AP VP DLP H&E. p-akt DLP
|
|
- Kimberly Sutton
- 5 years ago
- Views:
Transcription
1 A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy of mouse prostate: anterior prostate (AP), ventral prostate (VP), and dorsal-lateral prostate (DLP). Wild-type mouse prostate is shown at 12 weeks of age. (B) PTEN loss in prostate epithelium resulted in HG-PIN accompanied by activated downstream AKT signaling. Prostate lobes of PTEN lox/lox ; PbCre4 (i.e. PTEN-null) mouse were harvested at 12 weeks of age and stained with H&E and p-akt (S473).
2 a HG-PIN surgical castration Tumorigenesis of PTEN -/- prostates 8 wks weeks post castration (age) (wks) lymphocyte infiltration lymphocyte infiltration apoptosis invasion invasion b relative levels Testosterone In circulation (n 8) relative levels Testosterone Intra-prostate Human Mice Human Mice PIN CRPC PIN CRPC Intact Castrated Supplementary Fig. 2. a. Androgen deprivation potentiated disease progression from HG-PIN to invasive castration-resistant prostatic adenocarcinoma. Mice harboring HG-PIN were castrated at 8 weeks of age, and PTEN-null prostate tumors developed invasive castrationresistant prostate cancer (CRPC) over the time. b. Testosterone levels in CRPC dramatically decreased compared to intact PIN mice. Testosterone levels were measured in circulation (left panel) and intra-prostate (middle panel) in CRPC post castration 16 wks. Testosterone amounts in circulation in human vs mice with intact or castration conditions. (n 8) ne amount ulation Testostero in circu (ng/dl)
3 H&E SMA CK8 p63 Supplementary Fig. 3. Invasive CRPC lesions contained both luminal cells and basal-like cells. FFPE prostate tissues containing invasive lesions from Supplementary Fig.2 were stained with SMA (smooth muscle marker), CK8 (luminal cell marker) and p63 (basal cell marker).
4 Supplementary Fig. 4. AR expression increased in castration-resistant prostate cancer. Western blot of AR using prostates isolated from age-matched wide-type littermates (WT), PTEN-null HG-PIN (PIN), PTEN-null castration-resistant prostate cancer (CRPC). For CRPC samples, HG-PIN harboring mice were castrated at 8 weeks of age and CRPC samples were harvested 6 weeks or 16 weeks post castration. Note that there is a 1.7-fold increase of AR protein in VP and 2.3-fold increase in AP when CRPC compared to HG-PIN. Normalized quantification of AR expression at 16 weeks post castration is shown below.
5 post castration 6 weeks AP VP DLP WT HG-PIN CRPC WT HG-PIN CRPC WT HG-PIN CRPC p53 AR, c-19 Quantification p53 16 weeks 16 weeks p53 Vinculin SMAD4 a-tubulin ification Quanti SMAD4 Supplementary Fig. 5. Down-regulated expression of p53 and SMAD4 in castration-resistant prostate cancer. Western blot of p53 and SMAD4 using prostates isolated from age-matched wide-type littermate (WT), PTEN-null HG-PIN (PIN), PTEN-null castration-resistant prostate cancer (CRPC). In case of CRPC, HG-PIN harboring mice were castrated at 8 weeks of age and CRPC samples were harvested 6 weeks or 16 weeks post castration. Note the loss of p53 and down-regulation of SMAD4 at 16 weeks post castration (see red box). Normalized quantification of p53 and SMAD4 at 16 weeks post castration is shown (right).
6 a CRPC: forward b CRPC: reverse d HG-PIN: forward c CRPC allele-specific PCR amplicon: reverse 5 - T G T C C T A G A - 3 anti-sense strand sense strand 5 - T C T G G G A C A A C A G G A T C T - 5 sense strand 5 - Ser Gly Thr Thr Arg Ser - 5 Supplementary Fig. 6. p53 somatic point mutations in PTEN-null CRPC. HG-PIN harboring mice were castrated at 8 weeks of age, and CRPC samples were isolated 16 weeks post castration. Prostate genomic DNA was used to amplify p53 exons followed by Sanger sequencing. Conventional PCR amplicons using CRPC genomic DNA were sequenced using both p53 forward primer (a) and reverse primer (b). p53 mutant amplicons were enriched in a mutation allele-specific PCR using the same DNA in (a) and (b) prior to Sanger sequencing using reverse primers (c). Conventional PCR amplicons using prostate DNA of HG-PIN or wild-type were sequenced using p53 primers, where no point mutations ever found. A representative forward sequencing result is shown (d). Note the position of p53 somatic point mutation (red arrow) and the resulting amino acid change in mouse (yellow box), i.e. p53 G114R (Gly Arg), corresponding to human p53 G117R (Gly Arg).
7 p63 DAPI p63/dapi HG-PIN CRPC (intra-luminal) CRPC (invasive) SMA p63/sma p63/sma/dapi S l t Fi 7 A d d i ti l dt i d 63 iti ith li l ll i th lti t I fl Supplementary Fig. 7. Androgen deprivation led to increased p63-positive epithelial cells in the resulting tumors. Immunofluorescence staining: p63 (red), SMA (green) and DAPI (blue). Top panel (HG-PIN): note the disconnected thin layer of spindle-shaped p63-positive basal epithelial cells (arrow head). Middle panel: the enrichment of intra-luminal p63-positive cells in CRPC lesion (arrow). Lower panel: the enrichment of enlarged rounded nuclei of p63-positive epithelial cells in the invasive lesions lining above SMA-stained stromal layer (arrow), as compared to the spindle shaped smaller nuclei of basal epithelial cells (arrow head).
8 ** ** ** Sham operation Surgical castration Supplementary Fig. 8. Androgen deprivation led to increased p63-positive epithelial cells in the resulting tumors. p63- positive epithelial tumor cells were calculated in up to 100 ventral prostate glands / per group, n=12 mice per group. Two groups: sham operation vs. surgical castration.
9 a Pten f/f; Pb-Cre Placebo MDV AP VP DLP Prostate tumor weight (mg) p< p>0.05 Vehicle (n=9) MDV (n=13) p< AP VP DLP b CRPC H&E invasion AR invasion p63 invasion H& E AR p63 HG-PIN Supplementary Fig. 9. MDV3100 treatment also resulted ultimately in the progression to invasiveness of otherwise stable HG-PIN. Mice pp y g y p g harboring PTEN-null HG-PIN at 8 weeks of age were treated with MDV3100 or vehicle via oral gavage daily. a. Prostate tissues were harvested and weighted 16 weeks post chemical castration. b. Prostate tissues were stained with H&E, AR, and p63. Note the invasive lesions (black arrow) enrichment of p63-positive cells in CRPC. However, the HG-PIN (control tumor) is well localized within the boundary surrounded by basement membrane (H&E), and p63 IHC staining labels a thin, disconnected layer of p63-positive spindle shaped basal epithelial cells (blue arrow).
10 p110β dose PTEN -/- ; p110β +/+ PTEN -/- ; p110β +/- PTEN -/- ; p110β -/- Supplementary Fig. 10. Genetic ablation of p110β impairs prostate tumorigenesis in the AP in a dose-dependent manner. Heterozygous mice obtained during the breeding process showed that loss of a single copy of p110β impaired PTEN-controlled tumorigenesis in a dose-dependent manner. Left: H&E, Right: prostate weight (mg). Anterior prostates are shown at 12 weeks of age.
11 AP VP DLP PTEN-/-; p110β-/-; p110α-/- PTEN-/-; p110β-/-; p110α+/- Supplementary Fig. 11. In VP and DLP, genetic ablation of one p110α allele in the p110β null background restored the normal ductal structure in PTEN-/-; p110β-/- ; p110α+/- prostates. Prostates are shown at 12 weeks of age.
12 Placebo BEZ235 Placebo BEZ235 CRPC, PTEN-null Surgical castration Primary HG-PIN, PTEN-null Sham operation Supplementary Fig. 12. Inhibition of PI3K pathway only partially affected the proliferation of PTEN-null CRPC prostate tumors. Mice harboring PTEN-null HG-PIN at 8 weeks of age underwent either surgical castration (left panel) or sham operation (right panel) for 16 weeks. Mice were then treated with BEZ235 or placebo. Brdu was administered at 1-hour post treatment and samples harvested 5 hours later. Shown are Brdu immunohistochemical staining.
13 wild-type HG-PIN CRPC AP VP DLP AP VP DLP AP VP DLP pakt 6 weeks post castration perk1/2 Tubulin 1 2 Quantificatio on pakt on Quantificati perk1/2 Supplementary Fig 13 The gradual signaling shift between PI3K and MAPK pathways in castration-resistant prostate tumors Tissue Supplementary Fig. 13. The gradual signaling shift between PI3K and MAPK pathways in castration-resistant prostate tumors. Tissue western for prostates of wild-type (WT), Pten-null HG-PIN (PIN), PTEN-null castration-resistant prostate tumors (CRPC). Mice were castrated at 8 weeks of age, and CRPC samples harvested 6 weeks post castration. Normalized quantification of pakt and p-erk1/ in VP is shown.
14 per duct 100 * ** * BrdU- -positive cells Placebo BEZ235 Placebo BEZ235 Placebo BEZ235 AZD6244 BEZ235+ AZD6244 * Supplementary Fig. 14. Concurrent inhibition of PI3K and MAPK signaling pathways substantially suppressed cell division of CRPC. Mice harboring PTEN-null HG-PIN at 8 weeks of age underwent surgical castration for 16 weeks. Mice were then treated with placebo, BEZ235, AZD6244, or combo. BrdU was administered at 1-hour post treatment and prostate tissues were harvested 5 hours later. BrdU IHC staining was shown in Fig 4b, and the percentage of Brdu+ cells per duct was calculated here.
SUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2697 Figure S1 Cytokeratin 5 is a specific marker for basal and intermediate cells in all mouse prostate lobes. (a) Immunofluorescence staining showing co-localization of YFP with p63 in
More informationSOPten flox/flox (KO) Pten flox/flox (WT) flox allele 6.0 kb. Pten. Actin. ! allele 2.3 kb. Supplementary Figure S1. Yanagi, et al.
s1 A Pten flox/flox () SOPten flox/flox () flox allele 6. kb B Pten flox/flox () SOPten flox/flox () Pten Actin! allele 2.3 kb Supplementary Figure S1. Yanagi, et al. A B BrdU BrdU positive cells ( ) 3
More informationSupplemental Figure S1. RANK expression on human lung cancer cells.
Supplemental Figure S1. RANK expression on human lung cancer cells. (A) Incidence and H-Scores of RANK expression determined from IHC in the indicated primary lung cancer subgroups. The overall expression
More informationSupplementary Figure 1
Combination index (CI) Supplementary Figure 1 2. 1.5 1. Ishikawa AN3CA Nou-1 Hec-18.5...2.4.6.8 1. Fraction affected (Fa) Supplementary Figure 1. The synergistic effect of PARP inhibitor and PI3K inhibitor
More informationSupplementary Figure 1. Successful excision of genes from WBM lysates and
Supplementary Information: Supplementary Figure 1. Successful excision of genes from WBM lysates and survival of mice with different genotypes. (a) The proper excision of Pten, p110α, p110α and p110δ was
More informationSupplementary Material
Supplementary Material The Androgen Receptor is a negative regulator of eif4e Phosphorylation at S209: Implications for the use of mtor inhibitors in advanced prostate cancer Supplementary Figures Supplemental
More informationInfect MCF-7 cells carrying dcas9-vp64 + psm2-p65-hsf1 with SAM library or vector. Introduce AKT reporter
Infect MCF-7 cells carrying dcas9-vp64 + psm2-p65-hsf1 with SM library or vector Introduce reporter Grow cells in presence of puromycin for 5 days Vector control SM library fewer surviving cells More surviving
More informationSupplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.
Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationEGFR shrna A: CCGGCGCAAGTGTAAGAAGTGCGAACTCGAGTTCGCACTTCTTACACTTGCG TTTTTG. EGFR shrna B: CCGGAGAATGTGGAATACCTAAGGCTCGAGCCTTAGGTATTCCACATTCTCTT TTTG
Supplementary Methods Sequence of oligonucleotides used for shrna targeting EGFR EGFR shrna were obtained from the Harvard RNAi consortium. The following oligonucleotides (forward primer) were used to
More informationSupplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic B cells from WT Nfat2 +/+, TCL1 Nfat2 +/+ and TCL1 Nfat2
More informationJames C. Fleet, PhD Professor Dept of Nutrition Science Purdue University
James C. Fleet, PhD Professor Dept of Nutrition Science Purdue University Overview What are we trying to model? Vitamin D biology Cancer Is there in vivo proof of principle for vitamin D/cancer relationship?
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationSupplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
More informationstability and tumor suppression
Supplementary information The stress kinase MKK7 couples oncogenic stress to p53 stability and tumor suppression Daniel Schramek 1, Athanassios Kotsinas 2, Arabella Meixner 1, Teiji Wada 1, Ulrich Elling
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationSupplementary Figure 1. Double-staining immunofluorescence analysis of invasive colon and breast cancers. Specimens from invasive ductal breast
Supplementary Figure 1. Double-staining immunofluorescence analysis of invasive colon and breast cancers. Specimens from invasive ductal breast carcinoma (a) and colon adenocarcinoma (b) were staining
More information(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
More informationSUPPLEMENTARY FIGURE LEGENDS
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Hippocampal sections from new-born Pten+/+ and PtenFV/FV pups were stained with haematoxylin and eosin (H&E) and were imaged at (a) low and (b) high
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationTargeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics. For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from
Supplementary Methods: Targeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from mouse tumor samples and analyzed as
More informationMolecular and genetic analysis of stromal fibroblasts in prostate cancer
Final report ESMO Translational Research Fellowship 2010-2011 Molecular and genetic analysis of stromal fibroblasts in prostate cancer Michalis Karamouzis Host Institute Department of Biological Chemistry,
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationRationale Design of Combination Therapy in Prostate Cancer: Targeting the AR and PI3K pathways
Rationale Design of Combination Therapy in Prostate Cancer: Targeting the AR and PI3K pathways Brett S Carver, MD Assistant Attending, Department of Surgery/Urology Prostate Cancer Therapeutics: A Changed
More informationBezzi et al., Supplementary Figure 1 *** Nature Medicine: doi: /nm Pten pc-/- ;Zbtb7a pc-/- Pten pc-/- ;Pml pc-/- Pten pc-/- ;Trp53 pc-/-
Gr-1 Gr-1 Gr-1 Bezzi et al., Supplementary Figure 1 a Gr1-CD11b 3 months Spleen T cells 3 months Spleen B cells 3 months Spleen Macrophages 3 months Spleen 15 4 8 6 c CD11b+/Gr1+ cells [%] 1 5 b T cells
More informationTitle: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events
Title: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events Pu Yang 1, 3, radley M. Schmit 1, Chunhua Fu 1, Kenneth DeSart 1, S. Paul
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationLayered-IHC (L-IHC): A novel and robust approach to multiplexed immunohistochemistry So many markers and so little tissue
Page 1 The need for multiplex detection of tissue biomarkers. There is a constant and growing demand for increased biomarker analysis in human tissue specimens. Analysis of tissue biomarkers is key to
More informationSupplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis (a) Immunohistochemical (IHC) analysis of tyrosine 705 phosphorylation status of STAT3 (P- STAT3) in tumors and stroma (all-time
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationSupplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as
Supplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as well as their downstream effectors across a panel of ESCC
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationSupplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses
Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses using an anti-cre antibody; testes at 1 week (left panel),
More informationSupplementary Table 1. List of primers used in this study
Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3
More informationp.r623c p.p976l p.d2847fs p.t2671 p.d2847fs p.r2922w p.r2370h p.c1201y p.a868v p.s952* RING_C BP PHD Cbp HAT_KAT11
ARID2 p.r623c KMT2D p.v650fs p.p976l p.r2922w p.l1212r p.d1400h DNA binding RFX DNA binding Zinc finger KMT2C p.a51s p.d372v p.c1103* p.d2847fs p.t2671 p.d2847fs p.r4586h PHD/ RING DHHC/ PHD PHD FYR N
More informationAndrogen deprivation induced NCoA2 promotes metastatic and castration-resistant prostate cancer
The Journal of Clinical Investigation Research article Androgen deprivation induced NCoA2 promotes metastatic and castration-resistant prostate cancer Jun Qin, 1,2 Hui-Ju Lee, 2 San-Pin Wu, 2,3 Shih-Chieh
More information(A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939 (5 µm)
Supplementary Figure Legends Figure S1. Tankyrase inhibition suppresses cell proliferation in an axin/β-catenin independent manner. (A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939
More informationCHAPTER VII CONCLUDING REMARKS AND FUTURE DIRECTION. Androgen deprivation therapy is the most used treatment of de novo or recurrent
CHAPTER VII CONCLUDING REMARKS AND FUTURE DIRECTION Stathmin in Prostate Cancer Development and Progression Androgen deprivation therapy is the most used treatment of de novo or recurrent metastatic PCa.
More informationLoss of RhoA promotes skin tumor formation. Supplementary Figure 1. Loss of RhoA does not impair F-actin organization.
Supplementary Figure Legends Supplementary Figure 1. Loss of RhoA does not impair F-actin organization. a. Representative IF images of F-actin staining of big and small control (left) and RhoA ko tumors
More informationFigure S1. Figure S2. Figure S3.
Figure S1. PSA expression in VCaP was not dependent on the residual androgens in hormonedepleted medium. VCaP or LNCaP cells grown in CSS medium or SFM (serum-free medium) were treated with ethanol (-)
More informationSupplementary Figure 1. IHC and proliferation analysis of pten-deficient mammary tumors
Wang et al LEGENDS TO SUPPLEMENTARY INFORMATION Supplementary Figure 1. IHC and proliferation analysis of pten-deficient mammary tumors A. Induced expression of estrogen receptor α (ERα) in AME vs PDA
More informationSUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods
SUPPLEMENTARY INFORMATION SUMO1 modification of PTEN regulates tumorigenesis by controlling its association with the plasma membrane Jian Huang 1,2#, Jie Yan 1,2#, Jian Zhang 3#, Shiguo Zhu 1, Yanli Wang
More informationA dual PI3 kinase/mtor inhibitor reveals emergent efficacy in glioma
Supplemental data A dual PI3 kinase/mtor inhibitor reveals emergent efficacy in glioma Qi-Wen Fan, Zachary A. Knight, David D. Goldenberg, Wei Yu, Keith E. Mostov, David Stokoe, Kevan M. Shokat, and William
More informationp = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG
A.. Relative # of ECs associated with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 ol b p < 0.001 Relative # of blood vessels that formed with HCI-001 1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0 l b p = 0.002 Control IHC:
More information(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a
Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons
Supplementary Figure 1 ETBF activate Stat3 in B6 and Min mice colons a pstat3 controls Pos Neg ETBF 1 2 3 4 b pstat1 pstat2 pstat3 pstat4 pstat5 pstat6 Actin Figure Legend: (a) ETBF induce predominantly
More informationQuantification of early stage lesions for loss of p53 should be shown in the main figures.
Reviewer #1 (Remarks to the Author): Expert in prostate cancer The manuscript "Clonal dynamics following p53 loss of heterozygosity in Kras-driven cancers" uses a number of novel genetically engineered
More informationPrimary Cilia Can Both Mediate and Suppress Hedgehog Pathway- Dependent Tumorigenesis (Supplementary Figures and Materials)
Primary Cilia Can Both Mediate and Suppress Hedgehog Pathway- Dependent Tumorigenesis (Supplementary Figures and Materials) Sunny Y. Wong, Allen D. Seol, Po-Lin So, Alexandre N. Ermilov, Christopher K.
More informationTITLE: Phosphoinositide-Driven Epithelial Proliferation in Prostatic Inflammation. CONTRACTING ORGANIZATION: University of Wisconsin Madison, WI 53792
AD Award Number: W81XWH-07-1-0092 TITLE: Phosphoinositide-Driven Epithelial Proliferation in Prostatic Inflammation PRINCIPAL INVESTIGATOR: Travis J. Jerde, Ph.D. CONTRACTING ORGANIZATION: University of
More informationPREPARED FOR: U.S. Army Medical Research and Materiel Command Fort Detrick, Maryland
AD Award Number: W81XWH-4-1-82 TITLE: Effect of Saw Palmetto on the Development and Progression of Prostate Carcinoma in TRAMP Mice PRINCIPAL INVESTIGATOR: Charles E. Roselli CONTRACTING ORGANIZATION:
More information10/15/2012. Biologic Subtypes of TNBC. Topics. Topics. Histopathology Molecular pathology Clinical relevance
Biologic Subtypes of TNBC Andrea L. Richardson M.D. Ph.D. Brigham and Women s Hospital Dana-Farber Cancer Institute Harvard Medical School Boston, MA Topics Histopathology Molecular pathology Clinical
More informationSupplementary Information
Supplementary Information Title Degeneration and impaired regeneration of gray matter oligodendrocytes in amyotrophic lateral sclerosis Authors Shin H. Kang, Ying Li, Masahiro Fukaya, Ileana Lorenzini,
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Fig. 1: Quality assessment of formalin-fixed paraffin-embedded (FFPE)-derived DNA and nuclei. (a) Multiplex PCR analysis of unrepaired and repaired bulk FFPE gdna from
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Krenn et al., http://www.jcb.org/cgi/content/full/jcb.201110013/dc1 Figure S1. Levels of expressed proteins and demonstration that C-terminal
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationSupplementary Figure 1. Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Nature Immunology: doi: /ni.
Supplementary Figure 1 Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Expression of Mll4 floxed alleles (16-19) in naive CD4 + T cells isolated from lymph nodes and
More informationSupplementary Figure 1
A B D Relative TAp73 mrna p73 Supplementary Figure 1 25 2 15 1 5 p63 _-tub. MDA-468 HCC1143 HCC38 SUM149 MDA-468 HCC1143 HCC38 SUM149 HCC-1937 MDA-MB-468 ΔNp63_ TAp73_ TAp73β E C Relative ΔNp63 mrna TAp73
More informationDEVELOPMENT RESEARCH ARTICLE
RESEARCH ARTICLE 723 Development 134, 723-734 (2007) doi:10.1242/dev.02765 Fibroblast growth factor receptor 2 tyrosine kinase is required for prostatic morphogenesis and the acquisition of strict androgen
More informationLack of cadherins Celsr2 and Celsr3 impairs ependymal ciliogenesis, leading to fatal
Lack of cadherins Celsr2 and Celsr3 impairs ependymal ciliogenesis, leading to fatal hydrocephalus Fadel TISSIR, Yibo QU, Mireille MONTCOUQUIOL, Libing ZHOU, Kouji KOMATSU, Dongbo SHI, Toshihiko FUJIMORI,
More information(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,
Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.
More informationTITLE: Neuregulin Driven Cell Differentiation, Transformation, and Parity of Luminal Breast Cancer
AD Award Number: W81XWH-13-1-0019 TITLE: Neuregulin Driven Cell Differentiation, Transformation, and Parity of Luminal Breast Cancer PRINCIPAL INVESTIGATOR: David B. Vaught, Ph.D. CONTRACTING ORGANIZATION:
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/9/430/ra57/dc1 Supplementary Materials for The 4E-BP eif4e axis promotes rapamycinsensitive growth and proliferation in lymphocytes Lomon So, Jongdae Lee, Miguel
More informationBRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information)
BRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information) David Dankort, David P. Curley, Robert A. Cartlidge, Betsy Nelson, Anthony N. Karnezis,
More informationSupplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
More informationGallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity
Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae
More informationSupplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/375/ra41/dc1 Supplementary Materials for Actin cytoskeletal remodeling with protrusion formation is essential for heart regeneration in Hippo-deficient mice
More informationExpression of acid base transporters in the kidney collecting duct in Slc2a7 -/-
Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.
More informationw ª wy xvwz A ª vw xvw P ª w} xvw w Æ w Æ V w,x Æ w Æ w Æ y,z Æ { Æ y,z, w w w~ w wy}æ zy Æ wyw{ xæ wz w xywæ xx Æ wv Æ } w x w x w Æ w Æ wy} zy Æ wz
w ª wy xvwz A ª vw xvw P ª w} xvw w Æ w Æ V w,x Æ w Æ w Æ y,z Æ { Æ y,z, w w w~ w wy}æ zy Æ wyw{ xæ wz w xywæ xx Æ wv Æ } w x w x w Æ w Æ wy} zy Æ wz {w Æ Æ wyw{ x w Germ-line mutations in BRCA1 are associated
More informationSUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
More informationSupplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationSupporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
More informationTEB. Id4 p63 DAPI Merge. Id4 CK8 DAPI Merge
a Duct TEB b Id4 p63 DAPI Merge Id4 CK8 DAPI Merge c d e Supplementary Figure 1. Identification of Id4-positive MECs and characterization of the Comma-D model. (a) IHC analysis of ID4 expression in the
More informationWenqi Pan. A dissertation submitted to the faculty of the University of North Carolina at
MODULATION OF P53 SIGNALING IN an APT 121 INDUCED PROSTATE CANCER MODEL Wenqi Pan A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the
More informationSupplementary Figure 1:
Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas
More informationDeletion of tyrosine phosphatase Shp2 in Sertoli cells causes infertility. in mice
Deletion of tyrosine phosphatase Shp2 in Sertoli cells causes infertility in mice Xiaopeng Hu 1 *, Zhenzhou Tang 1,2 *, Yang Li 2 *, Wensheng Liu 2, Shuang Zhang 3, Bingyan Wang 3, Yingpu Tian 2, Yinan
More informationSPOP Mutation Drives Prostate Tumorigenesis In Vivo through Coordinate Regulation of PI3K/mTOR and AR Signaling
Article SPOP Mutation Drives Prostate Tumorigenesis In Vivo through Coordinate Regulation of PI3K/mTOR and AR Signaling Graphical Abstract Authors Mirjam Blattner, Deli Liu, Brian D. Robinson,..., Yu Chen,
More informationTargeting the stromal androgen receptor in primary prostate tumors at earlier stages
Targeting the stromal androgen receptor in primary prostate tumors at earlier stages Yuanjie Niu*, Saleh Altuwaijri*, Shuyuan Yeh*, Kuo-Pao Lai*, Shengqiang Yu*, Kuang-Hsiang Chuang*, Shu-Pin Huang*, Henry
More informationRole of epithelial cell fibroblast growth factor receptor substrate 2 in prostate development, regeneration and tumorigenesis
AND DISEASE 775 Development 135, 775-784 (2008) doi:10.1242/dev.009910 Role of epithelial cell fibroblast growth factor receptor substrate 2 in prostate development, regeneration and tumorigenesis Yongyou
More informationNature Medicine: doi: /nm.4322
1 2 3 4 5 6 7 8 9 10 11 Supplementary Figure 1. Predicted RNA structure of 3 UTR and sequence alignment of deleted nucleotides. (a) Predicted RNA secondary structure of ZIKV 3 UTR. The stem-loop structure
More informationSupplementary Figure 1.
Supplementary Figure 1. Increased β cell mass and islet diameter in βtsc2 -/- mice up to 35 weeks A: Reconstruction of multiple anti-insulin immunofluorescence images showing differences in β cell mass
More informationSupplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated,
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1: Neuregulin 1 increases the growth of mammary organoids compared to EGF. (a) Mammary epithelial cells were freshly isolated, embedded in matrigel and exposed
More informationNature Immunology: doi: /ni eee Supplementary Figure 1
eee Supplementary Figure 1 Hyphae induce NET release, but yeast do not. (a) NET release by human peripheral neutrophils stimulated with a hgc1 yeast-locked C. albicans mutant (yeast) or pre-formed WT C.
More informationTumor suppressor genes D R. S H O S S E I N I - A S L
Tumor suppressor genes 1 D R. S H O S S E I N I - A S L What is a Tumor Suppressor Gene? 2 A tumor suppressor gene is a type of cancer gene that is created by loss-of function mutations. In contrast to
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationSupplementary Figure S1. Generation of LSL-EZH2 conditional transgenic mice.
Downstream Col1A locus S P P P EP Genotyping with P1, P2 frt PGKneopA + frt hygro-pa Targeting vector Genotyping with P3, P4 P1 pcag-flpe P2 P3 P4 frt SApA CAG LSL PGKATG frt hygro-pa C. D. E. ormal KRAS
More informationAdult Murine Prostate Basal and Luminal Cells Are Self-Sustained Lineages that Can Both Serve as Targets for Prostate Cancer Initiation
Article Adult Murine Prostate Basal and Luminal Cells Are Self-Sustained Lineages that Can Both Serve as Targets for Prostate Cancer Initiation Nahyun Choi, 1,4 Boyu Zhang, 1,4 Li Zhang, 1 Michael Ittmann,
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationSupplementary Figure 1. IDH1 and IDH2 mutation site sequences on WHO grade III
Supplementary Materials: Supplementary Figure 1. IDH1 and IDH2 mutation site sequences on WHO grade III patient samples. Genomic DNA samples extracted from punch biopsies from either FFPE or frozen tumor
More informationSupplemental Figure 1: Leydig cells are reduced at multiple stages in both male sterile mutants
SUPPLEMENTAL FIGURE LEGENDS: Supplemental Figure 1: Leydig cells are reduced at multiple stages in both male sterile mutants (Sgpl1 -/- and Plekha1 -/- ). Using an antibody against CYP11a1 to label Leydig
More informationGenesis of cerebellar interneurons and the prevention of neural DNA damage require XRCC1.
Genesis of cerebellar interneurons and the prevention of neural DNA damage require XRCC1. Youngsoo Lee, Sachin Katyal, Yang Li, Sherif F. El-Khamisy, Helen R. Russell, Keith W. Caldecott and Peter J. McKinnon.
More informationFigure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from
Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from germ cell mutants (dnrar flox/flox, Stra8-Cre +, RARElacZ) (A ), controls (dnrar flox/flox, RARElacZ) (B ),
More informationSupplementary Figure 1: Comparison of acgh-based and expression-based CNA analysis of tumors from breast cancer GEMMs.
Supplementary Figure 1: Comparison of acgh-based and expression-based CNA analysis of tumors from breast cancer GEMMs. (a) CNA analysis of expression microarray data obtained from 15 tumors in the SV40Tag
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1. The expression of ephrin-b2 H2BGFP persists in the post-hearingonset organ of Corti and is specifically restricted to supporting cells. Sox2 immunolabeling
More information