Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced
|
|
- Maximillian Allen
- 5 years ago
- Views:
Transcription
1 Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced colitis implicating regulation of energy metabolism Xu-Guang Jiang 1,2,, Kai Sun 1,3,4,5,, Yu-Ying Liu 1,4,5, Li Yan 1,4,5, Ming-Xia Wang 1,4,5, Jing-Yu Fan 1,4,5, Hong-Na Mu 1,4,5, Chong Li 1,4,5, Yuan-Yuan Chen 1,4,5, Chuan-She Wang 1,3,4,5, Jing-Yan Han 1,3,4,5, 1. Tasly Microcirculation Research Center, Peking University Health Science Center, Beijing, China 2. Shandong college of Traditional Chinese Medicine, Yantai, Shandong, China 3. Department of Integration of Chinese and Western Medicine, School of Basic Medical Sciences, Peking University, Beijing, China 4. Key Laboratory of Microcirculation, State Administration of Traditional Chinese Medicine, Beijing , China 5. Key Laboratory of Stasis and Phlegm of State Administration of Traditional Chinese Medicine, Beijing , China Co-first author of this paper and contribute equally
2 Colonic weight index Colon length Colonic injury score Supplement Figure 1 Sham ASIV TNBS 1D TNBS 4D TNBS 4D+ASIV 5 TNBS 4D+ASIV 10 TNBS 7D TNBS 7D+ASIV 5 TNBS 7D+ASIV 10 A B Sham ASIV TNBS 1D 0 C TNBS 4D TNBS 4D +ASIV 5 TNBS 4D +ASIV D TNBS 7D TNBS 7D +ASIV 5 TNBS 7D +ASIV
3 MPO-positive cells /5 fields CD68-positive cells/5 fields Supplement Figure 2 A a1 a2 a3 a4 a5 b1 b2 b3 b4 b5 c1 c2 c3 c4 c5 Sham ASIV TNBS 1D TNBS 7D TNBS 7D+ASIV B C Sham ASIV TNBS 1D TNBS 7D TNBS 7D+ASIV 0 0
4 Ki-67-positive cells /field E-Cadherin/GAPDH (Fold change over Sham) Supplement Figure 3 A a1 a2 a3 a4 a5 b1 b2 b3 b4 b5 Sham ASIV TNBS 1D TNBS 7D TNBS 7D+ASIV B 4 0 Sham ASIV TNBS 1D TNBS 7D TNBS 7D+ASIV C E-Cadherin GAPDH kd 37 kd
5 Supplement Figure 4 95 kd Lgr 5 (95 kd) 35 kd GAPDH (37 kd)
6 Supplement Figure 5 Fig. 5A Fig. 5B 100 kd total β-catenin (92 kd) 100 kd nuclear β-catenin (92 kd) 35 kd GAPDH (37 kd) 15 kd histone H3 (17 kd)
7 Supplement Figure 6 70 kd 55 kd ATP synthase subunit beta (55 kd) 35 kd GAPDH (37 kd)
8 Supplement Figure kd 130 kd E-Cadherin (135 kd) 95 kd 35 kd GAPDH (37 kd)
9 Supplement figure legend Supplement Figure 1. ASIV reduces TNBS-induced colitis in rats in a dose- and timedependent manner. (A) Representative image of colon in different groups. (B) Macroscopic injury score. (C) Colon length. (D) Colon weight index. Sham: sham group; ASIV: ASIV (10 mg/kg) alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 4D: TNBS treatment for 1 days followed by saline treatment for 3 days group; TNBS 4D+ASIV 5: TNBS treatment for 1 day followed by ASIV (5 mg/kg) treatment for 3 days group; TNBS 4D+ASIV 10: TNBS treatment for 1 day followed by ASIV (10 mg/kg) treatment for 3 days group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV 5: TNBS treatment for 1 day followed by ASIV (5 mg/kg) treatment for 6 days group; TNBS 7D+ASIV 10: TNBS treatment for 1 day followed by ASIV (10 mg/kg) treatment for 6 days group. Data are mean ± SEM (N=8). p < 0.05 vs. Sham group, p < 0.05 vs. TNBS 7D group. Supplement Figure 2. ASIV suppresses inflammatory cell infiltration in TNBS-induced colitis in rats. (A) Representative images of immunohistochemistry of the tissues from different groups with double staining for MPO (brown) and CD68 (red) (a1-a5). Bar = 100 μm. The area within the rectangle in each picture is enlarged and presented below, correspondingly, to display the mucosa (b1-b5) and submucosa (c1-c5) in each group. Bar = 10 μm. (B) Quantification analysis of MPO-positive cells in different groups. (C) Quantification analysis of CD68-positive cells in different groups. Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group. Data are mean ± SEM (N=8). p < 0.05 vs. Sham group, p < 0.05 vs. TNBS 7D group. Supplement Figure 3. ASIV promotes epithelial cell regeneration in TNBS-induced colitis in rats. (A) Representative images of immunohistochemistry staining for Ki67 (brown) of colonic tissues from different groups (a1-a5). Bar = 100 μm. The area within
10 the rectangle in each picture is enlarged and presented below correspondingly (b1-b5). Bar = 50 μm. (B) Quantification analysis of Ki67-positive cells in different groups (N=8). (C) Representative Western blots and statistical analysis of E-Cadherin in colon tissues from different groups (N=5). Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group. Data are mean ± SEM. p < 0.05 vs. Sham group, p < 0.05 vs. TNBS 7D group. Supplement Figure 4. Source data for Figure 4C. Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group. Supplement Figure 5. Source data for Figure 5A and B. Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group. Supplement Figure 6. Source data for Figure 8D. Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group. Supplement Figure 7. Source data for supplement Figure 3C. Sham: sham group; ASIV: ASIV alone group; TNBS 1D: TNBS treatment for 1 day group; TNBS 7D: TNBS treatment for 1 days followed by saline treatment for 6 days group; TNBS 7D+ASIV: TNBS treatment for 1 day followed by ASIV treatment for 6 days group.
TRPM8 in the negative regulation of TNFα expression during cold stress
in the negative regulation of TNFα expression during cold stress Xin-Pei Wang 1, Xuan Yu 1, Xiao-Jin Yan 1, Fan Lei 2, Yu-Shuang Chai 1, Jing-Fei Jiang 1, Zhi- Yi Yuan 1, Dong-Ming Xing 1, Li-Jun Du 1*
More informationAmniotic fluid stem cells provide considerable advantages in epidermal. regeneration: B7H4 creates a moderate inflammation
Amniotic fluid stem cells provide considerable advantages in epidermal regeneration: B7H4 creates a moderate inflammation microenvironment to promote wound repair Qing Sun 1, +, Fang Li 1, +, Hong Li 2,
More informationDisrupting GluA2-GAPDH Interaction Affects Axon and Dendrite Development
Disrupting GluA2-GAPDH Interaction Affects Axon and Dendrite Development 1 Frankie Hang Fung Lee, 1 Ping Su, 1 Yu Feng Xie, 1 Kyle Ethan Wang, 2 Qi Wan and 1,3 Fang Liu 1 Campbell Research Institute, Centre
More informationResearches on Fermentation Engineering of Polysaccharide of
13 1 Vol13 No1 1 2009 2 Life Science Research Feb 2009 1a 1b, 2, 1 416000 2 416000 3 410300 : (Cordyceps militaris), :, 6% 1% 25, ; 6% 1% 22, : ; ; ; ; ; : TQ92 : A : 1007-7847(2009)01-0065-06 Researches
More informationSupplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence
Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β
More informationSupplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation
Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,
More informationGenome-wide association study of esophageal squamous cell carcinoma in Chinese subjects identifies susceptibility loci at PLCE1 and C20orf54
CORRECTION NOTICE Nat. Genet. 42, 759 763 (2010); published online 22 August 2010; corrected online 27 August 2014 Genome-wide association study of esophageal squamous cell carcinoma in Chinese subjects
More informationAn epithelial-to-mesenchymal transition-inducing potential of. granulocyte macrophage colony-stimulating factor in colon. cancer
An epithelial-to-mesenchymal transition-inducing potential of granulocyte macrophage colony-stimulating factor in colon cancer Yaqiong Chen, Zhi Zhao, Yu Chen, Zhonglin Lv, Xin Ding, Renxi Wang, He Xiao,
More informationMechanical Stress-Dependent Autophagy Components Release via Extracellular
Supporting Information for Mechanical Stress-Dependent Autophagy Components Release via Extracellular Nanovesicles in Tumor Cells Kaizhe Wang,, Yuhui Wei,, Wenjing Liu,, Lin Liu,, Zhen Guo,, Chunhai Fan,,
More informationSupplemental Materials. STK16 regulates actin dynamics to control Golgi organization and cell cycle
Supplemental Materials STK16 regulates actin dynamics to control Golgi organization and cell cycle Juanjuan Liu 1,2,3, Xingxing Yang 1,3, Binhua Li 1, Junjun Wang 1,2, Wenchao Wang 1, Jing Liu 1, Qingsong
More informationSupporting Information
Supporting Information Natural small molecule FMHM inhibits lipopolysaccharide-induced inflammatory response by promoting TRAF6 degradation via K48-linked polyubiquitination Ke-Wu Zeng 1, Li-Xi Liao 1,
More informationSupplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons
Supplementary Figure 1 ETBF activate Stat3 in B6 and Min mice colons a pstat3 controls Pos Neg ETBF 1 2 3 4 b pstat1 pstat2 pstat3 pstat4 pstat5 pstat6 Actin Figure Legend: (a) ETBF induce predominantly
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationSupplemental Information
Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin
More informationThe subcortical maternal complex controls symmetric division of mouse zygotes by
The subcortical maternal complex controls symmetric division of mouse zygotes by regulating F-actin dynamics Xing-Jiang Yu 1,2, Zhaohong Yi 1, Zheng Gao 1,2, Dan-dan Qin 1,2, Yanhua Zhai 1, Xue Chen 1,
More informationAdenosine A1 receptors mediate local anti-nociceptive effects of acupuncture
Adenosine A1 receptors mediate local anti-nociceptive effects of acupuncture Nanna Goldman *, Michael Chen *, Takumi Fujita *, Qiwu Xu, Weiguo Peng, Wei Liu, Tina K. Jensen, Yong Pei, Fushun Wang, Xiaoning
More informationYu Ping Feng San reverses cisplatin-induced multi-drug resistance in lung cancer cells via regulating drug transporters and p62/traf6 signaling
Yu Ping Feng San reverses cisplatin-induced multi-drug resistance in lung cancer cells via regulating drug transporters and p/traf signaling Jian-shu Lou,,LuYan, Cathy W. C. Bi,, Gallant K.L. Chan,Qi-YunWu,
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationCanqiu Yu 1, Jinwei Chen 2, Li Huang 3*
A STUDY ON THE ANTITUMOUR EFFECT OF TOTAL FLAVONOIDS FROM PTERIS MULTIFIDA POIR IN H22 TUMOUR-BEARING MICE 459 Canqiu Yu 1, Jinwei Chen 2, Li Huang 3* 1 Department of General Surgery, The Second Xiangya
More informationLi et al. Journal of Experimental & Clinical Cancer Research (2018) 37:108
Li et al. Journal of Experimental & Clinical Cancer Research (2018) 37:108 https://doi.org/10.1186/s13046-018-0774-7 CORRECTION Correction to: Novel smac mimetic APG- 1387 elicits ovarian cancer cell killing
More informationSupplementary Information
Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1
More informationTrehalose, sucrose and raffinose are novel activators of autophagy in human. keratinocytes through an mtor-independent pathway
Title page Trehalose, sucrose and raffinose are novel activators of autophagy in human keratinocytes through an mtor-independent pathway Xu Chen 1*, Min Li 1*, Li Li 1, Song Xu 1, Dan Huang 1, Mei Ju 1,
More informationPKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65
SUPPLEMENTARY INFORMATION TITLE: PKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65 RUNNING TITLE: PKCζ-NFκB Signaling in Breast Cancer
More informationSupplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.
Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50
More informationSupplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
More informationEphrin receptor A2 is an epithelial cell receptor for Epstein Barr virus entry
SUPPLEMENTARY INFORMATION Letters https://doi.org/10.1038/s41564-017-0080-8 In the format provided by the authors and unedited. Ephrin receptor A2 is an epithelial cell receptor for Epstein Barr virus
More informationProtein tyrosine phosphatase 1B targets PITX1/p120RasGAP. thus showing therapeutic potential in colorectal carcinoma
Protein tyrosine phosphatase 1B targets PITX1/p120RasGAP thus showing therapeutic potential in colorectal carcinoma Hao-Wei Teng, Man-Hsin Hung, Li-Ju Chen, Mao-Ju Chang, Feng-Shu Hsieh, Ming-Hsien Tsai,
More information(A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939 (5 µm)
Supplementary Figure Legends Figure S1. Tankyrase inhibition suppresses cell proliferation in an axin/β-catenin independent manner. (A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939
More informationCorrelation between estrogen receptor β expression and the curative effect of endocrine therapy in breast cancer patients
1568 Correlation between estrogen receptor β expression and the curative effect of endocrine therapy in breast cancer patients LIYING GUO 1, YU ZHANG 2, WEI ZHANG 3 and DILIMINA YILAMU 1 1 Department of
More informationSupplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times.
Supplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times. Western blots shown are representative results from 3 independent
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationNature Medicine: doi: /nm.4324
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Supplementary Figure 1. Kinetics of SnCs development in surgically-induced OA and effect of GCV-induced SnC clearance on OA disease progression
More informationInfluence of Starch-inorganic Salt Surface Sizing on the Application Properties of Corrugating Medium
- 266042-8 2 6 g /m 2 76. 3% 80. 0% 82. 5% 74. 7% 72. 6% 80. 9% 13. 1% 14. 3% 15. 6% Cobb 140 g /m 2 30 g /m 2 TS727 +. 5 A 0254-508X 2013 04-0022-05 Influence of Starch-inorganic Salt Surface Sizing on
More informationSupplementary Figure 1. Electroporation of a stable form of β-catenin causes masses protruding into the IV ventricle. HH12 chicken embryos were
Supplementary Figure 1. Electroporation of a stable form of β-catenin causes masses protruding into the IV ventricle. HH12 chicken embryos were electroporated with β- Catenin S33Y in PiggyBac expression
More informationRapid Detection of Milk Protein based on Proteolysis Catalyzed by Trypsinase
Rapid Detection of Milk Protein based on Proteolysis Catalyzed by Trypsinase Yafeng Chen Institute of Food Quality and Safety, University of Shanghai for Science and Technology Shanghai 93, China Email:cyfxy498@6.com
More informationSupporting Information: Enhanced Therapeutic Effects of MSC-derived Exosomes with an Injectable Hydrogel for Hindlimb Ischemia Treatment
Supporting Information: Enhanced Therapeutic Effects of MSC-derived Exosomes with an Injectable Hydrogel for Hindlimb Ischemia Treatment Kaiyue Zhang 1,2, Xiangnan Zhao 1, Xiaoniao Chen 3, Yongzhen Wei
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationUniversity of Miami Miller School of Medicine, Miami, FL 33136, USA, 3 State Key Laboratory
Supplementary File ASXL1 plays an important role in erythropoiesis Hui Shi 1,2,3, Shohei Yamamoto 1,2,4, Mengyao Sheng 3, Jie Bai 3, Peng Zhang 1,2, Runze Chen 1,2, Shi Chen 1,2, Lihong Shi 3, Omar Abdel-Wahab
More informationSocial deficits in Shank3-deficient mouse models of autism are rescued by histone deacetylase (HDAC) inhibition
SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41593-018-0110-8 In the format provided by the authors and unedited. Social deficits in Shank3-deficient mouse models of autism are rescued by
More informationSupplementary Table 1. Characterization of HNSCC PDX models established at MSKCC
Supplementary Table 1. Characterization of HNSCC PDX models established at MSKCC Supplementary Table 2. Drug content and loading efficiency estimated with F-NMR and UV- Vis Supplementary Table 3. Complete
More informationSupplemental information Acid-sensing ion channel 1a contributes to hippocampal LTP inducibility through multiple mechanisms
Supplemental information Acid-sensing ion channel 1a contributes to hippocampal LTP inducibility through multiple mechanisms Ming-Gang Liu, Hu-Song Li, Wei-Guang Li, Yan-Jiao Wu, Shi-Ning Deng, Chen Huang,
More informationExcessive fatty acid oxidation induces muscle atrophy in cancer cachexia
SUPPLEMENTARY INFORMATION Excessive fatty acid oxidation induces muscle atrophy in cancer cachexia Tomoya Fukawa, Benjamin Chua Yan-Jiang, Jason Chua Min-Wen, Elwin Tan Jun-Hao, Dan Huang, Chao-Nan Qian,
More informationWelcome Message. We look forward to seeing you in Nanjing in Welcome to Nanjing! Sincerely yours,
Welcome Message On behalf of the organising committee, it gives us immense pleasure to invite you to participate in the 6th ISMAAR World Congress on Mild Approaches in Assisted Reproduction, which will
More informationsupplementary information
DOI: 10.1038/ncb2133 Figure S1 Actomyosin organisation in human squamous cell carcinoma. (a) Three examples of actomyosin organisation around the edges of squamous cell carcinoma biopsies are shown. Myosin
More informationPKMζ maintains memories by regulating GluR2- dependent AMPA receptor trafficking
Supplementary information PKMζ maintains memories by regulating GluR2- dependent AMPA receptor trafficking Paola Virginia Migues, Oliver Hardt, Dong Chuan Wu, Karine Gamache, Todd Charlton Sacktor, Yu
More informationSupporting Information
Copyright WILEY-VCH Verlag GmbH & Co. KGaA, 69469 Weinheim, Germany, 212. Supporting Information for Adv. Funct. Mater., DOI:.2/adfm.2122233 MnO Nanocrystals: A Platform for Integration of MRI and Genuine
More informationSupplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
More informationSingle-cell RNA-Seq profiling of human pre-implantation embryos and embryonic stem cells
Single-cell RNA-Seq profiling of human pre-implantation embryos and embryonic stem cells Liying Yan,2,5, Mingyu Yang,5, Hongshan Guo, Lu Yang, Jun Wu, Rong Li,2, Ping Liu, Ying Lian, Xiaoying Zheng, Jie
More informationBile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response. Supplementary Results
Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response Shi-Ying Cai 1, Xinshou Ouyang 1, Yonglin Chen 1, Carol J. Soroka 1, Juxian Wang 2, Albert Mennone 1,
More informationCORRELATION BETWEEN SURVIVIN OVEREXPRESSION AND CLINICO-PATHOLOGICAL FEATURES OF INVASIVE CERVICAL CANCER: A META-ANALYSIS
Acta Medica Mediterranea, 2018, 34: 1091 CORRELATION BETWEEN SURVIVIN OVEREXPRESSION AND CLINICO-PATHOLOGICAL FEATURES OF INVASIVE CERVICAL CANCER: A META-ANALYSIS HUI-RONG LI 1, JI-LI BAI 2*, RUI XU 2,
More informationm 6 A mrna methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer
SUPPLEMENTARY INFORMATION Articles https://doi.org/10.1038/s41556-018-0174-4 In the format provided by the authors and unedited. m 6 A mrna methylation regulates AKT activity to promote the proliferation
More informationProtein-Mediated Anti-Adhesion Surface against Oral Bacteria
Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 2018 Supporting Information Protein-Mediated Anti-Adhesion Surface against Oral Bacteria Xi Liu a,b,
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationExpanded View Figures
Shao-Ming Shen et al Role of I in MT of cancers MO reports xpanded View igures igure V1. nalysis of the expression of I isoforms in cancer cells and their interaction with PTN. RT PR detection of Ish and
More informationEpstein-Barr virus driven promoter hypermethylated genes in gastric cancer
RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES Epstein-Barr virus driven promoter hypermethylated genes in gastric cancer J Yu *, KF To, QY Liang K e y M e s s a g e s 1. Somatostatin receptor 1
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 DOT1L regulates the expression of epithelial and mesenchymal markers. (a) The expression levels and cellular localizations of EMT markers were confirmed by
More informationSupplementary Table 1 Clinicopathological characteristics of 35 patients with CRCs
Supplementary Table Clinicopathological characteristics of 35 patients with CRCs Characteristics Type-A CRC Type-B CRC P value Sex Male / Female 9 / / 8.5 Age (years) Median (range) 6. (9 86) 6.5 (9 76).95
More informationSupplemental data Supplemental Figure Legends Supplemental Figure 1. Supplemental Figure 2.
Supplemental data Supplemental Figure Legends Supplemental Figure 1. Analysis of deletion of AMPK!2 in POMC and AgRP neurons in control and POMC!2KO and AgRP!2KO mice. (A) mmunofluorescence analysis for
More informationFormylpeptide receptor2 contributes to colon epithelial homeostasis, inflammation, and tumorigenesis
Supplementary Data Formylpeptide receptor2 contributes to colon epithelial homeostasis, inflammation, and tumorigenesis Keqiang Chen, Mingyong Liu, Ying Liu, Teizo Yoshimura, Wei Shen, Yingying Le, Scott
More informationThe clathrin adaptor Numb regulates intestinal cholesterol. absorption through dynamic interaction with NPC1L1
The clathrin adaptor Numb regulates intestinal cholesterol absorption through dynamic interaction with NPC1L1 Pei-Shan Li 1, Zhen-Yan Fu 1,2, Ying-Yu Zhang 1, Jin-Hui Zhang 1, Chen-Qi Xu 1, Yi-Tong Ma
More informationDiabetes Care Publish Ahead of Print, published online August 19, 2010
Diabetes Care Publish Ahead of Print, published online August 19, 2010 Neck circumference positively related with central obesity, overweight and metabolic syndrome in Chinese people with type 2 diabetes:
More informationEMPEROR'S COLLEGE MTOM COURSE SYLLABUS HERB FORMULAE II
COURSE DESCRIPTION The second of three courses in the Herb Formulae series. Categories covered in Formulae II include the Tonify Qi and Blood, Regulate Qi, Invigorate the Blood, Stop Bleeding, Stabilize
More informationAcupuncture Boosts Breast Milk Production
Acupuncture Boosts Breast Milk Production Published by HealthCMi on July 2017 Acupuncture restores normal breast milk production to lactating mothers with low milk secretion levels. Research conducted
More informationSupplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells
Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Immunofluorescence staining of H3K9me3 and 53BP1 in PH and HGADFN003 (HG003) cells at 24 h after γ-irradiation. Scale bar,
More informationSupplementary Material
Supplementary Material Fig. S1. Gpa33 -/- mice do not express Gpa33 mrna or GPA33 protein. (A) The Gpa33 null allele contains a premature translational stop codon (STOP) in exon 2, and almost all of the
More informationThe progressing research of traditional Chinese medicine treatment of. insomnia. Liu Jing1 a
4th International Conference on Education, Management and Computing Technology (ICEMCT 2017) The progressing research of traditional Chinese medicine treatment of insomnia Liu Jing1 a 1 Shandong University
More informationAccepted Manuscript. Unexpected high incidence of hepatocellular carcinoma in patients with hepatitis C in the era of DAAs: too alarming?
Accepted Manuscript Unexpected high incidence of hepatocellular carcinoma in patients with hepatitis C in the era of DAAs: too alarming? Qing-Lei Zeng, Zhi-Qin Li, Hong-Xia Liang, Guang-Hua Xu, Chun-Xia
More informationCURRICULUM VITAE. Professional Employment and Teaching Experience:
CURRICULUM VITAE Name: Current Address: Hong Chen American Academy of Acupuncture and Oriental Medicine 1925 West County Road B2 Roseville, MN 55113 Tel: (651) 631-0204 Fax: (651) 631-0361 E-mail: hongyu1229@hotmail.com
More informationAppropriate Quality regarde as
A systematic review of antibiotic prescription associated with upper respiratory tract infections in China (Jing Li, MS 1 ) Supplemental Digital Content-Table 1. Quality assessment of included studies
More informationCancer incidence and patient survival rates among the residents in the Pudong New Area of Shanghai between 2002 and 2006
Chinese Journal of Cancer Original Article Cancer incidence and patient survival rates among the residents in the Pudong New Area of Shanghai between 2002 and 2006 Xiao-Pan Li 1, Guang-Wen Cao 2, Qiao
More informationRapid parallel measurements of macroautophagy and mitophagy in
Supplemental Figures Rapid parallel measurements of macroautophagy and mitophagy in mammalian cells using a single fluorescent biosensor Sargsyan A, Cai J, Fandino LB, Labasky ME, Forostyan T, Colosimo
More informationSupplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous
Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous LRP5 in intact adult mouse ventricular myocytes (AMVMs)
More informationSupplementary information CD4 T cells are required for both development and maintenance of disease in a new model of reversible colitis
Supplementary information CD4 T cells are required for both development and maintenance of disease in a new model of reversible colitis rasseit and Steiner et al. .. Supplementary Figure 1 % of initial
More informationOncolytic Adenovirus Complexes Coated with Lipids and Calcium Phosphate for Cancer Gene Therapy
Oncolytic Adenovirus Complexes Coated with Lipids and Calcium Phosphate for Cancer Gene Therapy Jianhua Chen, Pei Gao, Sujing Yuan, Rongxin Li, Aimin Ni, Liang Chu, Li Ding, Ying Sun, Xin-Yuan Liu, Yourong
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/275/ra34/dc1 Supplementary Materials for An Increase in Synaptic NMDA Receptors in the Insular Cortex Contributes to Neuropathic Pain Shuang Qiu, Tao Chen, Kohei
More informationAVINASH CHANDRA, MD. September 16 th, Business Address: Buffalo Neuroimaging Analysis Center
AVINASH CHANDRA, MD September 16 th, 2014 Title: MRI Fellow Business Address: Buffalo Neuroimaging Analysis Center 100 High Street; Buffalo, NY 14203 Work: 716 859 7040 Email: achandra@bnac.net Education
More informationBeijing , China. 4 Department of Surgery, Third Affiliated Hospital of Peking University, Beijing , China. *Corresponding author:
Title:Eplerenone restores -h blood pressure circadian rhythm and reduces advanced glycation end-products in rhesus macaques with spontaneous hypertensive metabolic syndrome Yan Zhang,,Wen Zheng,, Yuli
More information290 Biomed Environ Sci, 2016; 29(4):
290 Biomed Environ Sci, 2016; 29(4): 290-294 Letter to the Editor Prevalence and Predictors of Hypertension in the Labor Force Population in China: Results from a Cross-sectional Survey in Xinjiang Uygur
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationEngineering of Ministry of Education, Institute of Molecular Science, Shanxi University, Taiyuan , China.
Indicator approach to develop a chemosensor for the colorimetric sensing of thiol-containing in water and its application for the thiol detection in plasma Fang-Jun Huo, a Yu-Tao Yang, b Jing Su, b Yuan-Qiang
More informationTargeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics. For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from
Supplementary Methods: Targeted mass spectrometry (LC/MS/MS) for Olaparib pharmacokinetics For LC/MS/MS of Olaparib pharmacokinetics metabolites were extracted from mouse tumor samples and analyzed as
More informationCYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt
Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,
More informationSupplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function
Supplementary data and figures Thyroid hormone inhibits murine lung fibrosis through improved epithelial mitochondrial function Guoying Yu 1*, Argyris Tzouvelekis 1,2*, Rong Wang 1,3, Jose D. Herazo-Maya
More informationSupporting Information
Supporting Information Cancer Cell Membrane-Biomimetic Nanoprobes with Two-Photon Excitation and Near-Infrared Emission for Intravital Tumor Fluorescence Imaging Yanlin Lv 1,2,, Ming Liu 3,4,, Yong Zhang
More informationOrganochloride pesticides impaired mitochondrial function in hepatocytes and. aggravated disorders of fatty acids metabolism
Supplementary Materials Organochloride pesticides impaired mitochondrial function in hepatocytes and aggravated disorders of fatty acids metabolism Qian Liu 1,2,3*, Qihan Wang 4*, Cheng Xu 2,3, Wentao
More informationAvian Influenza A(H7N9) 13 February 2014 Surveillance Update
Avian Influenza A(H7N9) 13 February 2014 Surveillance Update Summary The WHO has reported 337 human infections including 66 deaths with onset since February 2013. There are still no signs of ongoing, efficient,
More informationHypertension Regulated By Acupuncture Finding
Hypertension Regulated By Acupuncture Finding Published by HealthCMi on November 2017 Heilongjiang Woniutuzhen Hospital researchers find acupuncture effective for the treatment of essential hypertension.
More information(A) [DOI] /j.issn
Med J Chin PLA, Vol. 41, No. 3, March 1, 2016 175 [ ] 30 SD 5 (A) (B) (C) (D) (E) 0.206 0.514 1.028mg/(kg d) ELISA HE Masson (TGF- ) 9(MMP-9) C D E A B (P
More informationSupplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis (a) Immunohistochemical (IHC) analysis of tyrosine 705 phosphorylation status of STAT3 (P- STAT3) in tumors and stroma (all-time
More informationSUPPLEMENTARY FIG. S5. ROS regulated the signaling responses of A. gambiae 4a3B cells to human insulin. (A) 4a3B cells were stimulated with 6000
Supplementary Data SUPPLEMENTARY FIG. S1. Exogenous H 2 O 2 induced rapid activation of ERK in Anopheles stephensi cells. ASE cells were treated with PBS or with 500 mmh 2 O 2 for 5, 30, 60, and 180 min.
More informationSantulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function
ONLINE DATA SUPPLEMENTS Santulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function Supplementary Figures Figure S1 Effect of Ad-p27-126TS on the expression
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/1/9/e1500781/dc1 Supplementary Materials for pnaktide inhibits Na/K-ATPase reactive oxygen species amplification and attenuates adipogenesis Komal Sodhi, Kyle Maxwell,
More informationImpact factor: Reporter:4A1H0019 Chen Zi Hao 4A1H0023 Huang Wan ting 4A1H0039 Sue Yi Zhu 4A1H0070 Lin Guan cheng 4A1H0077 Chen Bo xuan
Curcumin Protects Neonatal Rat Cardiomyocytes against High Glucose-Induced Apoptosis via PI3K/Akt Signalling Pathway Wei Yu,1,2 Wenliang Zha,1 Zhiqiang Ke,1 Qing Min,2 Cairong Li,1 Huirong Sun,3 and Chao
More informationNOD2 Activation promotes anti-inflammatory activity of human Umbilical cord blood MSCs against Inflammatory bowel disease
NOD2 Activation promotes anti-inflammatory activity of human Umbilical cord blood MSCs against Inflammatory bowel disease Prof. Kyung-Sun Kang, DVM, PhD. Adult Stem Cell Research Center Seoul National
More informationDownregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral
Supplementary Information Downregulation of angiotensin type 1 receptor and nuclear factor-κb by sirtuin 1 contributes to renoprotection in unilateral ureteral obstruction Shao-Yu Yang 1,2, Shuei-Liong
More informationGene expression was analyzed by real time PCR (SYBR GREEN PCR Master. Mix, Roche Applied Science) using specific oligonucleotides.
1 SUPPLEMENTAL MATERIAL SUPPLEMENT METHODS Real Time PCR. Gene expression was analyzed by real time PCR (SYBR GREEN PCR Master Mix, Roche Applied Science) using specific oligonucleotides. Rat ST2L forward
More informationEffects of Soil Copper Concentration on Growth, Development and Yield Formation of Rice (Oryza sativa)
Rice Science, 05, 12(2): 125-132 125 http://www.ricescience.org Effects of Soil Copper Concentration on Growth, Development and Yield Formation of Rice (Oryza sativa) XU Jia-kuan 1, 2, YANG Lian-xin 1,
More informationHigh expression level of T-box transcription factor 5 predicts unfavorable survival in stage I and II gastric adenocarcinoma
ONCOLOGY LETTERS 10: 2021-2026, 2015 High expression level of T-box transcription factor 5 predicts unfavorable survival in stage I and II gastric adenocarcinoma YAN ZHENG 1,2*, YUAN FANG LI 1*, WEI WANG
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More information