Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538

Size: px
Start display at page:

Download "Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538"

Transcription

1 Data Sheet TIGIT / NFAT Reporter - Jurkat Cell Line Catalog #60538 Background: TIGIT is a co-inhibitory receptor that is highly expressed in Natural Killer (NK) cells, activated CD4+, CD8+ and regulatory T cells. Interaction with the poliovirus receptor (PVR; CD155) on antigen presenting cells, such as dendritic cells, recruits Src homology (SH) domain-containing protein tyrosine phosphatase SHP1 and SHP2 or the inositol phosphatase SHIP1 and SHIP2 to the TIGIT ITIM domain. This increases IL-10 release and suppresses NFkB and NFAT T cell receptor (TCR) signaling, which blocks T cell proliferation and cytokine production. It serves as a competitive inhibitor of CD226, a co-stimulatory receptor for CD155. TIGIT targeting antibodies that block this T cell-intrinsic inhibitory effects have shown enhanced anti-tumor and anti-viral functions in preclinical studies. Description: Recombinant Jurkat cell line constitutively expressing a full length human TIGIT (T cell Immunoreceptor with Immunoglobulin and ITIM domain; VSTM3), and a firefly luciferase gene under the control of nuclear factor of activator T cells (NFAT) response element. Both TIGIT and NFAT constructs have been stably integrated into Jurkat cells. TIGIT expression has been confirmed by Western Blot, and TIGIT-specific NFAT response has been validated using a TIGIT ligand, CD155 (PVR). Application: This cell line is ideal for high throughput screening (HTS) to identify antagonistic monoclonal antibodies targeting either TIGIT or its ligands, such as CD155 in a cellular context. It is also ideal for characterizing TIGIT mediated biological activity and immunological response in T cells upon its interactions with its ligands. Host Cell Human T lymphocyte cell line. Suspension cells. Format Each vial contains ~2 x 10 6 cells in 1mL of 10% DMSO in FBS. Storage Store in liquid nitrogen immediately upon receipt. Culture Medium RPMI (Thermo Fisher Cat. # ), 10% heat-inactivated FBS (Thermo Fisher Cat. # ), 1x Penicillin/Streptomycin (Thermo Fisher, Cat. # ), 100 µg/ml Hygromycin B (Thermo Fisher, Cat. # ) and 1mg/ml Geneticin, G418 Sulfate (Thermo Fisher, Cat. # ).

2 Culture conditions Frozen Cells: Prepare T-75 culture flask with 20 ml of pre-warmed growth medium. Quickly thaw cells in a 37 C water bath with constant and slow agitation. Clean the outside of the vial with 70% ethanol and immediately transfer the entire contents to the culture media without Hygromycin B and G418. Avoid pipetting up and down, and gently rock the flask to distribute the cells. Incubate the cells in a humidified 37 C incubator with 5% CO hours after incubation, centrifuge cells at 250 x g for 5 minutes and re-suspend to fresh medium without Hygromycin B and G418. Continue to monitor growth for 2-3 days and change medium to remove dead debris. If slow cell growth occurs during resuscitation, increase FBS to 15% for the first week of culture. Begin adding Hygromycin B and G418 to medium after multiple cell colonies (in clumps) start to appear (indicative of healthy cell division). Subculture: When cells reached 90% confluency, transfer cells to a 50 ml conical tube and centrifuge cells at 200 x g for 5 minutes. Wash cells once with PBS (without Magnesium or Calcium) and re-suspend cells in 10 ml pre-warmed medium; gently pipette up and down to dissociate cell clumps. Dispense 2 ml of the cell suspension into a new T-75 flask containing pre-warmed 20 ml medium. Incubate cells in a humidified 37 C incubator with 5% CO 2. Freeze cells in freezing medium (10% DMSO in FBS) when cells reach 90% confluency. Cells have been demonstrated to be stable for at least 15 passages; BPS recommends preparing frozen stocks so cells are not used beyond passage 20. Mycoplasma Testing This cell line has been screened using the MycoAlert Mycoplasma Detection Kit (Lonza, Cat. #LT07-118) to confirm the absence of Mycoplasma contamination. MycoAlert Assay Control Set (Lonza, Cat. #LT07-518) was used as a positive control. Application References 1. Li M et.al (2014) T-cell Immunoglobulin and ITIM Domain (TIGIT) Receptor/ Poliovirus Receptor (PVR) Ligand Engagement Suppresses Interferon-g Production of Natural Killer Cells via b-arrestin 2-mediated Negative Signaling. J Biol Chem. 289: Stanietsky N. et.al. (2009) The interaction of TIGIT with PVR and PVRL2 inhibits human NK cell cytotoxicity. PNAS. 106: Zhu et.al. (2016) Identification of CD112R as a novel checkpoint for human T cells. J Exp. Med. 213: Yu X. et.al. (2008) The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. Nat.Immunol. 10:

3 Quality Assurance and Functional Analysis Figure 1. Human TIGIT Expression in TIGIT/NFAT-Luciferase cells. Cells were seeded at semi-confluency in 24 well plates overnight and were lysed by RIPA lysis buffer containing protease inhibitors. Human TIGIT protein level was assessed by Western blot using a TIGIT antibody ( ) (Sigma Aldrich, Cat. #SAB ). β-actin (8H10D10) (Cell Signaling Technology, Cat. #3700) was used as a loading control. Figure 2. NFAT Signaling in TIGIT overexpressed reporter Jurkat cells is suppressed by CD155/HEK293 cells. CD155 (PVR) HEK293 Stable Cell Line (BPS Cat. #60537) or naïve HEK293 cells were seeded overnight at ~ 4x10 4 cells/well, and TIGIT-expressing NFATluciferase (TIGIT NFAT; TIGIT+ ) or NFAT-luciferase (NFAT; TIGIT- ) Jurkat T cells were seeded overnight at ~ 2x10 4 cells/well at 100 µl in a white 96 well plate. The next day, NFAT Jurkat T cells were activated with Human T-activator CD3/CD28 Dynabeads (Thermo Fisher,

4 Cat. #111.61D) at ~ 4:1 bead-to-cell ratio and were subsequently incubated with CD155/HEK293 or HEK293 for 24 hours before the addition of ONE-Step Luciferase Assay substrates (BPS, Cat. #60690) for luminescence detection. The % NFAT-Luciferase activity represents relative luminescence units released by TIGIT or NFAT T cells incubated with CD155/HEK293 vs. HEK293. Error bar = S.E.M. n=3, ***P<0.001, Student s two-tailed unpaired t-test. Figure 3. NFAT signal in TIGIT overexpressed Jurkat cells is inhibited by soluble recombinant human CD155 protein. Cells were seeded in 96 well at 2x10 4 cells per well at 100 µl overnight in a white 96 well plate. The next day, TIGIT expressing NFAT Jurkat cells (TIGIT NFAT) and NFAT Jurkat cells (NFAT) were activated with Human T-activator CD3/CD28 Dynabeads (Thermo Fisher, Cat. #111.61D) at ~ 4:1 bead-to-cell ratio, and subsequently treated with various concentrations of CD155 (BPS Cat. #71181) for 24 hours. IC 50 = µg/ml. (Left). Activated TIGIT NFAT (TIGIT+) or NFAT (TIGIT-) Jurkat cells were treated with soluble recombinant human CD155 (BPS Cat. #71181) at 100 µg/ml for 24 hours (Right) before the addition of ONE-Step Luciferase Assay substrates (BPS, Cat. #60690) for luminescence detection. The % NFAT-Luciferase activity represents relative luminescence units released by TIGIT or NFAT T cells incubated with CD155/HEK293 vs. HEK293. Error bar = S.E.M. n = 3, ***P < 0.001, ns = not significant. Student s two-tailed unpaired t-test.

5 Figure 4. A CD155 human monoclonal antibody blocks TIGIT-CD155 mediated NFAT signal inhibition. CD155/HEK293 (BPS Cat. #60537) cells were seeded in 96 well at 4x10 5 cells per well at 100 µl, and TIGIT/NFAT cells were seeded at 2x10 5 cells per well overnight in a white 96 well plate. The next day, TIGIT/NFAT were activated with Human T-activator CD3/CD28 Dynabeads (Thermo Fisher, Cat. #111.61D) at ~ 2:1 bead-to-cell ratio. TIGIT/NFAT cells were added to each well containing HEK293 cells. Human anti-cd155 monoclonal antibody (TX21, MBL International, Cat. #D174-3) were added (at 50 µg/ml) to co-cultures and incubated for 20 hours before the addition of ONE-Step Luciferase Assay substrates (BPS, Cat. #60690) for luminescence detection. Relative Luminescence Units (RLUs) released by activated TIGIT/NFAT cells were normalized to cells without CD3 activation. Error bar = S.E.M. n = 5. ****P<0.0001, *** P< One-way ANOVA, Tukey s multiple comparison test. Vector and sequence NFAT-Luciferase was cloned into the MCS of pcdna3.1 (+) vector (Invitrogen, Cat. #V79020). Human TIGIT (NP_ ; Accession BC026692) was cloned into the MCS of pireshyg3 vector (Clontech, Cat. # ). MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQD QLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE SSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSA PSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG

6 Related Products Product Cat. # Size CD155 (PVR) HEK293 Stable Cell Line vials ONE-Step TM Luciferase Assay System ml ONE-Step TM Luciferase Assay System ml Human CD155 (PVR) His-tag Protein μg Mouse CD155 (PVR) His-tag Protein μg Mouse CD155, His-tag, Biotin-labeled μg Human CD226, Fc fusion μg Human CD226, Fc fusion, Biotin-labeled μg Human CD112, Fc fusion μg Human CD112, Fc fusion, Biotin-labeled μg Human TIGIT, Fc fusion μg Human TIGIT, Fc fusion, Biotin-labeled μg TIGIT:CD155 Homogenous Assay Kit reactions CD226: CD155 Homogenous Assay Kit reactions TIGIT:CD112 Homogenous Assay Kit reactions CD226: CD112 Homogenous Assay Kit reactions NFAT Reporter (Luc) Jurkat Cell Line vials PD-1 / NFAT Reporter Jurkat Cell Line vials TCR Activator / PD-L1 Cho Recombinant Cell Line vials

Data Sheet IL-2-Luciferase Reporter (Luc) - Jurkat Cell Line Catalog # 60481

Data Sheet IL-2-Luciferase Reporter (Luc) - Jurkat Cell Line Catalog # 60481 642 Cornerstone Court W, Ste B Tel: 1.858.829.382 Data Sheet IL-2-Luciferase Reporter (Luc) - Jurkat Cell Line Catalog # 6481 Description Human IL-2 reporter construct is stably integrated into the genome

More information

Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535

Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535 Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535 Product Description Recombinant Jurkat T cell expressing firefly luciferase gene under the control of NFAT response elements with constitutive

More information

Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535

Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535 Data Sheet PD-1 / NFAT Reporter - Jurkat Cell Line Catalog #: 60535 Product Description Recombinant Jurkat T cell expressing firefly luciferase gene under the control of NFAT response elements with constitutive

More information

Data Sheet. NFAT Reporter (Luc) Jurkat Cell line Catalog #: 60621

Data Sheet. NFAT Reporter (Luc) Jurkat Cell line Catalog #: 60621 Data Sheet NFAT Reporter (Luc) Jurkat Cell line Catalog #: 60621 Background The nuclear factor of activator T cells (NFAT) family of transcription factors plays an important role in immune response. T

More information

Notch Signaling Pathway Notch CSL Reporter HEK293 Cell line Catalog #: 60652

Notch Signaling Pathway Notch CSL Reporter HEK293 Cell line Catalog #: 60652 Notch Signaling Pathway Notch CSL Reporter HEK293 Cell line Catalog #: 60652 Background The Notch signaling pathway controls cell fate decisions in vertebrate and invertebrate tissues. Notch signaling

More information

nachr α 4 β 2 CHO Cell Line

nachr α 4 β 2 CHO Cell Line B SYS GmbH nachr α 4 β 2 CHO Cell Line Cell Culture Conditions B SYS GmbH B SYS GmbH nachr α 4 β 2 CHO Page 2 TABLE OF CONTENTS 1 BACKGROUND...3 1.1 Human Nicotinic Acetylcholine Receptors...3 1.2 B SYS

More information

CHO α 1 β 2 γ 2 GABAA Cell Line

CHO α 1 β 2 γ 2 GABAA Cell Line B SYS GmbH CHO α 1 β 2 γ 2 GABAA Cell Line Specification Sheet B SYS GmbH B SYS GmbH CHO α 1 β 2 γ 2 Cells Page 2 TABLE OF CONTENTS 1 BACKGROUND...3 1.1 THE PHARMACOLOGICAL DISTINCTION OF GABA A RECEPTOR

More information

Human ipsc-derived Ventricular Cardiomyocytes. Protocol version 3.1

Human ipsc-derived Ventricular Cardiomyocytes. Protocol version 3.1 Human ipsc-derived Ventricular Cardiomyocytes Protocol version 3.1 Protocol version 3.1 Table of Contents Product Information 2 Recommendations 2 Preparing Cardiomyocyte Maintenance Medium 3 Cardiomyocyte

More information

Nuclear Extraction Kit

Nuclear Extraction Kit Nuclear Extraction Kit Catalog Number KA1346 50 assays Version: 07 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Principle of the Assay... 3 General Information... 4

More information

For research or further manufacturing use only. Not for injection or diagnostic procedures.

For research or further manufacturing use only. Not for injection or diagnostic procedures. PRIME-XV T cell Expansion XSFM PRIME-XV T Cell Expansion XSFM is a xeno-free, serum-free medium optimized for the activation and expansion of human T lymphocytes. This medium contains gentamicin and requires

More information

Product Use HPSC-CC are for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures.

Product Use HPSC-CC are for research use only. It is not approved for human or animal use, or for application in in vitro diagnostic procedures. HPSC-derived Cardiomyocyte Cells (HPSC-CC) Catalog #6240 Cell Specification Human primary cardiomyocytes and cardiac tissue are superior modeling systems for heart disease studies, drug discovery and toxicity

More information

Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set

Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Catalog Number : SEK11695 To achieve the best assay results, this manual must be read carefully before using this product

More information

Lumino Firefly Luciferase Assay

Lumino Firefly Luciferase Assay G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Lumino Firefly Luciferase Assay (Cat. # 786 1267, 786 1268) think proteins! think G-Biosciences

More information

NINDS Repository Human Induced Pluripotent Stem Cell (ipsc) Handling Protocols (Matrigel and mtesr Media)

NINDS Repository Human Induced Pluripotent Stem Cell (ipsc) Handling Protocols (Matrigel and mtesr Media) General Guidelines for Handling Human ipsc cells ipsc are cryopreserved in plastic cryovials and shipped on dry ice. If storing the ipsc before thawing, store in liquid nitrogen vapor. Storage directly

More information

Data Sheet. Notch Pathway Reporter Kit Catalog # 60509

Data Sheet. Notch Pathway Reporter Kit Catalog # 60509 Data Sheet Notch Pathway Reporter Kit Catalog # 60509 6042 Cornerstone Court W, Ste B Background The Notch signaling pathway controls cell fate decisions in vertebrate and invertebrate tissues. NOTCH signaling

More information

Nuclear Extraction Kit

Nuclear Extraction Kit Nuclear Extraction Kit Item No. 10009277 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL INFORMATION 3 Materials

More information

Human CD4+T Cell Care Manual

Human CD4+T Cell Care Manual Human CD4+T Cell Care Manual INSTRUCTION MANUAL ZBM0067.04 SHIPPING CONDITIONS Human CD4+T Cells, cryopreserved Cryopreserved human CD4+T cells are shipped on dry ice and should be stored in liquid nitrogen

More information

Human Induced Plutipotent Stem Cell (ipsc) Handling Protocols: Matrigel and mtesr/e8 Media

Human Induced Plutipotent Stem Cell (ipsc) Handling Protocols: Matrigel and mtesr/e8 Media General Guidelines for Handling Human ipsc cells ipsc are cryopreserved in plastic cryovials and shipped on dry ice. If storing the ipsc before thawing, store in liquid nitrogen vapor. Storage directly

More information

Striatal Neuron Medium Kit

Striatal Neuron Medium Kit Striatal Neuron Medium Kit Product Information What are included in the Striatal Neuron Medium Kit (ax0333): 2x 250 ml Striatal Neuron Basal Medium (Store at 4 o C upon receipt) 2x 7.5 ml Striatal Neuron

More information

HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual)

HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) BACKGROUND Human Immunodeficiency Virus ( HIV ) can be divided into two major types, HIV type 1 (HIV-1) and HIV type 2 (HIV-2). HIV-1 is related to

More information

Influenza B Hemagglutinin / HA ELISA Pair Set

Influenza B Hemagglutinin / HA ELISA Pair Set Influenza B Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK11053 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

Human Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Introduction Kit Components Cat. # # of vials Reagent Quantity Storage

Human Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Introduction Kit Components Cat. # # of vials Reagent Quantity Storage Human Pluripotent Stem Cell Cardiomyocyte Differentiation Kit (PSCCDK) Catalog #5901 Introduction Human pluripotent stem cells (hpsc), including embryonic stem cells (ESC) and induced pluripotent stem

More information

Mitochondrial DNA Isolation Kit

Mitochondrial DNA Isolation Kit Mitochondrial DNA Isolation Kit Catalog Number KA0895 50 assays Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

Data Sheet. CD28:B7-2[Biotinylated] Inhibitor Screening Assay Kit Catalog # Size: 96 reactions

Data Sheet. CD28:B7-2[Biotinylated] Inhibitor Screening Assay Kit Catalog # Size: 96 reactions Data Sheet CD28:B7-2[Biotinylated] Inhibitor Screening Assay Kit Catalog # 72062 Size: 96 reactions BACKGROUND: The activation of naïve T cells requires two signals; the specific T cell receptor recognition

More information

Cell Lysis Buffer. Catalog number: AR0103

Cell Lysis Buffer. Catalog number: AR0103 Cell Lysis Buffer Catalog number: AR0103 Boster s Cell Lysis Buffer is a ready-to-use Western blot related reagent solution used for efficient extraction of total soluble protein in nondenatured state

More information

Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit User Manual (v5)

Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit User Manual (v5) Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit Catalog number: SM-005 Description Minute TM plasma membrane (PM) protein isolation kit is a novel and patented native PM protein

More information

Mammalian Cell PE LB

Mammalian Cell PE LB 257PR G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Mammalian Cell PE LB Mammalian Cell Protein Extraction & Lysis Buffer (Cat. # 786 180)

More information

SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric*

SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric* SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric* Catalog # 72171 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit is optimized to detect Cathepsin K activity. Enhanced Value: Ample

More information

Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set

Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Catalog Number : SEK11233 To achieve the best assay results, this manual must be read carefully before using this product

More information

Human Keratinocyte Manual

Human Keratinocyte Manual INSTRUCTION MANUAL SHIPPING CONDITIONS Human Keratinocyte Cells Human Keratinocyte Manual ZBM0032.09 Orders are delivered via Federal Express courier. All US and Canada orders are shipped via Federal Express

More information

TECHNICAL BULLETIN. Catalog Number RAB0447 Storage Temperature 20 C

TECHNICAL BULLETIN. Catalog Number RAB0447 Storage Temperature 20 C Phospho-Stat3 (ptyr 705 ) and pan-stat3 ELISA Kit for detection of human, mouse, or rat phospho-stat3 (ptyr 705 ) and pan-stat3 in cell and tissue lysates Catalog Number RAB0447 Storage Temperature 20

More information

Protocol for Thawing Cryopreserved Hepatocytes

Protocol for Thawing Cryopreserved Hepatocytes cell and tissue-based products Protocol for Thawing Cryopreserved Hepatocytes Product Instruction The following procedure may be carried out in a biosafety containment hood to reduce the risk of contamination

More information

Human Umbilical Vein Endothelial Cell Manual

Human Umbilical Vein Endothelial Cell Manual Human Umbilical Vein Endothelial Cell Manual INSTRUCTION MANUAL ZBM0079.03 SHIPPING CONDITIONS Human Umbilical Vein Endothelial Cells, cryopreserved Cryopreserved cells are shipped on dry ice and should

More information

Luciferase (Firefly and Renilla) Expression Stable Cell Lines

Luciferase (Firefly and Renilla) Expression Stable Cell Lines Luciferase (Firefly and Renilla) Expression Stable Cell Lines Catalog # Product Amount HEK293 Host cell line SC002-Bsd SC002-Puro SC002-Neo SC002-GB SC002-GP SC002-RB SC002-RP SC020-Puro SC020-RP SC021-Puro

More information

Midi Plant Genomic DNA Purification Kit

Midi Plant Genomic DNA Purification Kit Midi Plant Genomic DNA Purification Kit Cat #:DP022MD/ DP022MD-50 Size:10/50 reactions Store at RT For research use only 1 Description: The Midi Plant Genomic DNA Purification Kit provides a rapid, simple

More information

To place an order, please visit lifelinecelltech.com or call customer service at

To place an order, please visit lifelinecelltech.com or call customer service at Human Melanocyte Cells Instruction Manual HEMn Human Epidermal Melanocytes, Neonatal HEMn-HP Human Epidermal Melanocytes, Neonatal-Highly Pigmented HEMa Human Epidermal Melanocytes, Adult HEMa-HP Human

More information

Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set

Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK40103 To achieve the best assay results, this manual must be read carefully before using this product and the assay

More information

EPIGENTEK. EpiQuik Global Histone H4 Acetylation Assay Kit. Base Catalog # P-4009 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Global Histone H4 Acetylation Assay Kit. Base Catalog # P-4009 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Global Histone H4 Acetylation Assay Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Global Histone H4 Acetylation Assay Kit is suitable for specifically measuring global

More information

Human TRPC6 Ion Channel Cell Line

Human TRPC6 Ion Channel Cell Line TECHNICAL DATA SHEET ValiScreen Ion Channel Cell Line Caution: For Laboratory Use. A research product for research purposes only Human TRPC6 Ion Channel Cell Line Product No.: AX-012-C Lot No.: 512-548-A

More information

Osteoclast Culture Kit

Osteoclast Culture Kit K-ASSAY KAMIYA BIOMEDICAL COMPANY Osteoclast Culture Kit For the culture of Osteoclasts from precursor cells. Cat. No.: CC-107 Rat Osteoclast Precursor Cells, V-1 CC-109 Mouse Osteoclast Precursor Cells,

More information

Human Apolipoprotein A1 EIA Kit

Human Apolipoprotein A1 EIA Kit A helping hand for your research Product Manual Human Apolipoprotein A1 EIA Kit Catalog Number: 83901 96 assays 1 Table of Content Product Description 3 Assay Principle 3 Kit Components 3 Storage 4 Reagent

More information

RODENT Hepatocytes Care Manual

RODENT Hepatocytes Care Manual RODENT Hepatocytes Care Manual INSTRUCTION MANUAL ZBM0054.02 SHIPPING CONDITIONS Rodent Hepatocytes cryopreserved Orders are delivered via Federal Express courier. All US and Canada orders are shipped

More information

FOCUS SubCell. For the Enrichment of Subcellular Fractions. (Cat. # ) think proteins! think G-Biosciences

FOCUS SubCell. For the Enrichment of Subcellular Fractions. (Cat. # ) think proteins! think G-Biosciences 169PR 01 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name FOCUS SubCell For the Enrichment of Subcellular Fractions (Cat. # 786 260) think

More information

Intracellular (Total) ROS Activity Assay Kit (Red)

Intracellular (Total) ROS Activity Assay Kit (Red) Intracellular (Total) ROS Activity Assay Kit (Red) Catalog Number KA2525 200 assays Version: 04 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General

More information

FOXO Reporter Kit PI3K/AKT Pathway Cat. #60643

FOXO Reporter Kit PI3K/AKT Pathway Cat. #60643 Data Sheet FOXO Reporter Kit PI3K/AKT Pathway Cat. #60643 Background The PI3K/AKT signaling pathway is essential for cell growth and survival. Disruption of this pathway or its regulation has been linked

More information

Alpha-Tubulin Housekeeping 10,000 tests

Alpha-Tubulin Housekeeping 10,000 tests Headquarters & Europe Office Cisbio Bioassays Phone: +33 (0)4 66 79 67 05 Fax: +33 (0)4 66 79 19 20 bioassays@cisbio.com cisbio_dd_pi_64atubpeh USA Office Cisbio US, Inc. Phone: +1 888 963 4567 Fax: +1

More information

Human LDL Receptor / LDLR ELISA Pair Set

Human LDL Receptor / LDLR ELISA Pair Set Human LDL Receptor / LDLR ELISA Pair Set Catalog Number : SEK10231 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized in

More information

EPIGENTEK. EpiQuik Global Histone H3 Acetylation Assay Kit. Base Catalog # P-4008 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Global Histone H3 Acetylation Assay Kit. Base Catalog # P-4008 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Global Histone H3 Acetylation Assay Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Global Histone H3 Acetylation Assay Kit is suitable for specifically measuring global

More information

Influenza A H1N1 HA ELISA Pair Set

Influenza A H1N1 HA ELISA Pair Set Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the

More information

Mouse Hepatic Progenitor Organoid Culture: Supplementary Protocols

Mouse Hepatic Progenitor Organoid Culture: Supplementary Protocols TECHNICAL BULLETIN Mouse Hepatic Progenitor Organoid Culture: The following are supplementary protocols for the culture of hepatic organoids with HepatiCult Organoid Growth Medium (Mouse) (Catalog #06030).

More information

Constitutive Reporter Lentiviral Vectors Expressing Fluorescent Proteins

Constitutive Reporter Lentiviral Vectors Expressing Fluorescent Proteins Constitutive Reporter Lentiviral Vectors Expressing Fluorescent Proteins www.vectalys.com/products/ Constitutive Reporter Lentiviral Vectors Catalog Number referring to this User Manual: 0008VCT; 0009VCT;

More information

STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit

STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit Catalog Number KA2176 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Principle of the Assay...

More information

91154 PRIME-XV T Cell CDM Liquid 1 L Additional package sizes are available at request

91154 PRIME-XV T Cell CDM Liquid 1 L Additional package sizes are available at request PRIME-XV T CELL CDM PRIME-XV T Cell CDM is a ready-to-use chemically-defined, animal component-free medium. It is optimized and designed for the culture of T cells of human origin and recommended for use

More information

Global Histone H3 Acetylation Assay Kit

Global Histone H3 Acetylation Assay Kit Global Histone H3 Acetylation Assay Kit Catalog Number KA0633 96 assays Version: 06 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle

More information

PROTOCOL: OPTIMIZATION OF LENTIVIRAL TRANSDUCTION USING SPINFECTION

PROTOCOL: OPTIMIZATION OF LENTIVIRAL TRANSDUCTION USING SPINFECTION Last Modified: April 2018 Last Review: October 2018 PROTOCOL: OPTIMIZATION OF LENTIVIRAL TRANSDUCTION USING SPINFECTION Table of Contents 1. Brief Description 1 2. Materials and Reagents.1 3. Optimization

More information

Data Sheet. PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002

Data Sheet. PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002 Data Sheet PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002 DESCRIPTION: The PCSK9[Biotinylated]-LDLR Binding Assay Kit is designed for screening and profiling purposes. PCSK9 is known to function

More information

EPIGENTEK. EpiQuik HDAC2 Assay Kit (Colorimetric) Base Catalog # P-4006 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik HDAC2 Assay Kit (Colorimetric) Base Catalog # P-4006 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik HDAC2 Assay Kit (Colorimetric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik HDAC2 Assay Kit is very suitable for measuring HDAC2 levels from various fresh tissues and

More information

Controlling cell-based bioassay performance through controlled preparation of bioassayready

Controlling cell-based bioassay performance through controlled preparation of bioassayready Controlling cell-based bioassay performance through controlled preparation of bioassayready cells Teresa Surowy September 2013 Promega Corporation Introduction The importance of cell-based bioassays and

More information

SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # Kit Size

SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # Kit Size SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # 72152 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit detects Cathepsin K activity.

More information

Influenza A H1N1 (Swine Flu 2009) Hemagglutinin / HA ELISA Pair Set

Influenza A H1N1 (Swine Flu 2009) Hemagglutinin / HA ELISA Pair Set Influenza A H1N1 (Swine Flu 2009) Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK001 To achieve the best assay results, this manual must be read carefully before using this product and the assay

More information

EPIGENTEK. EpiQuik Total Histone Extraction Kit. Base Catalog # OP-0006 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Total Histone Extraction Kit. Base Catalog # OP-0006 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Total Histone Extraction Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE Uses: The EpiQuik Total Histone Extraction Kit is suitable for a quick preparation of total histone extracts

More information

TECHNICAL BULLETIN. Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates

TECHNICAL BULLETIN. Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates Catalog Number RAB0011 Storage Temperature 20 C TECHNICAL BULLETIN Product Description

More information

Cryopreserved HepaRG Cells and Media Supplements

Cryopreserved HepaRG Cells and Media Supplements Cryopreserved HepaRG Cells and Media Supplements Catalog No. MMHPR116 Catalog No. MMADD621 Catalog No. MMADD631 Catalog No. MMADD641 Catalog No. MMADD651 Catalog No. MMADD671 FOR RESEARCH USE ONLY Not

More information

Thawing MEFs (Mouse Embryonic Fibroblasts (MEFs)

Thawing MEFs (Mouse Embryonic Fibroblasts (MEFs) 1 FEEDER CULTURES The function of feeder cultures is to support the undifferentiated growth of hpsc. Typically primary fibroblasts are used for this purpose. We prepare our mouse feeder cells from ICR

More information

HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates

HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates HIV-1 Virus-like Particle Budding Assay Nathan H Vande Burgt, Luis J Cocka * and Paul Bates Department of Microbiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, USA

More information

Human Urokinase / PLAU / UPA ELISA Pair Set

Human Urokinase / PLAU / UPA ELISA Pair Set Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

Mammalian Membrane Protein Extraction Kit

Mammalian Membrane Protein Extraction Kit Mammalian Membrane Protein Extraction Kit Catalog number: AR0155 Boster s Mammalian Membrane Protein Extraction Kit is a simple, rapid and reproducible method to prepare cellular protein fractions highly

More information

ab Nuclear Extract Kit

ab Nuclear Extract Kit Version 1 Last updated 10 November 2017 ab221978 Nuclear Extract Kit For the preparation of nuclear extracts from mammalian and tissue. This product is for research use only and is not intended for diagnostic

More information

Human IL-2. Pre-Coated ELISA Kit

Human IL-2. Pre-Coated ELISA Kit Human IL-2 (Interleukin 2) Pre-Coated ELISA Kit Catalog No: 90-2083 1 96 well Format (96 tests) Detection Range: 31.2 2000 pg/ml Sensitivity: < 18.75 pg/ml This immunoassay kit allows for the in vitro

More information

Cathepsin K Activity Assay Kit

Cathepsin K Activity Assay Kit Cathepsin K Activity Assay Kit Catalog Number KA0769 100 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

GLUT4 Redistribution Assay

GLUT4 Redistribution Assay INSTRUCTIONS GLUT4 Redistribution Assay For High-Content Analysis Number R04-023-01 Description 023-01.04 Recombinant CHOhIR cells stably expressing human GLUT4 (GenBank Acc. NM_001042) fused to the N-terminus

More information

STAT3 (py705) (Human/Mouse/Rat) ELISA Kit

STAT3 (py705) (Human/Mouse/Rat) ELISA Kit STAT3 (py705) (Human/Mouse/Rat) ELISA Kit Catalog Number KA2175 96 assays Version: 01 Intended for research use only www.abnova.com I. INTRODUCTION STAT3 (py705) (Human/Mouse/Rat) ELISA (Enzyme-Linked

More information

IncuCyte NeuroPrime Cell Kit Catalog Number: 4585

IncuCyte NeuroPrime Cell Kit Catalog Number: 4585 IncuCyte NeuroPrime Cell Kit Catalog Number: 4585 IncuCyte Cell Kits Contents 1x vial IncuCyte NeuroPrime rforebrain Neurons* (2 x 106 cells/vial) 1x vial IncuCyte NeuroPrime rastrocytes* (2 x 106 cells/vial)

More information

E.Z.N.A. SQ Blood DNA Kit II. Table of Contents

E.Z.N.A. SQ Blood DNA Kit II. Table of Contents E.Z.N.A. SQ Blood DNA Kit II Table of Contents Introduction and Overview...2 Kit Contents/Storage and Stability...3 Blood Storage and DNA Yield...4 Preparing Reagents...5 100-500 μl Whole Blood Protocol...6

More information

Supplementary Figure 1. Method development.

Supplementary Figure 1. Method development. Supplementary Figure 1 Method development. Titration experiments to determine standard antibody:lysate concentration. Lysates (~2 mg of total proteins) were prepared from cells expressing FLAG- tagged

More information

ab Human Citrate Synthase (CS) Activity Assay Kit

ab Human Citrate Synthase (CS) Activity Assay Kit ab119692 Human Citrate Synthase (CS) Activity Assay Kit Instructions for Use For the measurement of mitochondrial citrate synthase (CS) activity in Human samples This product is for research use only and

More information

Data Sheet. PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002

Data Sheet. PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002 Data Sheet PCSK9[Biotinylated]-LDLR Binding Assay Kit Catalog # 72002 DESCRIPTION: The PCSK9[Biotinylated]-LDLR Binding Assay Kit is designed for screening and profiling purposes. PCSK9 is known to function

More information

ROS Activity Assay Kit

ROS Activity Assay Kit ROS Activity Assay Kit Catalog Number KA3841 200 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

Osteoclast Culture Kit

Osteoclast Culture Kit K-ASSAY Osteoclast Culture Kit For the culture of Osteoclasts from precursor cells. Cat. No.: CC-107 Rat Osteoclast Precursor Cells, V-1 For Research Use Only. 1 Rev. 091708 K-ASSAY PRODUCT INFORMATION

More information

Pluricyte Cardiomyocytes

Pluricyte Cardiomyocytes Pluricyte Cardiomyocytes Manual Version 2.1 / March 2018 Contents 1. Introduction 2 2. Equipment, Materials and Reagents 3 3. Methods 4 3.1 Coating of tissue culture plates 4 3.2 Thawing Pluricyte Cardiomyocytes

More information

RayBio Human PPAR-alpha Transcription Factor Activity Assay Kit

RayBio Human PPAR-alpha Transcription Factor Activity Assay Kit RayBio Human PPAR-alpha Transcription Factor Activity Assay Kit Catalog #: TFEH-PPARa User Manual Jan 5, 2018 3607 Parkway Lane, Suite 200 Norcross, GA 30092 Tel: 1-888-494-8555 (Toll Free) or 770-729-2992,

More information

CellPlayer HeLa NucLight Red

CellPlayer HeLa NucLight Red Essen BioScience Catalog Number: 4489 Storage Liquid Nitrogen Note: Cells can be thawed and cultured immediately upon receipt or stored in liquid nitrogen for long-term storage. Storage at -8 C is not

More information

Primary Adult Naïve CD4+ CD45RA+ Cells. Prepared by: David Randolph at University of Alabama, Birmingham

Primary Adult Naïve CD4+ CD45RA+ Cells. Prepared by: David Randolph at University of Alabama, Birmingham Primary Adult Naïve CD4+ CD45RA+ Cells Prepared by: David Randolph (drdrdr@uab.edu) at University of Alabama, Birmingham Goal: To obtain large numbers of highly pure primary CD4+ CD45RO- CD25- cells from

More information

RayBio KinaseSTAR TM Akt Activity Assay Kit

RayBio KinaseSTAR TM Akt Activity Assay Kit Activity Assay Kit User Manual Version 1.0 March 13, 2015 RayBio KinaseSTAR TM Akt Activity Kit Protocol (Cat#: 68AT-Akt-S40) RayBiotech, Inc. We Provide You With Excellent Support And Service Tel:(Toll

More information

Mammalian Tissue Protein Extraction Reagent

Mammalian Tissue Protein Extraction Reagent Mammalian Tissue Protein Extraction Reagent Catalog number: AR0101 Boster s Mammalian Tissue Protein Extraction Reagent is a ready-to-use Western blot related reagent solution used for efficient extraction

More information

T Cell Activation Bioassay (IL-2) Instructions for use of Products J1651 and J1655.

T Cell Activation Bioassay (IL-2) Instructions for use of Products J1651 and J1655. TECHNICAL MANUAL T Cell Activation Bioassay (IL-2) Instructions for use of Products J1651 and J1655. 11/16 TM492 T Cell Activation Bioassay (IL-2) All technical literature is available at: www.promega.com/protocols/

More information

Immature organoids appear after hours.

Immature organoids appear after hours. THE ESSENTIALS OF LIFE SCIENCE RESEARCH GLOBALLY DELIVERED Allison Ruchinskas, B.S., and James Clinton, Ph.D. ATCC Cell Systems, Gaithersburg, MD INTRODUCTION Figure 1. Mouse small intestinal organoid

More information

Aperto Cell Lysis and Protein Solubilization Users Manual

Aperto Cell Lysis and Protein Solubilization Users Manual Aperto Cell Lysis and Protein Solubilization Users Manual Revision 2 THIS MANUAL APPLIES TO THE FOLLOWING PRODUCTS: 3A8600 Aperto, 5X Cell Lysis Buffer. 20mL 3A8610 Aperto, 5X Cell Lysis Buffer. 100mL

More information

Human Mammary Luminal Epithelial Cells. Manual

Human Mammary Luminal Epithelial Cells. Manual Human Mammary Luminal Epithelial Cell Manual INSTRUCTION MANUAL SHIPPING CONDITIONS ZBM0071.00 Human Mammary Luminal Epithelial Cells Orders are delivered via Federal Express courier. All US and Canada

More information

Follicle Dermal Papilla Cell

Follicle Dermal Papilla Cell Follicle Dermal Papilla Cell Instruction Manual Product Size Catalog Number Human Follicle Dermal Papilla Cells (HFDPC) 500,000 cryopreserved cells 500,000 proliferating cells C-12071 C-12072 Product Description

More information

Cellartis Hepatocyte Diff Kit User Manual

Cellartis Hepatocyte Diff Kit User Manual Takara Bio Europe AB Cellartis Hepatocyte Diff Kit User Manual Cat. No. Y30050 (061715) Takara Bio Europe AB A Takara Bio Company Arvid Wallgrens backe 20, SE-413 46 Göteborg, Sweden Europe Technical Support:

More information

STAT1 (ps727) (Human/Mouse) ELISA Kit

STAT1 (ps727) (Human/Mouse) ELISA Kit STAT1 (ps727) (Human/Mouse) ELISA Kit Catalog Number KA2171 96 assays Version: 01 Intended for research use only www.abnova.com I. INTRODUCTION STAT1 (ps727) (Human/Mouse) ELISA (Enzyme-Linked Immunosorbent

More information

Validation & Assay Performance Summary

Validation & Assay Performance Summary Validation & Assay Performance Summary LanthaScreen IGF-1R GripTite Cells Cat. no. K1834 Modification Detected: Phosphorylation of Multiple Tyr Residues on IGF-1R LanthaScreen Cellular Assay Validation

More information

VEGF Bioassay Instructions for use of Product GA2001 and GA2005

VEGF Bioassay Instructions for use of Product GA2001 and GA2005 TECHNICAL MANUAL VEGF Bioassay Instructions for use of Product GA21 and GA25 9/18 TM544 VEGF Bioassay All technical literature is available at: www.promega.com/protocols/ Visit the web site to verify that

More information

Human Dermal Microvascular Endothelial Cells. Protocol version 1.0

Human Dermal Microvascular Endothelial Cells. Protocol version 1.0 Human Dermal Microvascular Endothelial Cells Protocol version 1.0 Protocol version 1.0 Table of Contents Human Airway Epithelial Cells 2 Recommendations 2 Thawing and Plating 2 Passaging 3 Usage Statement

More information

EpiQuik Total Histone H3 Acetylation Detection Fast Kit (Colorimetric)

EpiQuik Total Histone H3 Acetylation Detection Fast Kit (Colorimetric) EpiQuik Total Histone H3 Acetylation Detection Fast Kit (Colorimetric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Total Histone H3 Acetylation Detection Fast Kit (Colorimetric)

More information

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum

More information

Small-scale Triton X-114 Extraction of Hydrophobic Proteins Yuzuru Taguchi * and Hermann M. Schätzl

Small-scale Triton X-114 Extraction of Hydrophobic Proteins Yuzuru Taguchi * and Hermann M. Schätzl Small-scale Triton X-114 Extraction of Hydrophobic Proteins Yuzuru Taguchi * and Hermann M. Schätzl Comparative Biology and Experimental Medicine, University of Calgary, Calgary, Canada *For correspondence:

More information

RayBio Cathepsin D Activity Assay Kit

RayBio Cathepsin D Activity Assay Kit RayBio Cathepsin D Activity Assay Kit User Manual Version 1.0 October 1, 2014 RayBio Cathepsin D Activity Assay (Cat#: 68AT-CathD-S100) RayBiotech, Inc. We Provide You With Excellent Support And Service

More information

EPIGENTEK. EpiQuik Global Acetyl Histone H3K27 Quantification Kit (Colorimetric) Base Catalog # P-4059 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Global Acetyl Histone H3K27 Quantification Kit (Colorimetric) Base Catalog # P-4059 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Global Acetyl Histone H3K27 Quantification Kit (Colorimetric) Base Catalog # P-4059 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Global Acetyl Histone H3K27 Quantification Kit (Colorimetric)

More information