Flu information pack 2015/16: guidance
|
|
- Liliana Armstrong
- 6 years ago
- Views:
Transcription
1 Introduction Forthe2015/16winterinfluenza(flu)season,theDepartmentofHealth(DH)hasadvisedthatthe following strains are likely to circulate and should be included in the trivalent seasonal influenza (northern hemisphere winter) vaccine, based on the World Health Organization (WHO) recommendation: AnA/California/7/2009(H1N1)pdm09likevirus AnA/Switzerland/ /2013(H3N2)likevirus AB/Phuket/3073/2013likevirus AnyquadrivalentvaccineswhichincludetwoinfluenzaBvirusesshould containtheabovethreevirusesandab/brisbane/60/2008likevirus. Targetgroups Forthe2015/16fluseason,thefollowingpatientgroupsareeligibleforfluvaccinationunderthe NHSthroughthecommunitypharmacyseasonalinfluenzavaccinationAdvancedService(England): 1) Thoseaged65yearsorover,includingthosereaching65yearsofageby31March2016 2) Those aged 18 years and over to under 65 years with one or more serious medical condition(s) a. For example, chronic respiratory disease, chronic heart disease, chronic kidney disease at stage three, four or five, chronic liver disease, chronic neurological disease,diabetes,weakenedimmunesystemorsplenicdysfunction 3) Allpregnantwomenatanystageofpregnancy 4) Thoseinlongstayresidentialcarehomesorotherlongstaycarefacilities a. Excludesprisons,youngoffenderinstitutions,universityhallsofresidence 5) Carers a. Individualswhoreceiveacarer sallowanceorthosewhoarethemaincarerofan elderlyordisabledindividual 6) Householdcontactsofimmunocompromisedindividuals a. Anyone living in close contact with immunocompromised individuals during most daysoverthewinterperiodshouldbeconsideredforvaccination Forthe2015/16fluseason,thefollowingpatientgroupsarealsoeligibleforfluvaccinationunder thenhsthroughotheravenuessuchasgpsurgeriesand/orlocallycommissionedservices: All two, three and four year olds (not five years or older) on 31 August 2015 through GP surgeries Allchildreninschoolyearsoneandtwothroughalocallycommissionedservice Primary schoolaged children in areas that were part of the primary schools pilot in the 2014/15influenzaseason Thoseagedsixmonthstounder65yearswithoneormoreseriousmedicalcondition(s) Theabovelistisnotexhaustive.Healthprofessionalsshouldapplytheirclinicaljudgementtodecide whetherapatientneedstohavethefluvaccine,takingintoaccounttheriskoffluexacerbatingany underlyingdiseaseandtheriskofillnessfromflu,andreferthepatienttoanappropriateservice provider. For further information about the flu plan please refer to the DH letter and Flu plan: Winter2015to2016.
2 Children(eligibilitythroughGPsurgeriesand/orlocallycommissionedservices) In July 2012, the JCVI issued a statement that recommended extending the flu vaccination programmetochildrenagedbetweentwoyearstolessthan17years;thisprocesswasrolledout gradually. In2015/16,alltwo,threeandfouryearoldswillcontinuetobeeligibleforfluvaccinationthrough GPsurgeries,andvaccinationwillcontinuetobeofferedtothosechildrenwhoparticipatedinthe primaryschoolpilotsin2014/15.inaddition,the2015/16seasonwillseetherolloutextendedto childreninschoolyearsoneandtwo,throughlocallycommissionedschemes. Forthe2015/16influenzaseason,therearetwotypesofvaccinesavailableforchildrenuptothe ageof17;aliveattenuatednasalvaccine(fluenztetra)andtheinactivatedinfluenzavaccine.for further information on the suitability of these vaccines for specific age ranges in children, please referto Whichfluvaccineshouldchildrenhave? publishedbypublichealthengland. Pregnancyandbreastfeeding Pregnancy Thefollowingshouldbeconsideredforfluvaccinationinpregnancy: Allpregnantwomenarerecommendedtoreceivetheinactivatedfluvaccineregardlessof whichtrimestertheyarein;pregnancyincreasestheriskofcomplicationsfromflu Ideally,fluvaccinationshouldbeofferedtopregnantwomenbeforeflustartscirculating Womenwhobecomepregnantduringthefluseasonshouldstillbeofferedthevaccine Fluduringpregnancycanleadtoprematurebirthandsmallerbirthsizeandweight Fluvaccinationduringpregnancymayprovidebabieswithpassiveimmunitytofluduring theirfirstfewmonthsoflife Inactivated flu vaccine can be administered safely and effectively during any trimester of pregnancy FluenzTetraintranasalvaccine thereislimiteddataontheuseofthisvaccineinpregnant women;therefore,itsuseisnotrecommendedduringpregnancy Intanza suspension for injection 15mcg/strain the vaccine is licensed for use in people aged60yearsandover,sothespccontainsnoinformationonitsuseduringpregnancy Breastfeeding The Summaries of Product Characteristics (SPCs) for all of the UK licensed flu vaccines for the 2015/16seasonstatetheyaresuitableforuseduringbreastfeeding,withtheexceptionof: FluenzTetra thisshouldnotbeusedduringbreastfeeding Intanza suspension for injection 15mcg/strain the vaccine is licensed for use in people aged60yearsandover,sothespccontainsnoinformationonitsuseduringbreastfeeding Vaccineadministration Beforeafluvaccineisadministered,thevaccinatorshouldmakesurethat: Thepatienthasnocontraindicationstothevaccine Thepatientisprovidedwithallappropriateinformationaboutthevaccinetogiveinformed consent
3 Thepatientfullyunderstandsthevaccinationprocedure Thepatientisinformedofanypossibleadversereactionsandhowtomanagethem Skin that looks dirty is washed with soap and water; clean skin does not require further cleaning InformationonvaccineadministrationcanbefoundintherelevantSPCsandin TheGreenBook: immunisationagainstinfectiousdisease:chapter19influenza and TheGreenBook:immunisation againstinfectiousdisease:chapter4immunisationprocedures Vaccination techniques overview (IMPORTANT: This is NOT a substitute for proper vaccination traininginstructionfromaqualifiedprovider itisyourpersonalandprofessionalresponsibilityto ensurethatyouhavetheappropriatetrainingtobeabletoadministerthefluvaccinescompetently) Intramuscular (IM) Deep subcutaneous (SC) Intranasal route(using FluenzTetra) Ininfants,childrenandadults,a25mm23G(blue)or25mm25G(orange) needleshouldbeused Inpretermorverysmallinfantsa16mmneedleissuitableforIMinjection Largeradultsmayrequirealongerlengthneedle,forexample,a38mmneedle Injectionsshouldbeadministeredwiththeneedleata90degreeangletothe skinandtheskinshouldbestretched,notbunched Injectionsshouldpreferablybeadministeredintothedeltoidmuscleofthe upperarminolderchildrenandadults;theanterolateralthighininfantsunder oneyearofage Useofa25mmneedlecanreduceanylocalvaccinereactogenicity Injectionsshouldbeadministeredwiththeneedleata45degreeangletothe skinandtheskinshouldbebunched,notstretched Injectionsshouldpreferablybeadministeredintothedeltoidsiteinolder childrenandadultsortheanterolateralthighininfantsundertheageofone year VaccinesthatarenormallyadministeredbytheIMrouteshouldonlybegiven bydeepscinjectiontoindividualswithableedingdisorder,inordertoreduce theriskofbleeding FluenzTetranasalspraysuspensionisaliveattenuatedfluvaccineandisonly licensedtobeadministeredbynasaladministration itdeliversa0.1mldose intoeachnostril Administrationdoesnotneedtoberepeatedifthepatientsneezesorblows theirnosefollowingadministration ItisnotknownwhetherFluenzTetrawillbeeffectiveifgiventoachildwitha heavilyblockedorrunnynose;insuchcasesitmaybeappropriatetopostpone administrationuntilthenasalcongestionisresolved,oradministeranim vaccineinstead Intradermal Injectionsshouldonlybeadministeredusinga26G,10mm(brown)needle Ifconsiderableresistanceisfeltandaraised,blanchedblebshowingthetipsof thehairfolliclesisapparent,thisindicatesthattheinjectionhasbeencorrectly administered Ifnoresistanceisfelt,theneedleshouldberemovedandreinsertedbefore furthervaccineisgiven
4 Fluvaccinecontraindications Fluvaccineshouldnotbegivento: Thosewhohavehadaconfirmedanaphylacticreactiontoapreviousdoseofthefluvaccine Thosewhohavehadaconfirmedanaphylacticreactiontoanycomponentofthefluvaccine (exceptovalbumin seesectionon Patientswithaneggallergy ) FurtherinformationonspecificfluvaccinecontraindicationscanbefoundintherelevantSPCs. Precautions Apersonwhoisunwellmayhavetheirfluvaccinationpostponeduntiltheyarefullyrecovered,to avoidconfusionbetweensymptomsoftheillnessandanysideeffectsofthevaccine.thereisno needtopostponetheadministrationofafluvaccinetopatientswithaminorillnessthatpresents withoutfeverorsystemicdisturbance. Adversedrugreactions FollowingadministrationoftheinactivatedfluvaccineviatheIMorintradermalroutethepatient mayexperience: Pain,swellingorrednessatthesiteofinjection Mildflulike symptoms such as headache, low grade fever, shivering, fatigue or myalgia; thesesymptomsusuallydisappearwithinonetotwodayswithouttreatment Followingadministrationoftheliveintranasalfluvaccine,thepatientmayexperience: Nasalcongestion,rhinorrhoea,lossofappetite,weaknessandheadache(common) Urticaria,bronchospasm,angiooedemaandanaphylaxis(immediately) Patients and healthcare professionals are advised to report serious adverse reactions using The YellowCardSchemeandinparticularthosevaccinesthathaveablacktrianglesymbol()suchas FluenzTetranasalspraysuspensionandFluarixTetrasuspensionforinjectioninprefilledsyringe. Black Triangle drugs are recently licensed and monitored intensively by the Medicines and HealthcareproductsRegulatoryAgency(MHRA). Doseinformation Information on vaccine dosage and schedules can be found in The Green Book: immunisation againstinfectiousdisease:chapter19:influenza andtherelevantspcs. TheJCVIhasadvisedondifferentdosageschedulesoffluvaccineforchildren;thiscandependon: Ageofthechild Clinicalindications Typeoffluvaccineoffered Previousadministrationofafluvaccine TheJCVIadvice,in TheGreenBook:immunisationagainstinfectiousdisease:Chapter19:Influenza, maydifferfromsomeofthespcs.
5 Administrationofothervaccines Thefollowingshouldbeconsideredwhenadministeringothervaccines: Inactivatedfluvaccinescanbegivenatthesametimeasothervaccines Live attenuated vaccines can also be given at the same time as other live or inactivated vaccines JCVIhasadvisedthatnospecificintervalsneedtobeobservedbetweenadministrationof theliveattenuatedintranasalfluvaccineandotherlivevaccines IMandintradermalinjectionvaccinesshouldbegivenatseparatesitesandpreferablyina different limb;if they are given in the same limb they should be administeredat least 2.5cmapart Vaccinestorage Vaccines should be stored as recommended in their SPC, in the original packagingbetween2cand8candprotectedfromlight Whenstoredintherefrigerator,vaccinesmustbestoredwithspacearoundthemsothatair cancirculate;theyshouldnotbeplacedtooclosetothesideorbackwallsoftherefrigerator becausethismayresultinthevaccinesfreezingmakingthemunusable Thecoldchainmustbemaintainedandmonitoreduntilthetimethevaccineisadministered tothepatient The pharmaceutical refrigerator they are stored in must be regularly serviced and maintainedandundergocalibrationandelectricaltestingsothatitisfitforpurpose Ifvaccinesneedtobetransported,avalidatedmedicalgradecoolboxorcoolpackmustbe usedandthetemperaturemustbemonitoredregularly Further information on vaccine storage can be found in The Green Book: immunisation against infectiousdisease:chapter3:storage,distributionanddisposalofvaccines Wastedisposalandspillages Expired stock and any equipment used during the vaccination process, including any empty vials, syringesandneedles,shouldbedisposedofcorrectlyintheappropriatesharpscontaineraccording tolocalauthorityregulationsandtheguidanceinthe HealthTechnicalMemorandum0701:Safe managementofhealthcarewaste bythedepartmentofhealth. Thesharpscontainershouldbesealedandreplacedonceitistwothirdsfull,oronce thecontentshavereachedthelevelindicatedonthecontainerbythemanufacturer. The container should not be accessible to unauthorised individuals and should be disposedofinaccordancewithlocalcontractualprocedures. Anyspillagesofvaccinesshouldbeclearedupquicklyusingpapertowelsandwearinggloves;local written procedures should be followed, together with the Control of Substances Hazardous to Health(COSHH)safetydatasheetssuppliedbythevaccinemanufacturers. Furtherinformationondealingwithspillagesandwastedisposalcanbefoundin TheGreenBook: immunisationagainstinfectiousdisease:chapter3:storage,distributionanddisposalofvaccines
6 Vaccineexcipients Eggallergy Aninactivatedfluvaccinewithanovalbumin contentoflessthan0.12mcg/ml (i.e.containinglessthan0.06mcgper0.5mldose)canbegiventopatientswith eggallergy Patientsovertheageof18yearswitheggallergycanusetheovalbuminfreeflu vaccine,optaflususpensionforinjection,inprefilledsyringe ChildrenwithaneggallergycanbesafelyadministeredwithFluenzTetrainany setting;unlesstheyhavesevereanaphylaxistoeggthathaspreviouslyrequired intensivecare Children for whom Fluenz Tetra is contraindicated should be offered an inactivated flu vaccine with a low ovalbumin content of less than 0.12mcg/ml (<0.6mcg/0.5ml) All patients (adults and children) with severe anaphylaxis to egg should be referredtospecialistsforimmunisationinhospital DetailsoftheovalbumincontentoffluvaccinesavailableintheUKforthe2015/16 fl useasoncanbefoundin Influenzavaccines:2015to2016fluseason, TheGreen Book:immunisationagainstinfectious disease:chapter19influenza and thenpa Pharmacy Services factsheet Flu information pack : vaccine information andtherelevantspcs. Antibiotics Mostoftheinfluenzavaccinesfor2015/16containtracesofcertainantibiotics andcautionmustbeexercisedinpatientswithhypersensitivitytoanyofthese All flu vaccines are contraindicated in patients who have had a confirmed anaphylacticreactiontotheseantibiotics Further information can be found in the NPA Pharmacy Services factsheet Flu informationpack201516:vaccineinformation andtherelevantspcs. Latex An individual should not be offered a flu vaccine that is supplied in a vial or syringethatcontainslatexiftheyhaveasevereallergytolatex Mostoftheinfluenzavaccinesarelatexfreebutthefollowingvaccinesmaynot besuitableforpatientswithalatexallergy: o FluarixTetrasuspensionforinjectioninprefilledsyringehaslatexpresentin thetipcapoftheprefilledsyringe o Agrippalsuspensionforinjectioninprefilledsyringehasnolatexpresentin thesyringecap;however,thesafeuseofagrippalsuspensionforinjectionin patients who are sensitive to latex has not been established, so the manufacturer, Novartis Vaccines Ltd, is unable to recommend its use in patientswhoaresensitivetolatex Further information on individual vaccines can be found in the NPA Pharmacy Services factsheet Flu information pack : vaccine information and the relevantspcs. Thiomersal Thiomersalisamercurybasedcompoundandcertainvaccinesusethiomersalas apreservativeduringmanufacturing
7 Gelatine None of the influenza vaccines for 2015/16 contain thiomersal as an added preservative. Further information can be found in the NPA Pharmacy Services factsheet Flu informationpack201516:vaccineinformation UKlicensedfluvaccinesforthe2015/16seasonareallfreefromgelatine,withthe exceptionoffluenztetrawhichcontainshydrolysedgelatinederivedfrompork(the gelatine is highly purified and is used to stabilise the live vaccine). Further informationcanbefoundinthenpapharmacyservicesfactsheet Fluinformation pack201516:vaccineinformation andtherelevantspcs. Since Fluenz Tetra nasal spray contains gelatine derived from pork, patients from certainfaithgroupsmayhaveconcernsaboutthisvaccine ssuitability. Jewish IndividualsfromtheJewishcommunitymayfindthefollowingstatement,byRabbi AbrahamAdleroftheKashrusandMedicinesInformationService,helpfulindeciding whether to have the vaccine or not: It should be noted that according to Jewish laws,thereisnoproblemwithporcineorotheranimalderivedingredientsinnon oral products. This includes vaccines, including those administered via the nose, injections,suppositories,creamsandointments. Patientswhoareunsurewhethertohavethevaccineornotarerecommendedto consultwiththeirlocalrabbiforfurtheradviceorguidance. Muslim TheBritishMuslimCouncilhasbeenconsultedbyPublicHealthEngland(PHE)over this matter. Some individuals in the Muslim community consider that porcine gelatineisforbidden;however,theymaybeabletoacceptmedicinalproductswhich containgelatinewhenthereisnosuitablealternativeandtheproductislifesaving. ThereisnootherlivefluvaccineavailableinEuropethatdoesnotcontainporcine gelatine. PHE and the DH have recommended that for vaccination of healthy children,thereisnosuitablealternativetofluenztetranasalspraysuspension.only children in clinical risk groups, who cannot receive Fluenz Tetra nasal spray suspension,shouldreceivetheinjectableinactivatedvaccine. PHE strongly recommend that children receive the live vaccine Fluenz Tetra nasal spray suspension to give them the best protection against flu and to reduce the spread of flu to more vulnerable people, for example, young infants, pregnant womenandthosewithunderlyingmedicalconditions. Patientswhoareunsurewhethertohavethevaccineornot,arerecommendedto consultwiththeirlocalimamforfurtheradviceorguidance.
8 NPAseasonalfluvaccinationprivatePatientGroupDirectionservice TheNPAprovidesaseasonalfluvaccinationprivatePatientGroupDirection(PGD)serviceaswellas fullandrefreshervaccinationtraining. Thefullvaccinationtrainingprogrammecovers: VaccinationtechniquesforadministeringalltypesofvaccinesincludingIM,intranasal,and SCrouteofadministeringvaccines Basiclifesupportandanaphylaxismanagement PLUSonline(distancelearning)trainingmodulesforthefollowing: 1) Influenza 2) Basiclifesupportandanaphylaxismanagement 3) Vaccinationtechniques Members interested in providing a private PGD service and/or vaccination training can obtain furtherinformationfromthepharmacyservicesteamby: Telephone: consultandtreat@npa.co.uk Professionalindemnityforvaccinationservices NPAprofessionalindemnityinsurancecoversmemberstoprovidePGDservice(privateand/orNHS) whichmayincludevaccinationservices,bothfromtheregisteredpharmacypremisesaswellasfrom offsite providedthatallthepgdandservicerequirementsarefulfilledcorrectly. Itremainsthepersonalandprofessionalresponsibilityofthepharmacist,inallcases,toensurethat theyaretrained,confidentandcompetenttoofferthefluvaccinationservice(nhsand/orprivate) includingmanagementofanaphylaxisandresuscitationtechniques;thepharmacistmustdecidefor themselveswhethertheyshouldundergothefullvaccinationtrainingortheonlinerefresher. NPAresourcestosupportyourfluvaccinationservice(NHSand/orprivate) Fluinformationpack2015/16:vaccineinformation Fluinformationpack2015/16:vaccineorderingandavailability Fluinformationpack2015/16:pharmacystaffguide Chaperonepolicy DealingwithneedlestickinjuriesandbiohazardspillagesSOP HandhygieneSOP VaccinecoldchainSOP TemplatefluserviceSOPtosupportthedeliveryoftheNHSNationalFluVaccination AdvancedServiceforcommunitypharmacists(comingsoon) TheseresourcesareaccessibletodownloadfromtheNPAwebsite:
9 References Contraindicationsandspecialconsiderations:TheGreenBook,Chapter6: considerationsthegreenbookchapter6 DepartmentofHealth(2013)HealthTechnicalMemorandum07 01:Safemanagementof healthcarewaste: healthcarewaste Fluplan:winter2015to2016: GreenBook Immunisationagainstinfectiousdisease: Immunisationprocedures:TheGreenBook,Chapter4: chapter4 Influenzavaccines:2015to2016flu: Influenzavaccineandporcinegelatine: guidanceforhealthprofessionals JCVIstatement: routineannualinfluenzavaccinationprogramme Nationalfluprogrammetrainingslidesetforhealthcareprofessionals: forhealthcareprofessionals NHSpublichealthfunctionsagreement2015to2016: to2016 Protocolforordering,storingandhandlingvaccines: vaccines Storage,distributionanddisposalofvaccines:TheGreenBook,Chapter3: vaccinesthegreenbookchapter3 SummaryofProductCharacteristics: Thenationalfluimmunisationprogramme2015/16: WorldHealthOrganization Influenza: Disclaimer:Theinformationpublishedis,tothebestofourknowledge,correctatthetimeof publication.however,noresponsibilitywillbeacceptedforanyconsequencesofdecisionsmade usingthisinformation.
Factsheet for healthcare practitioners
Influenza immunisation programme 2017/18 Factsheet for healthcare practitioners Morbidity and mortality due to influenza can cause winter pressures within the healthcare system and major harm to individuals,
More informationInfluenza immunisation programme 2018/19
Influenza immunisation programme 2018/19 Factsheet for healthcare practitioners Morbidity and mortality due to influenza can cause winter pressures within the healthcare system and major harm to individuals,
More informationChildhood influenza vaccination programme
Childhood influenza vaccination programme 2016-17 Questions and Answers Background In 2012 the Joint Committee on Vaccination and Immunisation (JCVI) recommended that the seasonal influenza (flu) programme
More informationThis resource does not cover the actual administration techniques involved in vaccinating with any other flu vaccine.
Background Following a recommendation in 2012 by the Joint Committee on Vaccination and Immunisation (JCVI) 1 that the seasonal flu programme should be extended to all children aged 2 to less than 17 years
More informationClinical Condition Indication:
GG&C PGD ref no: 2016/1366 YOU MUST BE AUTHORISED BY NAME, UNDER THE CURRENT VERSION OF THIS PGD BEFORE YOU ATTEMPT TO WORK ACCORDING TO IT Clinical Condition Indication: Active immunisation against disease
More informationBackground Rationale for resource
Background The Joint Committee on Vaccination and Immunisation 1 reviewed all the available medical, epidemiological and economic evidence as well as vaccine safety and efficacy relevant to offering a
More informationPre-administration checklist for Fluenz Tetra nasal spray vaccine
Pre-administration checklist for Fluenz Tetra nasal spray vaccine This medicinal product is subject to additional monitoring. This will allow quick identification of new safety information. Healthcare
More informationPatient Group Direction For The Administration Of H1N1 (Swine Flu) vaccine
n Patient Group Direction For The Administration Of H1N1 (Swine Flu) vaccine October 2009 PGD version template-2009.1 Page 1 of 8 Rationale Patient Group Direction For The Administration Of H1N1 (Swine
More informationExtension of the seasonal flu vaccination programme to children: Phase /15
Extension of the seasonal flu vaccination programme to children: Phase 2-2014/15 Administration of the intranasal flu vaccine by Healthcare Support Workers (Level 3 and 4 on NHS Career Framework) to children
More informationBackground Rationale for resource
Slide 1 Background The Joint Committee on Vaccination and Immunisation 1 reviewed all the available medical, epidemiological and economic evidence as well as vaccine safety and efficacy relevant to offering
More informationWe ll be our own lifesavers. We ll get the flu vaccine.
We ll be our own lifesavers. We ll get the flu vaccine. The flu vaccine is a lifesaver for older people and those with long-term health conditions. www.immunisation.ie Flu Vaccine 2017-18 What is seasonal
More informationFlu vaccination service All you need to know to make a success of the new service. Alastair Buxton Leyla Hannbeck Fin Mc Caul
Flu vaccination service All you need to know to make a success of the new service Alastair Buxton Leyla Hannbeck Fin Mc Caul Objectives: Understand exactly how the service will work and how to make your
More informationflu vaccination DRAFT The WINTER 2018/19 Who should have it and why Includes information for children and pregnant women mmunisation
flu vaccination Who should have it and why The WINTER 2018/19 Includes information for children and pregnant women The flu vaccination 1 Winter 2018/19 Flu mmunisation Helping to protect everyone, every
More informationFAQ s for parents. Why is my child being offered the flu vaccine?
FAQ s for parents Who is being offered the flu vaccine? This year all healthy children aged 2 years to 13 years old in Leicester, Leicestershire and Rutland will be offered a vaccination against flu. Children
More informationflu vaccination The Who should have it and why WINTER 2017/18 Includes information for children and pregnant women mmunisation in England in 2017/18
flu WINTER 2017/18 The vaccination Who should have it and why Includes information for children and pregnant women Flu mmunisation in England in 2017/18 The flu vaccination 1 Winter 2017/18 Helping to
More informationWELSH HEALTH CIRCULAR
WELSH HEALTH CIRCULAR WHC (2018) 015 Issue Date: 5 April 2018 STATUS: ACTION CATEGORY: PUBLIC HEALTH Title: Ordering adjuvanted flu vaccine for the 2018-19 season Date of Expiry / Review N/A For Action
More informationHELP PREVENT THE FLU WITH FLUMIST QUADRIVALENT
HELP PREVENT THE FLU WITH FLUMIST QUADRIVALENT THE NEEDLE-FREE INTRANASAL QUADRIVALENT FLU VACCINE Inf luenza Vaccine Live, Attenuated, Intranasal TABLE OF CONTENTS 2 What is FluMist Quadrivalent? 3 How
More informationIT S A LIFESAVER EVERY YEAR FLU CAUSES SEVERE ILLNESS AND DEATH. GET YOUR FLU VACCINE NOW. IF YOU ARE: worker
FLU VACCINE Information FOR Health care workers EVERY YEAR FLU CAUSES SEVERE ILLNESS AND DEATH. IF YOU ARE: A health care worker Over 65 Have a longterm illness Pregnant GET YOUR FLU VACCINE NOW. IT S
More informationInfluenza Vaccine Questions and Answers. Influenza Control Program
Influenza Vaccine Questions and Answers Influenza Control Program Influenza or the flu can be a serious contagious disease, which is spread by droplet transmission through close contact with an infected
More informationI M VACCINATING FOR TWO NOW. IT S A LIFESAVER. Pregnant women and their babies are at risk from flu. Protect you and your baby - get your flu vaccine.
I M VACCINATING FOR TWO NOW. Pregnant women and their babies are at risk from flu. Protect you and your baby - get your flu vaccine. IT S A LIFESAVER www.im munisation.ie For more information, talk to
More informationFlu Immunisation Programme 2017/18 Northern Ireland
Flu Immunisation Programme 2017/18 Northern Ireland Learning outcomes understand how flu is transmitted and the possible effects of flu understand the evidence base for the administration of flu vaccination
More informationBerkshire School Aged Immunisation Team Seasonal Influenza 2018/19
Dear Parent/ Carer Re: Seasonal Influenza Vaccinations (flu) for children from Reception to year 5 This autumn the school immunisation team will be returning to your child s school to offer the seasonal
More informationInfluenza Vaccinations: Procedure for the Ordering and Administration at Hospitals and Hostels within SHFT
SH CP 117 Influenza Vaccinations: Procedure for the Ordering and Administration at Hospitals and Hostels within SHFT Summary: Ordering and Administration of Influenza Vaccinations at Hospitals and Hostels
More informationWe ll be our lifesaver. We ll get the flu vaccine.
We ll be our lifesaver. We ll get the flu vaccine. The flu vaccine is a lifesaver for healthcare workers and the people they care for. www.immunisation.ie Flu Vaccine 2017-18 Healthcare workers prevent
More informationNational Immunisation Programme changes Michael Baker. Wessex Public Health England Centre
National Immunisation Programme changes 2013-14 Michael Baker Wessex Public Health England Centre Changes to the Meningococcal serogroup C conjugate (MenC) vaccine schedule in 2013 2 Immunisation Programme
More informationImmunization with Influenza Vaccine (Inf)
Immunization with Influenza Vaccine (Inf) Background Influenza is a respiratory infection caused by either the type A or type B influenza viruses, and occurs in populations worldwide. Although it is generally
More informationDocument Details. Patient Group Direction
Document Details Title Patient Group Direction (PGD) Hepatitis B Vaccine (Engerix ) Trust Ref No 1505-41182 Local Ref (optional) Main points the Immunisation against Hepatitis B document covers Who is
More informationSerum Institute of India Ltd. The Nasal-Spray Flu Vaccine (Live Attenuated Influenza Vaccine [LAIV])
Nasovac The Nasal-Spray Flu Vaccine (Live Attenuated Influenza Vaccine [LAIV]) Questions & Answers Who can be vaccinated with the nasal-spray flu vaccine LAIV (Nasovac )? LAIV (Nasovac ) is approved for
More informationA FLU SHOT CREATED DIFFERENTLY.
Indication and Usage for FLUCELVAX (Influenza Vaccine) A FLU SHOT CREATED DIFFERENTLY. FLUCELVAX (Influenza Vaccine) rethinking flu protection. FLUCELVAX was the first FDA-approved influenza vaccine made
More informationFlu Buddy Training. For Pharmacy Well-Being Champions. September
Flu Buddy Training For Pharmacy Well-Being Champions September 2018 Objectives of the session To have a better understanding of flu (influenza) As a Flu Buddy - act as an advocate of the seasonal influenza
More informationWe ll be our lifesaver. We ll get the flu vaccine.
We ll be our lifesaver. We ll get the flu vaccine. www.hse.ie/flu Flu Vaccine 2018-19 Healthcare workers prevent the spread of flu and save lives every year by getting vaccinated with the flu vaccine.
More informationProtecting your child against flu
Protecting your child against flu Information for the parents of children aged from 2 to 13 (year 8 at school) Flu mmunisation 2014/15 Helping to protect everyone, every winter This year, the flu vaccine
More informationFLU VACCINE INFORMATION The FLU JAB
FLU VACCINE INFORMATION 2018 In the UK the flu vaccine is available each year from late September or early October onwards. It is recommended to get the flu vaccine in the autumn, before outbreaks of flu
More informationExtension of the seasonal flu vaccination programme to children: Phase /15
Extension of the seasonal flu vaccination programme to children: Phase 2-2014/15 Administration of the intranasal flu vaccine by Healthcare Support Workers (Level 3 and 4 on NHS Career Framework) to *
More informationVaccinating Adults: A Step-by-Step Guide
Vaccinating Adults: A Step-by-Step Guide step ₁ : getting started The Basics 1 6 Why the emphasis on adult vaccination? 3 How do I determine which vaccines adults need? 5 The Guide does not discuss vaccines
More informationSwine flu - information prescription
Swine flu - information prescription Introduction Swine flu is a relatively new strain of influenza (flu) that was responsible for a flu pandemic during 2009-2010. It is sometimes known as H1N1 influenza
More informationProtecting your child against flu
Protecting your child against flu Information for parents Flu immunisation in England Flu mmunisation Helping to protect everyone, every winter Flu vaccine is offered free each year to most: children aged
More informationPATIENT GROUP DIRECTION (PGD) Infants, children and adolescents aged 2 17 years
Publications Gateway Reference 00366 PATIENT GROUP DIRECTION (PGD) Administration of Fluenz nasal spray suspension (influenza vaccine, live) Infants, children and adolescents aged 2 17 years For the supply
More informationDirection Number: - NECSAT 2016/015
Patient Group Direction (PGD) for the Administration of INFLUENZA (Seasonal Flu) Vaccines by Registered Professionals to Individuals Accessing NHS Services in Durham, Darlington, Tees, Cumbria, Northumberland
More informationInfluenza (flu) Infection Prevention and Control. What is influenza? What are the symptoms of influenza? What causes influenza?
What is influenza? Influenza (also known as flu) is a respiratory illness which is caused by the influenza virus. For most people influenza is just a nasty experience, but for some it can lead to illnesses
More informationInfluenza: Questions and Answers
Influenza: Questions and Answers Information about the disease and vaccines What causes influenza? Viruses cause influenza. There are two basic types, A and B. Their genetic material differentiates them.
More informationInfluenza. The disease. Influenza
19 The disease is an acute viral infection of the respiratory tract. There are three types of influenza virus: A, B and C. A and influenza B are responsible for most clinical illness. is highly infectious
More informationCLINICAL COMMISSIONING GROUP PRIMARY CARE COMMITTEE EXECUTIVE SUMMARY
Primary Care Committee Agenda Item 7.1 CLINICAL COMMISSIONING GROUP PRIMARY CARE COMMITTEE EXECUTIVE SUMMARY SHEET DATE: 4 th July 2017 TITLE OF PAPER: Influenza Vaccination 2016-17 EXECUTIVE Chris Morris
More informationGG&C PGD ref no: 2018/1603 YOU MUST BE AUTHORISED BY NAME, UNDER THE CURRENT VERSION OF THIS PGD BEFORE YOU ATTEMPT TO WORK ACCORDING TO IT
GG&C PGD ref no: 2018/1603 YOU MUST BE AUTHORISED BY NAME, UNDER THE CURRENT VERSION OF THIS PGD BEFORE YOU ATTEMPT TO WORK ACCORDING TO IT Clinical Condition Indication: Inclusion criteria: Active immunisation
More informationUpdated: 26 August 2010
Australian Technical Advisory Group on Immunisation (ATAGI) Updated advice on the use of pandemic and seasonal influenza vaccines in children
More informationProtecting your child against flu
Protecting your child against flu Information for parents Flu mmunisation 2015/16 Helping to protect everyone, every winter This year, the flu vaccine is being offered to: children aged two, three and
More informationPackage leaflet: Information for the user. Fluenz Tetra nasal spray suspension Influenza vaccine (live attenuated, nasal)
Package leaflet: Information for the user Fluenz Tetra nasal spray suspension Influenza vaccine (live attenuated, nasal) This medicine is subject to additional monitoring. This will allow quick identification
More informationContents. H1N1 09 swine influenza vaccine roll out. Who is eligible for the funded vaccine?
Contents Contents... 1 H1N1 09 swine influenza vaccine roll out... 1 Who is eligible for the funded vaccine?... 1 The vaccine - Panvax... 2 What to do in general practice... 2 Consent to vaccination...
More informationREVISION OF THE PCOREROPOSAL FOR A HARMONISED SPC FOR TRIVALENT INFLUENZA VACCINES
Co-ordination Group for Mutual Recognition and Decentralised Procedures - Human REVISION OF THE PCOREROPOSAL FOR A HARMONISED SPC FOR TRIVALENT INFLUENZA VACCINES October 2003 Revision 12, DecemberJune
More informationEnhanced service specification Childhood seasonal influenza vaccination programme NHS England gateway reference: 01641
Enhanced service specification Childhood seasonal influenza vaccination programme NHS England gateway reference: 01641 Introduction 1. All GMS practices are expected to provide essential and those additional
More informationThis is a purified, inactivated, split virion (split virus) vaccine each 0.5 ml of which contains antigens representative of the following types:
Fluvax WARNING: This season s vaccine is indicated for use only in persons aged 5 years and over. It must not be used in children under 5 years (see Contraindications). It should only be used in children
More informationWhat You Need to Know About the Flu
Wednesday, August 0, 017 BLUE P FISH E D I A T R I C S www.bluefishmd.com CYPRESS EDITION Biannual Newsletter In This Issue Find Out: Who should receive the flu vaccine? Who should NOT receive the flu
More informationINFLUENZA 2009 H1N1. INACTIVATED (the flu shot ) W H A T Y O U N E E D T O K N O W. 1 What is 2009 H1N1 influenza? H1N1 influenza vaccine
2009 H1N1 INFLUENZA INACTIVATED (the flu shot ) VACCINE W H A T Y O U N E E D T O K N O W Many Vaccine Information Statements are available in Spanish and other languages. See http://www.immunize.org/vis.
More informationTEMPORARY PROGRAMME PERTUSSIS VACCINATION FOR PREGNANT WOMEN
TEMPORARY PROGRAMME PERTUSSIS VACCINATION FOR PREGNANT WOMEN Richard Smithson Neil Irvine Maureen McCartney Consultant Health Protection October 2012 Pertussis/whooping cough The disease Whooping Cough
More informationSCIMP Guidance for Seasonal Influenza Vaccination Programme. Version 1.0 October Types of vaccine.. p2. 2. Groups requiring vaccination..
SCIMP Guidance for Seasonal Influenza Vaccination Programme Version 1.0 October 2011 Click on the heading below to go to the relevant place in the document 1. Types of vaccine.. p2 2. Groups requiring
More informationIn February 2015, the Joint Committee on Vaccination and Immunisation (JCVI) *
Background In 2015, Public Health England (PHE) reported a continued increase in meningococcal serogroup W cases in England. The rise was initially recorded in 2009 and since this time, cases have steadily
More informationBackground Rationale of resource Please note:
Background In 2010, the Joint Committee on Vaccination and Immunisation (JCVI) convened a meningococcal subcommittee to conduct a comprehensive and detailed assessment of the evidence on the meningococcal
More informationVaccine Administration An Evidence Based Approach
Vaccine Administration An Evidence Based Approach Ms Margaret Geoghegan Practice Nurse, Cavan 11th May 2016 Objectives Preparation of vaccines Injection technique Correct needle length True contraindications
More informationSeasonal influenza vaccination programme country profile: United Kingdom Northern Ireland
Seasonal influenza vaccination programme country profile: United Kingdom Northern Ireland 2012 13 Season Background information Influenza immunisation policy and general facts about the United Kingdom
More informationSAMPLE. PGD reviewed by: Dr Tim Patterson, Chris Faldon, John Maloney, Adrian Mackenzie
Patient Group Direction for the Supply or Administration of combined Diphtheria, Tetanus, acellular Pertussis, inactivated Polio vaccine and Haemophilus type b conjugate Vaccine (Infanrix-IPV-HIB) to children
More informationFlu. Flu is a killer. Flu vaccination
Flu Flu is a killer Flu vaccination 2015-16 Why is flu serious? Flu spreads easily and can cause serious illnesses which need to be treated in hospital. There are outbreaks every year, usually in winter.
More informationWhat You Need to Know About the Flu
Thursday, August 16, 018 BLUE P FISH E D I A T R I C S www.bluefishmd.com SIENNA PLANTATION EDITION Biannual Newsletter In This Issue Find Out: Who should receive the flu vaccine? Who should NOT receive
More informationMost people confuse influenza with a heavy cold; however influenza is usually a more severe illness than the common cold.
What is influenza? Influenza (also known as flu) is a respiratory illness which is caused by the influenza virus. For most people influenza is just a nasty experience, but for some it can lead to illnesses
More informationPANDEMIC (H1N1) 2009 VACCINATION INFORMATION & GUIDELINES
PANDEMIC (H1N1) 2009 VACCINATION INFORMATION & GUIDELINES September 2009 Contents Pandemic (H1N1) 2009 (swine influenza) Vaccination Program... 3 The vaccine Panvax... 3 Who is eligible for Panvax?...
More informationInfluenza Fact Sheet
What is influenza? Influenza, also known as the flu, is caused by a virus that affects the nose, throat, bronchial airways, and lungs. There are two types of flu that affect humans, types A and B. Influenza
More informationSAMPLE. PGD Reviewed by: Chris Faldon, John Maloney, Tim Patterson, Adrian MacKenzie, Claire Stein
Patient Group Direction for the supply or administration of haemophilus influenzae type B and meningococcal conjugate vaccine to children requiring immunisation as part of the national childhood vaccination
More informationPRODUCT INFORMATION INFLUVAC. NAME OF THE MEDICINE Influvac inactivated influenza vaccine (surface antigen)
PRODUCT INFORMATION INFLUVAC NAME OF THE MEDICINE Influvac inactivated influenza vaccine (surface antigen) DESCRIPTION Influvac is a clear colourless suspension for injection. It is an egg-grown, inactivated
More informationWHO PACKAGE INSERT. GlaxoSmithKline Biologicals FluLaval. Dossier First - Chapter 1 to 10 for WHO
77 WHO PACKAGE INSERT 11 Chapter 4_Annex 4.4-1_ WHO leaflet_en - Page 1 78 1. NAME OF THE MEDICINAL PRODUCT, suspension for injection Influenza vaccine (split virion, inactivated) 2. QUALITATIVE AND QUANTITATIVE
More informationSCIMP Guidance for Seasonal Influenza Vaccination Programme. Version 1.1 September 2015
SCIMP Guidance for Seasonal Influenza Vaccination Programme Version 1.1 September 2015 Click on the heading below to go to the relevant place in the document 1. Types of vaccine.. p2 2. Groups requiring
More informationNORTHEAST HOSPITAL CORPORATION
NORTHEAST HOSPITAL CORPORATION Title: Influenza and Pneumococcal Immunization Date Effective: 11/04 Date Revised: 7/08, 2/6/12, 3/15/13; 9/13/13 Date Reviewed: Joint Commission Chapter: Provision of Care,
More informationHow you can help support the Beat Flu campaign
How you can help support the Beat Flu campaign Toolkit www.beatflu.org f T Beat Flu 1 How can you help Beat Flu? Template news story You may wish to use the following news story as a template, which can
More informationWhat s the latest on the staff vaccination programme for swine flu?
H1N1 VACCINATION PROGRAMME Healthcare professional Q&A What s the latest on the staff vaccination programme for swine flu? Scientists have now developed an approved vaccine for the A(H1N1) or Swine Flu
More informationH1N1 and Flu Shots During Pregnancy
H1N1 and Flu Shots During Pregnancy HEALTH EDUCATION HEALTH EDUCATION The H1N1 flu and seasonal vaccines are safe and recommended for pregnant women. Be sure to: Get the H1N1 flu vaccine for yourself and
More informationPRODUCT INFORMATION INFLUVAC. NAME OF THE MEDICINE Influvac inactivated influenza vaccine (surface antigen)
PRODUCT INFORMATION INFLUVAC NAME OF THE MEDICINE Influvac inactivated influenza vaccine (surface antigen) DESCRIPTION Influvac is a clear colourless suspension for injection. It is an egg-grown, inactivated
More informationFAQ S ABOUT MAXWELL HEALTH S WORKPLACE FLU VACCINATION SERVICE
THE DISEASE - INFLUENZA FACTS 2017 Influenza the disease Influenza can be a serious illness with severe effects including hospitalisation, complications and even death. Influenza is not just a 'bad cold'.
More informationFrequently Asked Questions Greater Dayton Area Hospital Association Kettering Health Network
Frequently Asked Questions Greater Dayton Area Hospital Association Kettering Health Network Mandatory Influenza Vaccination Program The Greater Dayton Area Hospital Association (GDAHA) has recommended
More informationInformation to help patients, families and visitors better understand influenza or the flu
Influenza Information to help patients, families and visitors better understand influenza or the flu Read this brochure to learn about: How the flu spreads What UHN does to protect you What you need to
More informationswine flu vaccination:
swine flu vaccination: information for parents of children over six months and under five years old Flu. Protect yourself and others. Contents About this leaflet......................... 3 What is swine
More informationWhat You Need to Know About the Flu
Thursday, August 16, 018 BLUE P FISH E D I A T R I C S www.bluefishmd.com CYPRESS EDITION Biannual Newsletter In This Issue Find Out: Who should receive the flu vaccine? Who should NOT receive the flu
More informationSHETLAND NHS BOARD NEWS RELEASE
SHETLAND NHS BOARD NEWS RELEASE Seasonal flu immunisation The national seasonal flu immunisation campaign started on 1 st October. As in previous years, people in Shetland aged 65 and over, along with
More informationChild flu vaccine: what you need to know. Primary school edition
Child flu vaccine: what you need to know. Primary school 2017 edition The flu vaccine is offered to all primary school children in Scotland at school. It is also offered to younger children aged 2 5 years
More informationSHETLAND NHS BOARD NEWS RELEASE
SHETLAND NHS BOARD NEWS RELEASE 3 October 2016 Seasonal flu immunisation The seasonal flu immunisation campaign starts this week. As in previous years, people in Shetland aged 65 and over, along with pregnant
More information2016/2017 Influenza Season
2016/2017 Influenza Season 1 In healthy adults symptoms of flu can range from classic influenza to mild illness asymptomatic infection 10/9/2013 2 Symptoms Cold Classic Flu Fever Rare Very common Headache
More informationHow do I comply with the Influenza Control Program Policy this year?
Influenza Control Program Frequently Asked Questions Influenza Vaccine Influenza or the flu can be a serious contagious disease, which is spread by droplet transmission through close contact with an infected
More informationAdult Immunization Update 2015
Adult Immunization Update 2015 Objectives Upon completion of this session, the pharmacist should be able to: Compare and contrast previous versions of the ACIP immunization schedules with the most recent
More informationLast year, most children offered the vaccine in schools had the immunisation.
Immunisation Team The Warren Health Centre, Uxbridge Road, Hayes, UB4 0SF Telephone: 01895 485740 Dear Parent/Guardian, Your child s annual flu vaccination is now due This vaccination programme is in place
More informationSeasonal Flu Vaccination
Seasonal Flu Vaccination What You Need to Know to Protect: Your Patients Your Colleagues Your Family Yourself Advice for Healthcare Workers This leaflet is for NHS staff to help them advise patients and
More informationKey facts about influenza vaccine
Key facts about influenza vaccine Dr Wan Noraini Wan Mohamed Noor Head of Surveillance Sector Disease Control Division, MOH Malaysia 4 May 2018 drwnoraini@moh.gov.my The Outline: Introduction: Influenza
More informationCommunity school Influenza like illness In season HPZ : February 2019
rd Public Health England South West T +44 (0)300 303 8162 3 Floor, 2 Rivergate F +44 (0)117 930 0205 Temple Quay, Bristol, BS1 6EH Follaton House, Plymouth Road F: +44 (0)1392 367356 Totnes, Devon TQ9
More informationFlu. is a killer. If you are at risk you should have your free flu vaccination every year.
Flu is a killer. If you are at risk you should have your free flu vaccination every year. What is flu? Flu spreads easily and can cause serious illnesses which need to be treated in hospital. It is not
More informationPatient Group Direction (PGD) for the Administration of Fluenz Nasal Spray Suspension (Influenza Vaccine, Live)
Patient Group Direction (PGD) for the Administration of Fluenz Nasal Spray Suspension (Influenza Vaccine, Live) Note that Fluenz is for nasal administration only This PGD must be read in conjunction with
More informationHEALTHCARE SUPPLIES SPECIALISTS. Product information. amaproducts.com.au HEALTHCARE SUPPLIES SPECIALISTS
HEALTHCARE SUPPLIES SPECIALISTS Product information HEALTHCARE SUPPLIES SPECIALISTS 1300 558 135 1300 558 137 amaproducts.com.au sales@amaproducts.com.au Afluria Quad Inactivated Quadrivalent Influenza
More informationH1N1 Vaccine Medical Directive Training
H1N1 Vaccine Medical Directive Training October 27, 2009 Two Parts Part 1 - The Virus Part 2 - The Vaccine Characteristics of Seasonal vs. ph1n1 Influenza Characteristics Incubation Seasonal Flu mean=2;
More informationSWINE FLU IT STOPS WITH YOU. Getting the Swine Flu vaccine will protect you from Swine Flu and will also stop it spreading to people around you.
SWINE FLU IT STOPS WITH YOU Getting the Swine Flu vaccine will protect you from Swine Flu and will also stop it spreading to people around you. The HSE is working to offer a Swine Flu Vaccine to everyone
More informationADT Booster Product Information
NAME OF THE MEDICINE ADT Booster. Diphtheria and Tetanus Vaccine (adsorbed) for revaccination. DESCRIPTION ADT Booster is a suspension for intramuscular injection, containing aluminium-hydroxide-adsorbed
More informationDocument Details Patient Group Direction Hepatitis A vaccine (Havrix Monodose ) Trust Ref No Local Ref (optional) Main points the
Document Details Title Patient Group Direction Hepatitis A vaccine (Havrix Monodose ) Trust Ref No 1506-41174 Local Ref (optional) Main points the Active immunisation against infection caused by Hepatitis
More informationImmunizations 2014 OVERVIEW. MVNA Immunization Overview. 3. Vaccine Storage and Transport. 4. Vaccine Recommendations and Screening
Immunizations 2014 OVERVIEW compassion ingenuity optimism MVNA Immunization Overview 1. 2014 Vaccines 2. Review MnVFC and UUAV 3. Vaccine Storage and Transport 4. Vaccine Recommendations and Screening
More informationRevised Recommendations for the Use of Influenza Antiviral Drugs
QUESTIONS & ANSWERS Revised Recommendations for the Use of Influenza Antiviral Drugs Background On September 8, 2009 CDC updated its recommendations for the use of influenza antiviral medicines to provide
More informationPACKAGE LEAFLET: INFORMATION FOR THE USER
PACKAGE LEAFLET: INFORMATION FOR THE USER Focetria suspension for injection Pandemic Influenza Vaccine (H1N1) (surface antigen, inactivated, adjuvanted) For the most up-to-date information please consult
More information