(da-dt) via the induction of an RNA
RI-I dependent sensing of via the induction of an RNA polymerase III transcribed RNA intermediate Andrea Ablasser 1*, Franz Bauernfeind 1*, unther Hartmann 1, Eicke Latz 2, Katherine A. Fitzgerald 2* and
Supplementary information
Supplementary information Human Cytomegalovirus MicroRNA mir-us4-1 Inhibits CD8 + T Cell Response by Targeting ERAP1 Sungchul Kim, Sanghyun Lee, Jinwook Shin, Youngkyun Kim, Irini Evnouchidou, Donghyun
FIG S1 Examination of eif4b expression after virus infection. (A) A549 cells
Supplementary Figure Legends FIG S1 Examination of expression after virus infection. () 549 cells were infected with herpes simplex virus (HSV) (MOI = 1), and harvested at the indicated times, followed
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate
m 6 A mrna methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer
SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41556-018-0174-4 In the format provided by the authors and unedited. m 6 A mrna methylation regulates AKT activity to promote the proliferation
Supporting Information Table of Contents
Supporting Information Table of Contents Supporting Information Figure 1 Page 2 Supporting Information Figure 2 Page 4 Supporting Information Figure 3 Page 5 Supporting Information Figure 4 Page 6 Supporting