KD025 in IPF: Topline Results

Size: px
Start display at page:

Download "KD025 in IPF: Topline Results"

Transcription

1 KD025 in IPF: Topline Results Webcast Presentation February 13, 2018 Kadmon Holdings, Inc. 1

2 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs and assumptions and on information currently available to management of Kadmon Holdings, Inc. (the Company ). All statements other than statements of historical fact contained in this presentation are forward-looking statements. Forward looking statements include information concerning the initiation, timing, progress and results of clinical trials of the Company s product candidates, the timing or likelihood of regulatory filings and approvals for any of its product candidates, and estimates regarding the Company s expenses, future revenues and future capital requirements. In some cases, you can identify forward-looking statements by terminology such as may, will, should, expects, plans, anticipates, believes, estimates, predicts, potential or continue or the negative of these terms or other comparable terminology. There are important factors that could cause the Company s actual results to differ materially from those expressed or implied by the forward-looking statements, including those factors discussed under the caption entitled Risk Factors in the Company s Quarterly Report on Form 10-Q for the period ended September 30, Forward-looking statements involve known and unknown risks, uncertainties and other factors that may cause the Company s actual results, performance or achievements to be materially different from any future results, performance or achievements expressed or implied by the forward-looking statements. Forward-looking statements represent the Company s beliefs and assumptions only as of the date of this presentation. Although the Company believes that the expectations reflected in the forward-looking statements are reasonable, it cannot guarantee future results, levels of activity, performance or achievements. Except as required by law, the Company assumes no obligation to publicly update any forward looking statements for any reason after the date of this presentation to conform any of the forward-looking statements to actual results or to changes in its expectations. 2

3 ROCK Inhibition in Fibrosis 3

4 ROCK: Signaling Pathway with Major Therapeutic Potential ROCK Signaling Pathway Plays a Key Role in Multiple Tissue Types Rho-associated coiled-coil kinase (ROCK) is a serine/threonine kinase that mediates a wide range of functions, including cell movement, shape, differentiation and function 1 Two isoforms exist: ROCK1 and ROCK2, with both overlapping and non-redundant functions 1 ROCK is ubiquitously expressed, with high levels in smooth muscle tissues, brain and heart 2 Scientific literature has shown that ROCK is dysregulated in many chronic diseases, including IPF, chronic graft-versus-host disease (cgvhd), scleroderma, renal fibrosis, hypertension, glaucoma and others 3-6 ROCK inhibition has therapeutic potential in a wide range of diseases 1 Small GTPases. 2014; 5: e Post-Genomic Cardiology (Second Edition). 2014, Pages Pharmacol Rev Jan; 67(1): Blood Apr 28;127(17): Proc Natl Acad Sci USA Apr 25;114(17): Curr Drug Discov Technol Mar;6(1):

5 ROCK is the Common Pathway of Initiating Factors in IPF ROCK Regulates Multiple Pro-Fibrotic Processes, Including Myofibroblast Activation ROCK is downstream of major pro-fibrotic mediators, including: Transforming growth factor beta (TGF-β) Connective tissue growth factor (CTGF) CTGF Myofibroblast Cell Stress fiber formation Lysophosphatidic acid (LPA) ROCK regulates fibroblast differentiation to myofibroblasts, a defining feature of pathologic fibrosis ROCK ROCK MKL1 Pro-fibrotic genes ROCK mediates stress fiber formation ROCK regulates transcription of pro-fibrotic genes, including CTGF and alpha-smooth muscle actin (α-sma) Am J Pathol Apr;185(4): MKL1 MKL1 CTGF 5

6 ROCK Activity is Increased in Regions of Active Fibrosis RhoA/ROCK activity is increased in regions of active fibrosis in human IPF and in mice with bleomycin-induced lung injury Phosphorylation of myosin light chain (MLC 20 ) in the fibroblastic foci: evidence of RhoA/ROCK signaling in lung fibrosis ROCK activity analyzed in an ELISA-based assay IHC staining of IPF patients and mouse lung sections stained for phospho-mlc 20 (A F and H) or collagen (G, Masson s trichrome) J Clin Invest. 2013;123(3): Am J Pathol Dec; 179(6):

7 ROCK Inhibitor KD025 Reduced Lung Fibrosis in Bleomycin Model Reduced Fibrosis in Multiple Preclinical Models, Including Bleomycin and cgvhd Mouse Models Intratracheal Bleomycin KD025 treatment administered when fibrosis is already established (orally, 50, 100 or 150 mg/kg QD) Tissue Harvest Day: Normal Lung Pre-Treatment Lung Intratracheal Bleomycin Day 0 Vehicle or KD025 Day 8 Treatment: Day 21 Control KD mg/kg QD KD mg/kg QD KD mg/kg QD 1 Blood Apr 28;127(17):

8 KD025: an Investigational, Oral ROCK2 Inhibitor for IPF KD025 Represents an Innovative Approach to IPF Therapy KD025 is an oral ROCK2 inhibitor in Phase 2 development for inflammatory and fibrotic diseases Demonstrated clinical activity of KD025 in an ongoing Phase 2 clinical trial in cgvhd 1 KD025 achieved durable clinical responses in approximately two-thirds of patients, including Complete Responses in organs with fibrotic disease KD025 was well tolerated, with no treatment-related SAEs KD025 demonstrates potential therapeutic utility in IPF by targeting key fibrotic processes mediated by ROCK 1 ASH 2017, Poster

9 KD : Trial Design 9

10 Eligibility Criteria, Trial Design and Key Endpoints IPF diagnosis within 5 years by HRCT/ lung biopsy Received pirfenidone and/or nintedanib or been offered both 18 years of age FVC 50% predicted DL CO 30% predicted FEV 1 / FVC ratio :1 KD mg QD (n=25) BSC* (n=14) Option to extend Crossover allowed at investigator s discretion Primary Endpoints: Safety and tolerability Change in FVC from baseline to 24 weeks Key Secondary Endpoints: Percentage of patients with a decline in FVC of 5% at 24 weeks Pulmonary Function Test (PFT) High-Resolution Computed Tomography (HRCT) 1 J Manag Care Spec Pharm Mar;23(3-b Suppl):S17-S weeks 48 weeks Diffusion capacity (DL CO) 6-Minute Walk Test (6MWT) Lung fibrosis as measured by quantitative HRCT *Best Supportive Care, as determined by investigator. BSC may include pulmonary rehabilitation, supplemental oxygen therapy, and/or other symptomatic treatments 1 ; excludes pirfenidone/nintedanib 10

11 KD : Trial Sites Site Name Location Principal Investigator University of Pittsburgh Pittsburgh, PA Kevin F. Gibson, MD Medical University of South Carolina Charleston, SC Timothy P. Whelan, MD University of California, Davis Sacramento, CA Timothy E. Albertson, MD, PhD, MPH University of Arizona Tucson, AZ Sachin Chaudhary, MD Pulmonary Associates Phoenix, AZ David M. Baratz, MD Central Florida Pulmonary Group Orlando, FL Syed I. Mobin, MD Pulmonary Disease Specialists Kissimmee, FL Thomas W. O'Brien, MD St. Francis Medical Center Clearwater, FL Francis Averill, MD 11

12 KD : Data As of February 1,

13 Demographics and Baseline Characteristics KD025 (N=25) BSC (N=14) Age, years 71.4 ± ± 6.8 Male, n (%) 18 (72.0%) 11 (78.6%) Time since IPF diagnosis, years 2.5 ± ± 2.2 Former smokers, n (%) 17 (68.0%) 10 (71.4%) Prior treatment: Pirfenidone or nintedanib, n (%) 13 (52.0%) 4 (28.6%) Lung function: FVC, % of predicted value 67.2 ± ± 18.2 FVC (L) 2.51 ± ± 0.87 DL CO, % of predicted 45.6 ± ± 10.8 FEV 1 /FVC ratio 0.83 ± ± 0.07 Data are presented as mean ± SD, unless otherwise specified 13

14 Patient Disposition KD025 arm: Patients have received 24 weeks of KD025 treatment (n=20) Includes crossover patients (n=3); excludes patients not evaluable at 24 weeks (n=10) BSC arm: Patients have received 24 weeks of follow-up (n=9) W24 Evaluable (n=20) Patients Randomized 2:1 (n=39) KD025 (n=25) n=30 Crossover to KD025 Prior W24 (n=5) Withdrawal / LFU/Not Evaluable (n=10) Withdrawal / LFU / Not Evaluable (n=10) AEs* (7) Not evaluable at W24 + (1) IPF misdiagnosed (1) Lost to follow-up (1) BSC (n=14) W24 Evaluable (n=9) 24 weeks (EOPT) *Each occurred in 1 patient: Gr3 LFTs (considered related); basal ganglia hemorrhage; carcinoma; congestive heart failure; dyspnea; hypotension; death due to unknown cause + Sternotomy; patient continues on KD025 14

15 KD025 Slows Change in FVC at 24 Weeks Median Change in FVC (ml) Absolute FVC difference was 127 ml, a relative difference of 73% Decline in FVC % predicted was 1% with KD025 versus 2% with BSC, a relative difference of 50% FVC%-Predicted Decline 5% 20% of KD025 patients experienced FVC decline 5%, compared to 44% BSC patients at Week 24, a relative difference of 55% Change in FVC (ml) at W KD ml (n=20) BSC -175 ml (n=9) % Patients with 5% FVC % Patients with 5% FVC Decline 50% 40% 30% 20% 10% 0% 20% (n=20) KD025 44% (n=9) BSC 15

16 Additional Analyses Demonstrate Benefit of KD025 KD025 Showed Benefit in Annualized FVC Decline Compared to 1 Year Prior to Randomization Evaluable patients randomized to KD025 for whom prior-year data were available (n=17): Annualized FVC decline of 126 ml one year prior to randomization, compared to an annualized FVC decline of 32 ml at 24 weeks of KD025 Patients with Prior Pirfenidone/Nintedanib Treatment Responded Better to KD025 Previously treated KD025 patients (n=10) showed an FVC decline of 2 ml at 24 weeks Previously treated BSC patients (n=2) showed an FVC decline of 273 ml at 24 weeks 16

17 KD025 Efficacy Compares Favorably to Approved IPF Therapies Patients who Continue on KD025 to Week 36 Maintain Slowed Rate of FVC Decline 0-50 KD ml (n=20) KD ml (n=12) Change in FVC (ml) BSC -175 ml (n=9) Range of ΔFVC in treatment arms of Phase 3 studies of approved IPF therapies nintedanib and pirfenidone 1,2 Range of ΔFVC in placebo arms of Phase 3 studies of approved IPF therapies 1, Time (weeks) 1 Supplement to: N Engl J Med 2014;370: Page 18, Table S5: Secondary lung function endpoints in INPULSIS -1 and INPULSIS -2 at week 52 (pooled data). 2 N Engl J Med 2014;370: DOI: /NEJMoa Page 2088, Fig 2B (ASCEND). 17

18 KD025 was Well Tolerated, with No Drug-Related SAEs 18/20 (90%) of KD025 Patients Evaluable at W24 Elected to Continue KD025 Beyond W24 KD025 1 (N=34) BSC (N=14) Mean duration of exposure (weeks) Patient-years of exposure All-grade adverse events 29 (85%) 11 (79%) Drug-related adverse events: All-grade adverse events 2 (6%) 0 Grade 3 or higher adverse events 1 (3%) 0 Serious adverse events 0 0 Resulting in study drug discontinuation 2 (6%) All patients treated with KD025 (includes 9 crossovers) 2 KD025 arm could receive treatment beyond 24 weeks; BSC arm received maximum 24 weeks of follow-up 3 Depression, Grade 3 LFT elevations 18

19 Conclusions Demonstrated Clinical Activity of KD025 in IPF KD025 slowed the decline in lung function in IPF patients over 24 weeks of treatment: Absolute change in FVC of -48 ml in KD025 patients, compared to -175 ml with BSC KD025 patients demonstrated 1.0% FVC decline, compared to 2.0% with BSC 20% of KD025 patients experienced an FVC % predicted decline 5%, compared to 44% of BSC patients KD025 was well tolerated, with no drug-related SAEs 90% of patients on KD025 elected to continue on treatment beyond 24 weeks Findings support continued development of KD025 in IPF Data to be presented at American Thoracic Society (ATS) International Conference in May

20 Q&A 20

KD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF)

KD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) -207: A Phase 2 Trial of to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) K. F. Gibson 1, F. Averill 2, T.E. Albertson 3, D. M. Baratz 4, S. Chaudhary 5,

More information

Corporate Presentation

Corporate Presentation Corporate Presentation June 2018 Kadmon Holdings, Inc. 1 Disclaimers This presentation contains forward looking statements that are based on the beliefs and assumptions and on information currently available

More information

Corporate Presentation

Corporate Presentation Corporate Presentation November 2016 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs and assumptions and on information

More information

GLPG1690 FLORA topline results

GLPG1690 FLORA topline results GLPG1690 FLORA topline results Webcast presentation 10 August 2017 Disclaimer This presentation contains forward-looking statements, including (without limitation) statements concerning the potential activity

More information

KD : A Phase 2a Study of KD025 for Patients with Chronic Graft Versus Host Disease (cgvhd) - Pharmacodynamics and Updated Results

KD : A Phase 2a Study of KD025 for Patients with Chronic Graft Versus Host Disease (cgvhd) - Pharmacodynamics and Updated Results KD025-208: A Phase 2a Study of KD025 for Patients with Chronic Graft Versus Host Disease (cgvhd) - Pharmacodynamics and Updated Results Madan Jagasia 1, Amandeep Salhotra 2, Carlos R. Bachier 3, James

More information

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1 PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:

More information

NINTEDANIB MEDIA BACKGROUNDER

NINTEDANIB MEDIA BACKGROUNDER NINTEDANIB MEDIA BACKGROUNDER 1. What is nintedanib? 2. How does nintedanib work? 3. Data overview 4. International treatment guidelines for IPF 1. What is nintedanib? Nintedanib (OFEV a ) is a small molecule

More information

Corporate Presentation

Corporate Presentation Corporate Presentation January 2019 Kadmon Holdings, Inc. 1 Disclaimers This presentation contains forward looking statements that are based on the beliefs and assumptions and on information currently

More information

Regulatory Status FDA-approved indication: Ofev is a kinase inhibitor indicated for the treatment of idiopathic pulmonary fibrosis (IPF) (1).

Regulatory Status FDA-approved indication: Ofev is a kinase inhibitor indicated for the treatment of idiopathic pulmonary fibrosis (IPF) (1). Federal Employee Program 1310 G Street, N.W. Washington, D.C. 20005 202.942.1000 Fax 202.942.1125 5.45.05 Subject: Ofev Page: 1 of 5 Last Review Date: March 17, 2017 Ofev Description Ofev (nintedanib)

More information

Keyzilen TM Program Update

Keyzilen TM Program Update Keyzilen TM Program Update October 11, 2016 Forward-looking Statements This presentation and the accompanying oral commentary contain forward-looking statements that involve substantial risks and uncertainties.

More information

Roclatan TM Mercury 2 Phase 3 Topline Results

Roclatan TM Mercury 2 Phase 3 Topline Results Roclatan TM Mercury 2 Phase 3 Topline Results 1 Important Information Any discussion of the potential use or expected success of our product candidates is subject to our product candidates being approved

More information

Breathtaking science. Developing respiratory drugs to improve health and quality of life. H.C. Wainwright Global Life Sciences Conference April 2018

Breathtaking science. Developing respiratory drugs to improve health and quality of life. H.C. Wainwright Global Life Sciences Conference April 2018 Breathtaking science Developing respiratory drugs to improve health and quality of life H.C. Wainwright Global Life Sciences Conference April 2018 www.veronapharma.com Forward-Looking Statements This presentation

More information

Therapies for Idiopathic Pulmonary Fibrosis Pharmacologic, Non-Pharmacologic

Therapies for Idiopathic Pulmonary Fibrosis Pharmacologic, Non-Pharmacologic Therapies for Idiopathic Pulmonary Fibrosis Pharmacologic, Non-Pharmacologic Amy Olson, MD, MSPH Associate Professor, Division of Pulmonary and Critical Care Medicine National Jewish Health, Denver, CO

More information

Roclatan TM Mercury 1 Phase 3 12-month Topline Results. For Investor Use

Roclatan TM Mercury 1 Phase 3 12-month Topline Results. For Investor Use Roclatan TM Mercury 1 Phase 3 12-month Topline Results For Investor Use 1 Important Information Any discussion of the potential use or expected success of our product candidates is subject to our product

More information

Rimegepant Pivotal Phase 3 Trial Results - Conference Call March 26, Biohaven

Rimegepant Pivotal Phase 3 Trial Results - Conference Call March 26, Biohaven Rimegepant Pivotal Phase 3 Trial Results - Conference Call March 26, 2018 1 Forward-Looking Statement This presentation contains forward-looking statements, including: statements about our plans to develop

More information

Management of Idiopathic Pulmonary Fibrosis

Management of Idiopathic Pulmonary Fibrosis Management of Idiopathic Pulmonary Fibrosis Robert Hallowell, M.D. December 22, 2015 Disclosures No financial disclosures What causes IPF? +? VEGF-R Airspace lining TNFa Fibrocytes PDGF Fibroblasts IL-1

More information

OFEV MEDIA BACKGROUNDER

OFEV MEDIA BACKGROUNDER OFEV MEDIA BACKGROUNDER 1 What is OFEV (nintedanib*)? 2 How does OFEV (nintedanib*) work? 3 Data overview 4 OFEV (nintedanib*) approval status 1 What is OFEV (nintedanib*)? OFEV (nintedanib*) is a small

More information

PATENCY-1 Top-Line Results

PATENCY-1 Top-Line Results PATENCY-1 Top-Line Results December 13, 2016 2016 Proteon Therapeutics, Inc. Cautionary Note Regarding Forward-Looking Statements This presentation contains statements that are, or may be deemed to be,

More information

Advancing Innovative Therapies for Neurological Diseases

Advancing Innovative Therapies for Neurological Diseases Advancing Innovative Therapies for Neurological Diseases Phase 3 Topline Rimegepant 75 mg Zydis ODT December 03, 2018 NYSE: BHVN 2018 Biohaven Pharmaceuticals. All rights reserved. Disclaimer This presentation

More information

Phase 3c Topline Results. Page 1

Phase 3c Topline Results. Page 1 Phase 3c Topline Results Page 1 Important Information Any statements in this presentation about future expectations, plans and prospects for the Company including the development and regulatory status

More information

Controversies in Clinical Trials. Pirfenidone for Idiopathic Pulmonary Fibrosis (IPF)

Controversies in Clinical Trials. Pirfenidone for Idiopathic Pulmonary Fibrosis (IPF) Controversies in Clinical Trials Pirfenidone for Idiopathic Pulmonary Fibrosis (IPF) Controversies to be highlighted by IPF Post-hoc analyses Story Primary end point selection Changing prespecified endpoints

More information

REATA PHARMACEUTICALS, INC. ANNOUNCES SECOND QUARTER 2018 FINANCIAL RESULTS AND AN UPDATE ON DEVELOPMENT PROGRAMS

REATA PHARMACEUTICALS, INC. ANNOUNCES SECOND QUARTER 2018 FINANCIAL RESULTS AND AN UPDATE ON DEVELOPMENT PROGRAMS REATA PHARMACEUTICALS, INC. ANNOUNCES SECOND QUARTER 2018 FINANCIAL RESULTS AND AN UPDATE ON DEVELOPMENT PROGRAMS IRVING, Texas August 8, 2018 Reata Pharmaceuticals, Inc. (Nasdaq: RETA), a clinical-stage

More information

Edasalonexent (CAT-1004)

Edasalonexent (CAT-1004) Edasalonexent (CAT-1004) An NF-κB Inhibitor in Development for Patients with Duchenne Muscular Dystrophy Joanne M. Donovan, MD PhD Chief Medical Officer 17 February 2018 1 Forward Looking Statements This

More information

STUDY 1 PHASE 3 TOP-LINE RESULTS. September 2017

STUDY 1 PHASE 3 TOP-LINE RESULTS. September 2017 STUDY 1 PHASE 3 TOP-LINE RESULTS September 2017 Forward Looking Statement Zogenix cautions you that statements included in this presentation that are not a description of historical facts are forward-looking

More information

Edasalonexent (CAT-1004) Program

Edasalonexent (CAT-1004) Program Edasalonexent (CAT-1004) Program Oral small molecule designed to inhibit NF-κB for the treatment of Duchenne muscular dystrophy Joanne M. Donovan, MD, PhD Chief Medical Officer, Catabasis Pharmaceuticals

More information

Cavosonstat Phase 2 Trial Results. November 28 th, 2016

Cavosonstat Phase 2 Trial Results. November 28 th, 2016 Phase 2 Trial Results November 28 th, 2016 Nivalis Therapeutics 2016 Agenda Introduction Mike Carruthers, Chief Financial Officer Initial Remarks Jon Congleton, President and CEO Data Highlights David

More information

Update on Therapies for Idiopathic Pulmonary Fibrosis. Outline

Update on Therapies for Idiopathic Pulmonary Fibrosis. Outline Update on Therapies for Idiopathic Pulmonary Fibrosis Paul Wolters Associate Professor University of California, San Francisco Outline Classification of Interstitial lung disease Clinical classification

More information

Breathtaking science. Developing respiratory drugs to improve health and quality of life

Breathtaking science. Developing respiratory drugs to improve health and quality of life Breathtaking science Developing respiratory drugs to improve health and quality of life June 2017 Forward-Looking Statements This presentation contains forward looking statements that are based on the

More information

Targeted Therapeutics for Inflammatory Disease

Targeted Therapeutics for Inflammatory Disease Targeted Therapeutics for Inflammatory Disease Forward Looking Statements / Safe Harbor This presentation and the accompanying oral commentary contain forward-looking statements that involve substantial

More information

SAKURA 3 Open-Label Phase 3 Safety Study with DaxibotulinumtoxinA for Injection (RT002) for the Treatment of Moderate to Severe Glabellar Lines

SAKURA 3 Open-Label Phase 3 Safety Study with DaxibotulinumtoxinA for Injection (RT002) for the Treatment of Moderate to Severe Glabellar Lines SAKURA 3 Open-Label Phase 3 Safety Study with DaxibotulinumtoxinA for Injection (RT002) for the Treatment of Moderate to Severe Glabellar Lines Presented by Dan Browne, Co-Founder, President & CEO, and

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Q1 Results 2018 Webcast presentation 26 April 2018

Q1 Results 2018 Webcast presentation 26 April 2018 Q1 Results 2018 Webcast presentation 26 April 2018 Disclaimer This presentation contains forward-looking statements, including (without limitation) statements concerning the progress of our clinical pipeline,

More information

AR CS205 Clinical Pilot Study Topline Results

AR CS205 Clinical Pilot Study Topline Results AR-13324-CS205 Clinical Pilot Study Topline Results 1 Important Information The information in this presentation is current only as of its date and may have changed or may change in the future. We undertake

More information

Rhopressa TM Rocket 2 Phase 3 Topline Results

Rhopressa TM Rocket 2 Phase 3 Topline Results Rhopressa TM Rocket 2 Phase 3 Topline Results 1 Important Information Any discussion of the potential use or expected success of our product candidates is subject to our product candidates being approved

More information

Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates

Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates Connective Tissue Disorder- Associated Interstitial Lung Disease (CTD-ILD) and Updates Maria Elena Vega, M.D Assistant Professor of Medicine Lewis Katz School of Medicine at Temple University Nothing to

More information

A case of a patient with IPF treated with nintedanib. Prof. Kreuter and Prof. Heussel

A case of a patient with IPF treated with nintedanib. Prof. Kreuter and Prof. Heussel A case of a patient with IPF treated with nintedanib Prof. Kreuter and Prof. Heussel Case Overview This case describes the history of a patient with IPF who, at the time of diagnosis, had symptoms typical

More information

February 20, 2019 MANAGEMENT CALL TO DISCUSS PHASE 2 PHOENIX RESULTS AND CKD PROGRAM UPDATES

February 20, 2019 MANAGEMENT CALL TO DISCUSS PHASE 2 PHOENIX RESULTS AND CKD PROGRAM UPDATES February 20, 209 MANAGEMENT CALL TO DISCUSS PHASE 2 PHOENIX RESULTS AND CKD PROGRAM UPDATES Forward-Looking Statements This presentation contains certain forward-looking statements that are made pursuant

More information

Aquinox Q2 /2015 Conference Call: LEADERSHIP Secondary Endpoint Update - AQX-1125 in BPS/IC. August 6, 2015

Aquinox Q2 /2015 Conference Call: LEADERSHIP Secondary Endpoint Update - AQX-1125 in BPS/IC. August 6, 2015 Aquinox Q2 /2015 Conference Call: LEADERSHIP Secondary Endpoint Update - AQX-1125 in BPS/IC August 6, 2015 Forward Looking Statements / Safe Harbor This presentation and the accompanying oral commentary

More information

Committed to Transforming the Treatment Paradigm for Migraine Prevention

Committed to Transforming the Treatment Paradigm for Migraine Prevention June 14, 2018 Committed to Transforming the Treatment Paradigm for Migraine Prevention September 6, 2018 Forward-Looking Statements This presentation and the accompanying commentary contains certain forward-looking

More information

XP23829 PHASE 2 PSORIASIS TRIAL PRELIMINARY TOPLINE DATA PRESENTATION SEPTEMBER 15, 2015 COPYRIGHT 2015 XENOPORT, INC. ALL RIGHTS RESERVED.

XP23829 PHASE 2 PSORIASIS TRIAL PRELIMINARY TOPLINE DATA PRESENTATION SEPTEMBER 15, 2015 COPYRIGHT 2015 XENOPORT, INC. ALL RIGHTS RESERVED. XP23829 PHASE 2 PSORIASIS TRIAL PRELIMINARY TOPLINE DATA PRESENTATION SEPTEMBER 15, 2015 COPYRIGHT 2015 XENOPORT, INC. ALL RIGHTS RESERVED. SAFE HARBOR DISCLAIMER These slides and the accompanying oral

More information

Inarigivir ACHIEVE Trial Results and HBV Clinical Program Update. August 2, 2018

Inarigivir ACHIEVE Trial Results and HBV Clinical Program Update. August 2, 2018 Inarigivir ACHIEVE Trial Results and HBV Clinical Program Update August 2, 2018 FORWARD LOOKING STATEMENT This presentation includes forward-looking statements within the meaning of the Private Securities

More information

GR-MD-02 for Indication of NASH Cirrhosis: NASH-CX Clinical Trial Results

GR-MD-02 for Indication of NASH Cirrhosis: NASH-CX Clinical Trial Results GR-MD-02 for Indication of NASH Cirrhosis: NASH-C Clinical Trial Results Supplemental Information to Corporate Presentation February 6, 2018 NASDAQ: GALT www.galectintherapeutics.com 1 2018 2017 Galectin

More information

AM-125 : Intranasal Betahistine

AM-125 : Intranasal Betahistine AM-125 : Intranasal Betahistine February 3, 2017 NASDAQ: EARS Forward-looking Statements This presentation and the accompanying oral commentary contain forward-looking statements that involve substantial

More information

Patient with FVC>90% predicted. Demosthenes Bouros, Vasilios Tzilas University of Athens

Patient with FVC>90% predicted. Demosthenes Bouros, Vasilios Tzilas University of Athens Patient with FVC>90% predicted Demosthenes Bouros, Vasilios Tzilas University of Athens CASE OVERVIEW A 63-year-old, male patient with progressive exertional dyspnoea lasting for 2 years and dry cough

More information

MANIFEST Phase 2 Enhancement / Expansion

MANIFEST Phase 2 Enhancement / Expansion MANIFEST Phase 2 Enhancement / Expansion Investor Conference Call Stellar Science, Breakthrough Medicine October 11, 2018 Forward-Looking Statements This presentation contains forward-looking statements

More information

Summary: Key Learning Points, Clinical Strategies, and Future Directions

Summary: Key Learning Points, Clinical Strategies, and Future Directions Summary: Key Learning Points, Clinical Strategies, and Future Directions Introduction Idiopathic pulmonary fibrosis (IPF), a peripheral lobular fibrosis of unknown cause, is a chronic, progressive lung

More information

AVEO and Astellas Report Final Overall Survival Results from TIVO-1

AVEO and Astellas Report Final Overall Survival Results from TIVO-1 AVEO and Astellas Report Final Overall Survival Results from TIVO-1 - Median Overall Survival of 28.8 Months Reported for Tivozanib in Patients with Advanced Kidney Cancer - CAMBRIDGE, Mass. and TOKYO,

More information

Translating Science. Transforming Lives. ACT DMD Clinical Trial Results

Translating Science. Transforming Lives. ACT DMD Clinical Trial Results Translating Science. Transforming Lives ACT DMD Clinical Trial Results FORWARD LOOKING STATEMENTS This presentation contains forward-looking statements within the meaning of The Private Securities Litigation

More information

Zogenix Announces Positive Top-line Results from Pivotal Phase 3 Clinical Trial of ZX008 in Dravet Syndrome

Zogenix Announces Positive Top-line Results from Pivotal Phase 3 Clinical Trial of ZX008 in Dravet Syndrome Zogenix Announces Positive Top-line Results from Pivotal Phase 3 Clinical Trial of ZX008 in Dravet Syndrome Primary Endpoint Achieved - Statistically Significant Convulsive Seizure Reduction for ZX008

More information

Anti-IL-33 (ANB020) Program

Anti-IL-33 (ANB020) Program Anti-IL-33 (ANB020) Program Phase 2a Peanut Allergy Clinical Trial Interim Data Update March 26 th 2018 NASDAQ: ANAB Safe Harbor Statement This presentation and the accompanying oral presentation contain

More information

microrna Therapeutics Harnessing the power of micrornas to target multiple pathways of disease

microrna Therapeutics Harnessing the power of micrornas to target multiple pathways of disease microrna Therapeutics Harnessing the power of micrornas to target multiple pathways of disease January 2018 Safe Harbor Statement Statements contained in this presentation regarding matters that are not

More information

Nintedanib and Pirfenidone: New Medications in the Management of Idiopathic Pulmonary Fibrosis

Nintedanib and Pirfenidone: New Medications in the Management of Idiopathic Pulmonary Fibrosis Nintedanib and Pirfenidone: New Medications in the Management of Idiopathic Pulmonary Fibrosis Brad Zimmermann, PharmD, MBA Pharmacy Grand Rounds May 02, 2017 Rochester, Minnesota 2017 MFMER slide-1 Objectives

More information

Cohort A. Number of patients

Cohort A. Number of patients MyoKardia Announces Positive Results from Low- Dose Cohort of Phase 2 PIONEER-HCM Study of Mavacamten in Symptomatic, Obstructive Hypertrophic Cardiomyopathy Patients Met Primary Endpoint and Key Secondary

More information

-- Edasalonexent Substantially Slowed Duchenne Muscular Dystrophy Disease Progression through 36 Weeks --

-- Edasalonexent Substantially Slowed Duchenne Muscular Dystrophy Disease Progression through 36 Weeks -- Catabasis Pharmaceuticals Reports Positive Results from Open-Label Extension of Phase 2 MoveDMD Trial Evaluating Edasalonexent in Duchenne Muscular Dystrophy and Plans to Initiate Phase 3 Clinical Trial

More information

Long-term safety and efficacy of vismodegib in patients with advanced basal cell carcinoma (BCC): 24-month update of the pivotal ERIVANCE BCC study

Long-term safety and efficacy of vismodegib in patients with advanced basal cell carcinoma (BCC): 24-month update of the pivotal ERIVANCE BCC study Long-term safety and efficacy of vismodegib in patients with advanced basal cell carcinoma (BCC): 24-month update of the pivotal ERIVANCE BCC study A Sekulic, 1 MR Migden, 2 AE Oro, 3 L Dirix, 4 K Lewis,

More information

Idiopathic Pulmonary Fibrosis- a degenerative disease in need of a regenerative solution

Idiopathic Pulmonary Fibrosis- a degenerative disease in need of a regenerative solution Idiopathic Pulmonary Fibrosis- a degenerative disease in need of a regenerative solution Dan Chambers Queensland Lung Transplant Service, The Prince Charles Hospital School of Medicine, The University

More information

Disclosures. IPF Medications: Practical Experience. Prednisone, Azathioprine, N acyetylcysteine. Case 1. Brett Ley, MD, MAS Assistant Professor, UCSF

Disclosures. IPF Medications: Practical Experience. Prednisone, Azathioprine, N acyetylcysteine. Case 1. Brett Ley, MD, MAS Assistant Professor, UCSF IPF Medications: Practical Experience Disclosures Received speakers bureau honorarium from Roche/Genentech (makers of pirfenidone). Brett Ley, MD, MAS Assistant Professor, UCSF 67 y/o man 1 year cough

More information

Oppenheimer 29th Annual Healthcare Conference Mark Timney, Chief Executive Officer

Oppenheimer 29th Annual Healthcare Conference Mark Timney, Chief Executive Officer Oppenheimer 29th Annual Healthcare Conference Mark Timney, Chief Executive Officer New York City 20th March 2019 1 Safe Harbor Forward-looking statements Statements contained in this presentation about

More information

Disclosures. Traditional Paradigm. Overview 4/17/2010. I have relationships with the following organizations and companies:

Disclosures. Traditional Paradigm. Overview 4/17/2010. I have relationships with the following organizations and companies: Disclosures Pharmacological Therapy for ILD What to Use and How to Use It Harold R Collard MD Interstitial Lung Disease Program University of California San Francisco (UCSF) I have relationships with the

More information

Verona Pharma Announces Positive Top-Line Data from Phase 2a Clinical Trial in COPD with RPL554 Dosed in Addition to Tiotropium (Spiriva )

Verona Pharma Announces Positive Top-Line Data from Phase 2a Clinical Trial in COPD with RPL554 Dosed in Addition to Tiotropium (Spiriva ) Press release 7 September 2017 Verona Pharma Announces Positive Top-Line Data from Phase 2a Clinical Trial in COPD with RPL554 Dosed in Addition to Tiotropium (Spiriva ) Achieved significant and clinically

More information

Determined to realize a future in which people with cancer live longer and better than ever before

Determined to realize a future in which people with cancer live longer and better than ever before Determined to realize a future in which people with cancer live longer and better than ever before 3Q 2018 EARNINGS PRESENTATION NOVEMBER 2018 1 Forward-looking statements disclosure This presentation

More information

Quarterly Update & ASH 2017 Abstract Conference Call

Quarterly Update & ASH 2017 Abstract Conference Call Quarterly Update & ASH 2017 Abstract Conference Call November 1, 2017 Nasdaq : BLUE 1 Forward Looking Statements These slides and the accompanying oral presentation contain forward-looking statements and

More information

Building a Stroke Portfolio. June 28, 2018

Building a Stroke Portfolio. June 28, 2018 Building a Stroke Portfolio June 28, 2018 1 Forward-Looking Statements This presentation contains forward-looking statements, including statements relating to: the potential benefits, safety and efficacy

More information

PROMISE 1 Top-Line Data Results. June 27, 2017

PROMISE 1 Top-Line Data Results. June 27, 2017 PROMISE 1 Top-Line Data Results dd June 27, 2017 Forward Looking Statements This presentation and the accompanying commentary contains certain forward-looking statements within the meaning of Section 27A

More information

Presente e futuro della terapia della fibrosi polmonare idiopatica

Presente e futuro della terapia della fibrosi polmonare idiopatica Presente e futuro della terapia della fibrosi polmonare idiopatica Antonella Caminati U.O. di Pneumologia e Terapia Semi Intensiva Servizio di Fisiopatologia Respiratoria ed Emodinamica Polmonare Osp.

More information

Committed to Transforming the Treatment Paradigm for Migraine Prevention

Committed to Transforming the Treatment Paradigm for Migraine Prevention Committed to Transforming the Treatment Paradigm for Migraine Prevention 36th Annual J.P. Morgan Healthcare Conference January 8, 2018 Forward-Looking Statements This presentation and the accompanying

More information

Pimavanserin Top-Line Results Phase III Parkinson s Disease Psychosis Trial (-020 Study) Creating the Next Generation of CNS Drugs

Pimavanserin Top-Line Results Phase III Parkinson s Disease Psychosis Trial (-020 Study) Creating the Next Generation of CNS Drugs Pimavanserin Top-Line Results Phase III Parkinson s Disease Psychosis Trial (-020 Study) Creating the Next Generation of CNS Drugs Forward-Looking Statement This presentation contains forward-looking statements.

More information

-- Single Global Phase 3 Trial Expected to Begin in First Half of

-- Single Global Phase 3 Trial Expected to Begin in First Half of Catabasis Pharmaceuticals Reports Edasalonexent Preserved Muscle Function and Substantially Slowed Duchenne Muscular Dystrophy Disease Progression Through More Than One Year of Treatment -- Consistent

More information

Utrophin Modulation: A Universal Treatment Approach to DMD. End Duchenne Tour April 2018

Utrophin Modulation: A Universal Treatment Approach to DMD. End Duchenne Tour April 2018 Utrophin Modulation: A Universal Treatment Approach to DMD April 2018 Legal Disclaimer Statements in this presentation, other than statements of historical fact, constitute forward-looking statements within

More information

Experience with the Compassionate Use Program of nintedanib for the treatment of Idiopathic Pulmonary Fibrosis in Argentina

Experience with the Compassionate Use Program of nintedanib for the treatment of Idiopathic Pulmonary Fibrosis in Argentina ORIGINAL 131 RAMR 2017;2:131-135 ISSN 1852-236X Correspondence Gabriela Tabaj gabrielatabaj@gmail.com Received: 11.15.2016 Accepted: 02.03.2017 Experience with the Compassionate Use Program of nintedanib

More information

Retinal Disease Program

Retinal Disease Program Retinal Disease Program OIS @ ASRS Presentation August 2017 Important Information Any discussion of the potential use or expected success of our product candidates is subject to our product candidates

More information

ERS 2016 Congress Highlights Interstitial Lung Disease (ILD)

ERS 2016 Congress Highlights Interstitial Lung Disease (ILD) ERS 216 Congress Highlights Interstitial Lung Disease (ILD) London, UK September 3 rd 7 th 216 The 26 th European Respiratory Society International Congress, (ERS) the largest respiratory meeting in the

More information

IPF AND OTHER FIBROSING LUNG DISEASE: WHAT DRUGS MIGHT WORK AND ON WHOM DO THEY W ORK?

IPF AND OTHER FIBROSING LUNG DISEASE: WHAT DRUGS MIGHT WORK AND ON WHOM DO THEY W ORK? IPF AND OTHER FIBROSING LUNG DISEASE: WHAT DRUGS MIGHT WORK AND ON WHOM DO THEY W ORK? KEVIN K. BROWN, MD PROFESSOR AND VICE CHAIRMAN, DEPARTMENT OF MEDICINE NATIONAL JEWISH HEALTH DENVER, CO Kevin K.

More information

Challenges in Pulmonary and Critical Care 2017

Challenges in Pulmonary and Critical Care 2017 Challenges in Pulmonary and Critical Care 2017 Idiopathic Pulmonary Fibrosis: New Advances in Therapy Outcome Report: Boehringer Ingelheim Grant # ME201722329 February 2, 2018 Level 1 (Participation) Practice

More information

DIAGNOSTIC NOTE TEMPLATE

DIAGNOSTIC NOTE TEMPLATE DIAGNOSTIC NOTE TEMPLATE SOAP NOTE TEMPLATE WHEN CONSIDERING A DIAGNOSIS OF IDIOPATHIC PULMONARY FIBROSIS (IPF) CHIEF COMPLAINT HISTORY OF PRESENT ILLNESS Consider IPF as possible diagnosis if any of the

More information

Building a Fully Integrated Biopharmaceutical Company. June 2014

Building a Fully Integrated Biopharmaceutical Company. June 2014 Building a Fully Integrated Biopharmaceutical Company June 2014 Forward-Looking Statements This presentation contains forward-looking statements within the meaning of The Private Securities Litigation

More information

CADTH CDEC FINAL RECOMMENDATION

CADTH CDEC FINAL RECOMMENDATION CADTH CDEC FINAL RECOMMENDATION NINTEDANIB (Ofev Boehringer Ingelheim Canada Ltd.) Indication: Idiopathic Pulmonary Fibrosis Recommendation: The CADTH Canadian Drug Expert Committee (CDEC) recommends that

More information

Interim Results for 6 Months Ended 31 March 2017 and Business Update. 17 th May 2017

Interim Results for 6 Months Ended 31 March 2017 and Business Update. 17 th May 2017 Interim Results for 6 Months Ended 31 March 2017 and Business Update 17 th May 2017 Forward-looking Statements Please Note This presentation includes forward-looking statements. These forward-looking statements

More information

We strive to develop innovative solutions that improve and extend the lives of people with cystic fibrosis

We strive to develop innovative solutions that improve and extend the lives of people with cystic fibrosis Nivalis Therapeutics, Inc., October 2015 Analyst Breakfast at NACFC We strive to develop innovative solutions that improve and extend the lives of people with cystic fibrosis Disclaimer Regarding Forward

More information

Leading the Next Wave of Biotech Breakthroughs

Leading the Next Wave of Biotech Breakthroughs Leading the Next Wave of Biotech Breakthroughs Corporate Extensive corporate assets Platforms Pipeline Partnerships Building a sustainable global business Platform licenses represent a source of non-dilutive

More information

Idebenone (Raxone ) and pulmonary care in Duchenne Muscular Dystrophy (DMD) Kristina Nygren, MD CMO, Head of Development Santhera Pharmaceuticals,

Idebenone (Raxone ) and pulmonary care in Duchenne Muscular Dystrophy (DMD) Kristina Nygren, MD CMO, Head of Development Santhera Pharmaceuticals, Idebenone (Raxone ) and pulmonary care in Duchenne Muscular Dystrophy (DMD) Kristina Nygren, MD CMO, Head of Development Santhera Pharmaceuticals, Inc Disclaimer This presentation is not and under no circumstances

More information

May 10, 2016 Q & Business Update

May 10, 2016 Q & Business Update May 10, 2016 Q1 2016 Thank Financial you Results & Business Update Q1 2016 Financial Results Prepared Remarks Q1 Update Tom Hughes, Ph.D., Chief Executive Officer Clinical Update Dennis Kim, M.D., Chief

More information

PNEUMOLOGIA 2018 Milano, giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE. Il futuro dell IPF: dove stiamo andando. Carlo Albera

PNEUMOLOGIA 2018 Milano, giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE. Il futuro dell IPF: dove stiamo andando. Carlo Albera PNEUMOLOGIA 2018 Milano, 14 16 giugno 2018 INTERSTIZIOPATIE E MALATTIE RARE Il futuro dell : dove stiamo andando Carlo Albera Università di Torino, Scuola di Medicina Dipartimento di Scienze Cliniche e

More information

i-bodies a new class of protein therapeutics to treat fibrosis

i-bodies a new class of protein therapeutics to treat fibrosis i-bodies a new class of protein therapeutics to treat fibrosis BIOSHARES JULY 2017 Sam Cobb, CEO and Managing Director AdAlta Limited (ASX:1AD) s.cobb@adalta.com.au Disclaimer Investment in AdAlta is subject

More information

Common Drug Review Clinical Review Report

Common Drug Review Clinical Review Report Common Drug Review Clinical Review Report October 2015 Drug nintedanib (Ofev) Indication For the treatment of idiopathic pulmonary fibrosis (IPF). Listing request For adult patients who have a diagnosis

More information

PROMISE 2 Top-Line Data Results January 8, 2018

PROMISE 2 Top-Line Data Results January 8, 2018 PROMISE 2 Top-Line Data Results January 8, 2018 Forward-Looking Statements This presentation and the accompanying commentary contains certain forward-looking statements within the meaning of Section 27A

More information

Emerging Therapies for Lung Fibrosis. Helen Garthwaite Respiratory Registrar/ Clinical Research Fellow

Emerging Therapies for Lung Fibrosis. Helen Garthwaite Respiratory Registrar/ Clinical Research Fellow Emerging Therapies for Lung Fibrosis Helen Garthwaite Respiratory Registrar/ Clinical Research Fellow Lung Fibrosis/Interstitial Lung Disease Disease that affects the tissue that supports the lungs alveoli

More information

Triple kinase inhibitor with phosphodiesterase-5 inhibitor for idiopathic pulmonary fibrosis

Triple kinase inhibitor with phosphodiesterase-5 inhibitor for idiopathic pulmonary fibrosis Editorial Triple kinase inhibitor with phosphodiesterase-5 inhibitor for idiopathic pulmonary fibrosis Tomoo Kishaba Department of Respiratory Medicine, Okinawa Chubu Hospital, Uruma City, Okinawa, Japan

More information

Targeted Therapeutics for Inflammatory Disease Jefferies Healthcare Conference

Targeted Therapeutics for Inflammatory Disease Jefferies Healthcare Conference Targeted Therapeutics for Inflammatory Disease 2016 Jefferies Healthcare Conference Forward Looking Statements / Safe Harbor This presentation and the accompanying oral commentary contain forward-looking

More information

Targeted Therapeutics for Inflammatory Disease

Targeted Therapeutics for Inflammatory Disease Targeted Therapeutics for Inflammatory Disease Jefferies Global Healthcare Conference June 2015 Forward Looking Statements / Safe Harbor This presentation and the accompanying oral commentary contain forward-looking

More information

Pioneering Precision Cardiovascular Medicine. (NASDAQ: MYOK) Corporate Presentation March 2018

Pioneering Precision Cardiovascular Medicine. (NASDAQ: MYOK) Corporate Presentation March 2018 Pioneering Precision Cardiovascular Medicine (NASDAQ: MYOK) Corporate Presentation March 2018 Forward-Looking Statements Statements we make in this presentation may include statements which are not historical

More information

AGM Presentation For the year to 30 September February 2016

AGM Presentation For the year to 30 September February 2016 AGM Presentation For the year to 30 September 2015 25 February 2016 11 Forward Looking Statements This presentation includes forward-looking statements. These forward-looking statements involve known and

More information

C.S. HAWORTH 1, A. WANNER 2, J. FROEHLICH 3, T. O'NEAL 3, A. DAVIS 4, I. GONDA 3, A. O'DONNELL 5

C.S. HAWORTH 1, A. WANNER 2, J. FROEHLICH 3, T. O'NEAL 3, A. DAVIS 4, I. GONDA 3, A. O'DONNELL 5 Inhaled Liposomal Ciprofloxacin in Patients With Non-Cystic Fibrosis Bronchiectasis and Chronic Pseudomonas aeruginosa: Results From Two Parallel Phase III Trials (ORBIT-3 and -4) C.S. HAWORTH 1, A. WANNER

More information

Company Overview. September 2018 NASDAQ: MDGL

Company Overview. September 2018 NASDAQ: MDGL Company Overview September 2018 NASDAQ: MDGL 1 Forward Looking Statements Any statements, other than statements of historical facts, made in this presentation regarding our future financial or business

More information

Translating New Immune Pathways into Meaningful Medicines

Translating New Immune Pathways into Meaningful Medicines Translating New Immune Pathways into Meaningful Medicines Cantor Fitzgerald 2018 Global Healthcare Conference Sanjay S. Shukla, M.D., M.S., President & CEO October 2, 2018 Forward-Looking Statements The

More information

Aerie Pharmaceuticals, Inc. Additional Rhopressa Rocket 1 Analyses and Path Forward

Aerie Pharmaceuticals, Inc. Additional Rhopressa Rocket 1 Analyses and Path Forward Aerie Pharmaceuticals, Inc. Additional Rhopressa Rocket 1 Analyses and Path Forward May 7, 2015 1 Important Information Any discussion of the potential use or expected success of our product candidates

More information

Madrigal s MGL-3196 Achieves Liver Biopsy Endpoints in Patients with Non-alcoholic Steatohepatitis (NASH) at 36 Weeks in Phase 2 Clinical Trial

Madrigal s MGL-3196 Achieves Liver Biopsy Endpoints in Patients with Non-alcoholic Steatohepatitis (NASH) at 36 Weeks in Phase 2 Clinical Trial Madrigal s MGL-3196 Achieves Liver Biopsy Endpoints in Patients with Non-alcoholic Steatohepatitis (NASH) at 36 Weeks in Phase 2 Clinical Trial -- Statistically significantly more patients treated with

More information

Making Hope A Reality December 10, Nasdaq : BLUE

Making Hope A Reality December 10, Nasdaq : BLUE Making Hope A Reality December 10, 2014 Nasdaq : BLUE Forward Looking Statement These slides and the accompanying oral presentation contain forward-looking statements and information. The use of words

More information

Sponsor / Company: Sanofi Drug substance(s): SAR (iniparib)

Sponsor / Company: Sanofi Drug substance(s): SAR (iniparib) These results are supplied for informational purposes only. Prescribing decisions should be made based on the approved package insert in the country of prescription. Sponsor / Company: Sanofi Drug substance(s):

More information

Catabasis Pharmaceuticals Q May 2018

Catabasis Pharmaceuticals Q May 2018 Catabasis Pharmaceuticals Q1 2018 May 2018 Forward Looking Statements This presentation contains forward-looking statements within the meaning of The Private Securities Litigation Reform Act of 1995, including

More information