Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/-

Size: px
Start display at page:

Download "Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/-"

Transcription

1 Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice. As indicated in Fig 2, A, Supplement, AE1 mrna expression increased in the outer medulla of Slc2a7 -/- mice relative to Slc2a7 -/- mice (P<0.05, n=5). Immunofluorescence labeling (Fig. 2, B, Supplement) and Western blotting (not shown) indicate increased abundance of AE1 protein in OMCD of Slc2a7 -/- ko mice. Figure 2, C demonstrates the reduction in the expression of pendrin mrna in Slc26a7 ko mice relative to wild type littermates. Expression of gastric H-K-ATPase and AE2 in the stomach. Double immunofluorescence labeling was performed on Slc26a7 wt and ko stomachs. Figure 3, A, top column (Supplement) demonstrates the expression of AE2 (left panel) and gastric H-K-ATPase (right panel), with the middle panel depicting the merged image in wild type (Slc26a7 +/+ ) mouse stomach. Figure 3, A, bottom column (Supplement) demonstrate the expression of AE2 (left panel) and gastric H-K-ATPase (right panel), along with the merged image (middle panel) in Slc26a7-null mouse. The results indicated normal abundance and localization of AE2 and H-K ATPase in gastric parietal cells in Slc26a7 -/- mice relative to Slc26a7 +/+ mice. Western blotting of gastric H-K- ATPase on membrane proteins isolated from corpus of the stomach and showed no difference in the abundance of gastric H-K-ATPase in adult Slc26a7 -/- mice (data not shown). This is very distinct from Slc26a9, another member of Slc26 anion transporter family, which is expressed in tubulovesicles of gastric parietal cells and its deletion

2 causes loss of secretory canaliculi, reduction in gastric parietal cells and complete absence of acid secretion (10). Microscopic analysis of stomach and kidney in Slc26a7-null mice. Microscopic analysis of H and E prepared sections showed gastric glands in 6-7 weeks old Slc26a7-/- mutant mouse to be normal (Fig. 4, Top, lower panels, a and b; Supplement) relative to Slc26a7+/+ mouse (Fig. 4, Top, upper panels, a and b; Supplement). Parietal cells (arrow) with their lighter cytoplasm and distinct organization were present at normal numbers in Slc26a7-/- mice (Fig. 4, Supplement). Zymogen cells were similarly normal in Slc26a7 mutant stomach. The cell area and nuclear area of parietal cells from the Slc26a7 +/+ and Slc26a7 +/- were not significantly different. H and E analysis showed normal kidney structures in Slc26a7 ko mice, including proximal tubule, thick limb, distal tubule and collecting ducts (Fig. 4, Bottom) (Supplement). Methods. Histology of stomach and kidney. Several pairs of age-matched littermates were analyzed by light microscopy. Mice were 6-7 weeks old at termination and included male and females. Five µm thick sections were stained with hematoxylin and eosin (H&E), or with periodic-acid Schiff (PAS) and alcian blue (AB) for light microscopy. Morphometric analysis of the glandular and forestomach epithelium was performed as previously described (10). The percentage of cell types in a gastric gland was derived from cell counts of randomly selected but well oriented gastric glands beginning at the base and continuing to

3 the lumen of the stomach. Parietal cells were required to contain a nuclear profile, predominant large and well organized mitochondrial distribution and visible lucent areas of smooth membranes (canaliculi and tubulovesicles). Zymogenic cells were identified as having a profile of nucleus, basophilic cytoplasm (RER), and a minimum of three birefringent granules. Mucus neck cells were dark and small, mucus pit cells were determined by their mucus granules. RNA isolation and Northern blot hybridization. Total cellular RNA was extracted from stomach and cortex and medulla of kidney, according to established methods. Hybridization was performed according to established protocols (38). Kidney bots were examined for the expression of Slc26a7, AE1, pendrin and AQP2. Stomach blots were analyzed for the expression of mrnas encoding gastric H +,K + -ATPase - subunit, AE2, and Slc26a7 using 32 P-labeled cdna probes. The membranes were washed, blotted dry, and exposed to a Phosphorimager screen (Molecular Dynamics, Sunnyvale, CA). The densities of each band were normalized to that of the 18S rrna band (as a loading control). Immunofluorescent labeling in mouse stomach and kidney. Single and double immunofluorescent labeling on frozen sections from stomachs or kidneys was performed as described using AE2, AE1, Slc26a7, or V-ATPase polyclonal or gastric H-K-ATPase (beta subunit) monoclonal antibodies as described (28, 29). Western blotting of gastric H-K- ATPase in the stomach of Slc26a7 +/+ and Slc26a7 -/- mice. The corpus mucosa was dissected with a razor blade, washed, and centrifuged. Protein extracts were prepared as described (10) in the presence of a cocktail of protease inhibitors (Complete; Roche Diagnostics, Mannheim, Germany). Western

4 blotting was performed as before using H-K ATPase antibodies. Measurement of Gastric ph and Acid/Base Equivalents. The ph and acid-base content of gastric secretions of Slc26a7 / and wild-type littermates were measured at days of age as described previously (10, 13). Mice were fasted overnight, euthanized 15 min after subcutaneous injection of histamine (2 µg/g body weight) and the intact stomachs were removed. The gastric contents, which would include both basal and histamine-stimulated acid-base equivalents, were rinsed into 5 ml of oxygen-saturated normal saline solution at room temperature, degassed, pelleted by centrifugation, and the ph and acid-base equivalents were determined by titration with NaOH. Materials- 32 P-dCTP was purchased from New England Nuclear (Boston, MA). Nitrocellulose filters and other chemicals were purchased from Sigma Chemical Co. (St. Louis, MO). RadPrime DNA labeling kit was purchased from Gibco BRL, USA. Statistical Analyses. Data for microcopic and morphometry were analyzed using SigmaPlot, and means and standard errors, and unpaired t-tests were determined by genotype and gender. Results were considered significant when p < Differences in gastric ph and acid secretion in the stomach in wild type and null mice were evaluated statistically by ANOVA (Mann-Whitney test). Figure legends. Fig. 1. Expression of Slc26a7 in the kidney. Double immunofluorescent labeling of AQP2 and Slc26a7 demonstrate the expression of Slc26a7 on the basolateral membrane of A-intercaleted cells in the OMCD. The principal cells are delineated by their apical

5 labeling for AQP2. Arrows in the merged image point to the basolateral labeling by Slc26a7 and the apical labeling by AQP2. Fig. 2. Expression of acid base transporters in the kidney of Slc26a7+/+ and Slc26a7-/- mice. A. Northern hybridization of AE1 in the outer medulla. B. Immunofluorescence labeling of AE1 in the outer medulla. C. Expression of pendrin in the cortex. Fig. 3. Double immunofluorescent labeling of AE2 and H-K-ATPase. Top column demonstrates the expression of AE2 (left panel) and gastric H-K- ATPase (right panel) in wild type mouse stomach. The middle panel is a merged image. Bottom column demonstrates the expression of AE2 (left panel) and gastric H-K- ATPase (right panel), along with the merged image (middle panel), in Slc26a7-null mouse. Figure 4. Histopathologic analysis of stomach and kidney in Slc26a7 null mice. A. H and E analysis of stomach sections in Slc26a7-/- and Slc26a7+/+ mice. Parietal cells (arrows) had normal abundance and appearance in Slc26a7-/- mice (A, Bottom) relative to Slc26a7+/+ (A, Top). Zymogen cells and mucous cells in Slc26a7-/- stomach appeared normal. B. H and E analysis of kidney sections in Slc26a7-/- and Slc26a7+/+ mice. Kidney tubules and cells in the proximal and distal tubules had normal appearance and morphology in Slc26a7-/- mice (B, Bottom) relative to Slc26a7+/+ (B, Top).

6

7

8

9 Figure 4. Histopathologic analysis of stomach (A) and kidney (B) in Slc26a7 null mice.

10

11

(b) Stomach s function 1. Dilution of food materials 2. Acidification of food (absorption of dietary Fe in small intestine) 3. Partial chemical digest

(b) Stomach s function 1. Dilution of food materials 2. Acidification of food (absorption of dietary Fe in small intestine) 3. Partial chemical digest (1) General features a) Stomach is widened portion of gut-tube: between tubular and spherical; Note arranged of smooth muscle tissue in muscularis externa. 1 (b) Stomach s function 1. Dilution of food

More information

Supplementary methods:

Supplementary methods: Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA

More information

marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is

marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels

More information

Nature Immunology: doi: /ni eee Supplementary Figure 1

Nature Immunology: doi: /ni eee Supplementary Figure 1 eee Supplementary Figure 1 Hyphae induce NET release, but yeast do not. (a) NET release by human peripheral neutrophils stimulated with a hgc1 yeast-locked C. albicans mutant (yeast) or pre-formed WT C.

More information

sfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL

sfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL sfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL LTL staining Negative control Fluorescence microscopy of normal (CL-11 +/+ ) mouse renal tissue after staining with

More information

SUPPLEMENTARY FIGURES

SUPPLEMENTARY FIGURES SUPPLEMENTARY FIGURES Supplementary Figure 1: immunoprecipitation with anti-casr antibody The Casr protein was expressed in transiently transfected HEK cells. Cell lysates from HEK cells were subjected

More information

Alimentary Canal (I)

Alimentary Canal (I) Alimentary Canal (I) Esophagus and Stomach (Objectives) By the end of this lecture, the student should be able to discuss the microscopic structure in correlation with the function of the following organs:

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β

More information

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Generation and validation of mtef4-knockout mice.

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Generation and validation of mtef4-knockout mice. Supplementary Figure 1 Generation and validation of mtef4-knockout mice. (a) Alignment of EF4 (E. coli) with mouse, yeast and human EF4. (b) Domain structures of mouse mtef4 compared to those of EF4 (E.

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

Supplemental Figures:

Supplemental Figures: Supplemental Figures: Figure 1: Intracellular distribution of VWF by electron microscopy in human endothelial cells. a) Immunogold labeling of LC3 demonstrating an LC3-positive autophagosome (white arrow)

More information

HISTOLOGY. GIT Block 432 Histology Team. Lecture 1: Alimentary Canal (1) (Esophagus & Stomach) Done by: Ethar Alqarni Reviewed by: Ibrahim Alfuraih

HISTOLOGY. GIT Block 432 Histology Team. Lecture 1: Alimentary Canal (1) (Esophagus & Stomach) Done by: Ethar Alqarni Reviewed by: Ibrahim Alfuraih HISTOLOGY Lecture 1: Alimentary Canal (1) (Esophagus & Stomach) Done by: Ethar Alqarni Reviewed by: Ibrahim Alfuraih Color Guide: Black: Slides. Red: Important. Green: Doctor s notes. Blue: Explanation.

More information

Nature Neuroscience: doi: /nn.2275

Nature Neuroscience: doi: /nn.2275 Supplementary Figure S1. The presence of MeCP2 in enriched primary glial cultures from rat or mouse brains is not neuronal. Western blot analysis of protein extracts from (a) rat glial and neuronal cultures.

More information

Genotype analysis by Southern blots of nine independent recombinated ES cell clones by

Genotype analysis by Southern blots of nine independent recombinated ES cell clones by Supplemental Figure 1 Selected ES cell clones show a correctly recombined conditional Ngn3 allele Genotype analysis by Southern blots of nine independent recombinated ES cell clones by hybridization with

More information

Urinary System. Dr. Ahmed Maher Dr. Ahmed Manhal

Urinary System. Dr. Ahmed Maher Dr. Ahmed Manhal Urinary System Dr. Ahmed Maher Dr. Ahmed Manhal Presentation Map Kidney (cortex & medulla). Nephron. Duct system. Juxtaglomerular apparatus. Ureter, bladder & urethra. Definition & General Structure The

More information

Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses

Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses using an anti-cre antibody; testes at 1 week (left panel),

More information

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 10.1038/nature06994 A phosphatase cascade by which rewarding stimuli control nucleosomal response A. Stipanovich*, E. Valjent*, M. Matamales*, A. Nishi, J.H. Ahn, M. Maroteaux, J. Bertran-Gonzalez,

More information

Supplementary Fig. S1. Schematic diagram of minigenome segments.

Supplementary Fig. S1. Schematic diagram of minigenome segments. open reading frame 1565 (segment 5) 47 (-) 3 5 (+) 76 101 125 149 173 197 221 246 287 open reading frame 890 (segment 8) 60 (-) 3 5 (+) 172 Supplementary Fig. S1. Schematic diagram of minigenome segments.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis

More information

Lab Activity 31. Anatomy of the Urinary System. Portland Community College BI 233

Lab Activity 31. Anatomy of the Urinary System. Portland Community College BI 233 Lab Activity 31 Anatomy of the Urinary System Portland Community College BI 233 Urinary System Organs Kidneys Urinary bladder: provides a temporary storage reservoir for urine Paired ureters: transport

More information

Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells

Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2211 a! mir-143! b! mir-103/107! let-7a! mir-144! mir-122a! mir-126-3p! mir-194! mir-27a! mir-30c! Figure S1 Northern blot analysis of mir-143 expression dependent on feeding conditions.

More information

by authors and SVSBT.

by authors and SVSBT. The Indian Journal of Veterinary Sciences & Biotechnology (2018) Volume 13, Issue 4, 20-25 ISSN (Print) : 2394-0247 : ISSN (Print and online) : 2395-1176, abbreviated as IJVSBT 10.21887/ijvsbt.v13i4.11553

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

General Structure of Digestive Tract

General Structure of Digestive Tract Dr. Nabil Khouri General Structure of Digestive Tract Common Characteristics: Hollow tube composed of a lumen whose diameter varies. Surrounded by a wall made up of 4 principal layers: Mucosa Epithelial

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged

More information

McWilliams et al., http :// /cgi /content /full /jcb /DC1

McWilliams et al., http ://  /cgi /content /full /jcb /DC1 Supplemental material JCB McWilliams et al., http ://www.jcb.org /cgi /content /full /jcb.201603039 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. In vitro characterization of mito-qc. (A and B) Analysis

More information

Epithelia will be discussed according to the following scheme: Type Number of layers Shape Line drawing. Squamous Cuboidal Columnar

Epithelia will be discussed according to the following scheme: Type Number of layers Shape Line drawing. Squamous Cuboidal Columnar Epithelia Epithelia will be discussed according to the following scheme: Type Number of layers Shape Line drawing Simple Squamous Cuboidal Columnar Covering and Lining epithelium Pseudostratified Stratified

More information

Supplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation

Supplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,

More information

Supplementary Information Titles Journal: Nature Medicine

Supplementary Information Titles Journal: Nature Medicine Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11

More information

Yara shwabkeh. Osama Alkhader. Heba Kalbouneh

Yara shwabkeh. Osama Alkhader. Heba Kalbouneh 2 Yara shwabkeh Osama Alkhader Heba Kalbouneh CELL OVERVIEW -Note ; the important thing is to know how the organelles appear under the microscope - the stains we usually use in Histology are composed of

More information

Dissected tissues were minced and lysed in lysis buffer (1x Tris buffered saline (TBS), 1% NP-40,

Dissected tissues were minced and lysed in lysis buffer (1x Tris buffered saline (TBS), 1% NP-40, Data Supplement for Dincheva et al., Effect of Early-Life Fluoxetine on Anxiety-Like Behaviors in BDNF Val66Met Mice. Am J Psychiatry (doi: 10.1176/appi.ajp.2017.15121592) Contents Supplemental Methods

More information

Males- Western Diet WT KO Age (wks) Females- Western Diet WT KO Age (wks)

Males- Western Diet WT KO Age (wks) Females- Western Diet WT KO Age (wks) Relative Arv1 mrna Adrenal 33.48 +/- 6.2 Skeletal Muscle 22.4 +/- 4.93 Liver 6.41 +/- 1.48 Heart 5.1 +/- 2.3 Brain 4.98 +/- 2.11 Ovary 4.68 +/- 2.21 Kidney 3.98 +/-.39 Lung 2.15 +/-.6 Inguinal Subcutaneous

More information

Urinary System Laboratory

Urinary System Laboratory Urinary System Laboratory 1 Adrenal gland Organs of The Urinary System Renal artery and vein Kidney Ureter Urinary bladder Figure 26.1 2 Urethra Functions of the urinary system organs: Urethra expels urine

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplemental Figure 1. Furin is efficiently deleted in CD4 + and CD8 + T cells. a, Western blot for furin and actin proteins in CD4cre-fur f/f and fur f/f Th1 cells. Wild-type and furin-deficient CD4 +

More information

The subcortical maternal complex controls symmetric division of mouse zygotes by

The subcortical maternal complex controls symmetric division of mouse zygotes by The subcortical maternal complex controls symmetric division of mouse zygotes by regulating F-actin dynamics Xing-Jiang Yu 1,2, Zhaohong Yi 1, Zheng Gao 1,2, Dan-dan Qin 1,2, Yanhua Zhai 1, Xue Chen 1,

More information

Tissues. tissue = many cells w/ same structure and function. cell shape aids function tissue shape aids function. Histology = study of tissues

Tissues. tissue = many cells w/ same structure and function. cell shape aids function tissue shape aids function. Histology = study of tissues Tissues tissue = many cells w/ same structure and function cell shape aids function tissue shape aids function Histology = study of tissues 4 types of tissues Epithelial coverings contact openings Connective

More information

Cells and Tissues 3PART C. PowerPoint Lecture Slide Presentation by Patty Bostwick-Taylor, Florence-Darlington Technical College

Cells and Tissues 3PART C. PowerPoint Lecture Slide Presentation by Patty Bostwick-Taylor, Florence-Darlington Technical College PowerPoint Lecture Slide Presentation by Patty Bostwick-Taylor, Florence-Darlington Technical College Cells and Tissues 3PART C Protein Synthesis Gene DNA segment that carries a blueprint for building

More information

Explain the laboratory diagnosis of Rabies?

Explain the laboratory diagnosis of Rabies? Explain the laboratory diagnosis of Rabies? The standard test for rabies testing is dfa. This test has been thoroughly evaluated for more than 40 years, and is recognized as the most rapid and reliable

More information

MS1 Physiology Review of Na+, K+, H + /HCO 3. /Acid-base, Ca+² and PO 4 physiology

MS1 Physiology Review of Na+, K+, H + /HCO 3. /Acid-base, Ca+² and PO 4 physiology MS1 Physiology Review of,, / /Acidbase, Ca+² and PO 4 physiology I. David Weiner, M.D. Professor of Medicine and Physiology University of Florida College of Medicine Basic principles Proximal tubule Majority

More information

SUPPLEMENTARY FIGURE LEGENDS

SUPPLEMENTARY FIGURE LEGENDS SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Hippocampal sections from new-born Pten+/+ and PtenFV/FV pups were stained with haematoxylin and eosin (H&E) and were imaged at (a) low and (b) high

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering

More information

Small intestine. Small intestine

Small intestine. Small intestine General features Tubular organ longest part; 5-6 m most of chemical digestion absorption of nutrients reabsorption of H2O occurs. Two structural features; maximize the lumenal surface area villi microvilli

More information

ON THE PRESENCE OF A CILIATED COLUMNAR EPITHELIAL CELL TYPE WITHIN THE BOVINE CERVICAL MUCOSA 1

ON THE PRESENCE OF A CILIATED COLUMNAR EPITHELIAL CELL TYPE WITHIN THE BOVINE CERVICAL MUCOSA 1 ON THE PRESENCE OF A CILIATED COLUMNAR EPITHELIAL CELL TYPE WITHIN THE BOVINE CERVICAL MUCOSA 1 R. I. Wordinger, 2 J. B. Ramsey, I. F. Dickey and I. R. Hill, Jr. Clemson University, Clemson, South Carolina

More information

Expanded View Figures

Expanded View Figures Shao-Ming Shen et al Role of I in MT of cancers MO reports xpanded View igures igure V1. nalysis of the expression of I isoforms in cancer cells and their interaction with PTN. RT PR detection of Ish and

More information

Supplementary Table 1. List of primers used in this study

Supplementary Table 1. List of primers used in this study Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3

More information

Histological and Histochemical Investigations on Japanese Lizard

Histological and Histochemical Investigations on Japanese Lizard Okajimas Folia Anat. Jpn., 69(1): 25-34, May, 1992 Histological and Histochemical Investigations on Japanese Lizard Esophagus By Masatake IMAI and Taizo SHIBATA Department of Anatomy, Kanazawa Medical

More information

All lecture of practical OSPE file

All lecture of practical OSPE file All lecture of practical OSPE file Red: questions. Dark red: very important. Black: complete answers. Gray: notes extra. Editing File You should know before the exam: The diagrams in these slides are going

More information

Urinary Anatomy. Lab 40. Kidneys. Nephrons. Renal Corpuscle

Urinary Anatomy. Lab 40. Kidneys. Nephrons. Renal Corpuscle Urinary Anatomy Lab 40. Urinary Anatomy and Kidney Dissection Kidneys: filters blood, produces urine Ureters: convey urine to bladder Bladder: holding tank Urethra: carries urine to the outside for elimination

More information

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained

More information

Dr. Heba Kalbouneh. Dr. Heba Kalbouneh. Dr. Heba Kalbouneh

Dr. Heba Kalbouneh. Dr. Heba Kalbouneh. Dr. Heba Kalbouneh Dr. Heba Kalbouneh Dr. Heba Kalbouneh Dr. Heba Kalbouneh Basement membrane: What is the basement membrane? - It is a layer of ECM separating the epithelial cells from the underlying connective tissue Basement

More information

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12. Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.

More information

Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted

Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted Supplemental Figure 1. Quantification of proliferation in thyroid of WT, Ctns -/- and grafted Ctns -/- mice. Cells immunolabeled for the proliferation marker (Ki-67) were counted in sections (n=3 WT, n=4

More information

Reason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma

Reason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma Supplementary Table S1 Human Patients Patient Sample No. Gender Age Additional Medication Treatment 1 Reason for Dissection Total Irradiation Dose Estimated Irradiation Dose to SG Gland Time of Resection

More information

Lumen. -60 mv, ph 7.3 Cl - (E Cl CFTR HCO mv, ph 7.3 HCO HCO. Channel or Other electrogenic HCO 3- up to a 80-mM concentration when [Cl - ] i

Lumen. -60 mv, ph 7.3 Cl - (E Cl CFTR HCO mv, ph 7.3 HCO HCO. Channel or Other electrogenic HCO 3- up to a 80-mM concentration when [Cl - ] i . Proximal Duct 1 Cl HCO 8 Cl 8 HCO Lumen CFTR AE 6 mv, ph 7. Cl (E Cl = 712 ) Cl 2 HCO 2 lood ph HCO. Distal Duct 2 Cl 128 HCO >14 HCO? 6 mv, ph 7. Cl (E Cl = 47 ) Cl HCO HCO 5 2 HCO HCO Channel or Other

More information

AP VP DLP H&E. p-akt DLP

AP VP DLP H&E. p-akt DLP A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy

More information

Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is

Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is Supplemental Figure 1: Lrig1-Apple expression in small intestine. Lrig1-Apple is observed at the crypt base and in insterstial cells of Cajal, but is not co-expressed in DCLK1-positive tuft cells. Scale

More information

Medical School Histology Basics Introduction to Microscopy. VIBS 289 lab

Medical School Histology Basics Introduction to Microscopy. VIBS 289 lab Medical School Histology Basics Introduction to Microscopy VIBS 289 lab Larry Johnson Texas A&M University Objectives Learn the difference in magnification and resolution Learn about different types of

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/8/389/ra79/dc1 Supplementary Materials for HDL-bound sphingosine 1-phosphate acts as a biased agonist for the endothelial cell receptor S1P 1 to limit vascular

More information

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi

More information

DIGESTIVE TRACT ESOPHAGUS

DIGESTIVE TRACT ESOPHAGUS DIGESTIVE TRACT From the lower esophagus to the lower rectum four fundamental layers comprise the wall of the digestive tube: mucosa, submucosa, muscularis propria (externa), and adventitia or serosa (see

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

Histology Final Exam Done by:maha AbuAjamieh

Histology Final Exam Done by:maha AbuAjamieh Histology Final Exam Done by:maha AbuAjamieh 1) Which of the following is the least valuable when distinguishing between bone and hyaline cartilage?? A- lacunae B-canaliculi C-lamella D-cell nest E- harversian

More information

Histology Urinary system

Histology Urinary system Histology Urinary system Urinary system Composed of two kidneys, two ureters, the urinary bladder, and the urethra, the urinary system plays a critical role in: 1- Blood filtration,(filtration of cellular

More information

الله الر ح م ن الر ح يم مسب

الله الر ح م ن الر ح يم مسب بسم رلا هللارلا هللا This is the second histology lecture in the GI system. In this lecture, we will discuss the histology of the esophagus, stomach, and small intestine so prepare yourself.this sheet

More information

(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,

(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.

More information

Cell Overview. Hanan Jafar BDS.MSc.PhD

Cell Overview. Hanan Jafar BDS.MSc.PhD Cell Overview Hanan Jafar BDS.MSc.PhD THE CELL is made of: 1- Nucleus 2- Cell Membrane 3- Cytoplasm THE CELL Formed of: 1. Nuclear envelope 2. Chromatin 3. Nucleolus 4. Nucleoplasm (nuclear matrix) NUCLEUS

More information

21 Endocrine organs and cells

21 Endocrine organs and cells 21 Endocrine organs and cells The endocrine system consists of discrete organs, portions of organs and distributed cells that secrete hormones into surrounding tissues or structures. Objectives You should

More information

PANCREATIC BETA CELLS PRODUCE AND SECRETE

PANCREATIC BETA CELLS PRODUCE AND SECRETE 15 March, 2018 PANCREATIC BETA CELLS PRODUCE AND SECRETE Document Filetype: PDF 374.06 KB 0 PANCREATIC BETA CELLS PRODUCE AND SECRETE Among the oldest and cheapest drugs for diabetes are the drugs that

More information

Procaspase-3. Cleaved caspase-3. actin. Cytochrome C (10 M) Z-VAD-fmk. Procaspase-3. Cleaved caspase-3. actin. Z-VAD-fmk

Procaspase-3. Cleaved caspase-3. actin. Cytochrome C (10 M) Z-VAD-fmk. Procaspase-3. Cleaved caspase-3. actin. Z-VAD-fmk A HeLa actin - + + - - + Cytochrome C (1 M) Z-VAD-fmk PMN - + + - - + actin Cytochrome C (1 M) Z-VAD-fmk Figure S1. (A) Pan-caspase inhibitor z-vad-fmk inhibits cytochrome c- mediated procaspase-3 cleavage.

More information

Histopathology: chronic inflammation

Histopathology: chronic inflammation Histopathology: chronic inflammation These presentations are to help you identify, and to test yourself on identifying, basic histopathological features. They do not contain the additional factual information

More information

Journal Club. 03/04/2012 Lama Nazzal

Journal Club. 03/04/2012 Lama Nazzal Journal Club 03/04/2012 Lama Nazzal NOTCH and the kidneys Is an evolutionarily conserved cell cell communication mechanism. Is a regulator of cell specification, differentiation, and tissue patterning.

More information

Urinary bladder provides a temporary storage reservoir for urine

Urinary bladder provides a temporary storage reservoir for urine Urinary System Organs Kidney Filters blood, allowing toxins, metabolic wastes, and excess ions to leave the body in urine Urinary bladder provides a temporary storage reservoir for urine Paired ureters

More information

Supplemental data Supplemental Figure Legends Supplemental Figure 1. Supplemental Figure 2.

Supplemental data Supplemental Figure Legends Supplemental Figure 1. Supplemental Figure 2. Supplemental data Supplemental Figure Legends Supplemental Figure 1. Analysis of deletion of AMPK!2 in POMC and AgRP neurons in control and POMC!2KO and AgRP!2KO mice. (A) mmunofluorescence analysis for

More information

Zhu et al, page 1. Supplementary Figures

Zhu et al, page 1. Supplementary Figures Zhu et al, page 1 Supplementary Figures Supplementary Figure 1: Visual behavior and avoidance behavioral response in EPM trials. (a) Measures of visual behavior that performed the light avoidance behavior

More information

Role of Tyk-2 in Th9 and Th17 cells in allergic asthma

Role of Tyk-2 in Th9 and Th17 cells in allergic asthma Supplementary File Role of Tyk-2 in Th9 and Th17 cells in allergic asthma Caroline Übel 1*, Anna Graser 1*, Sonja Koch 1, Ralf J. Rieker 2, Hans A. Lehr 3, Mathias Müller 4 and Susetta Finotto 1** 1 Laboratory

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 YAP negatively regulates IFN- signaling. (a) Immunoblot analysis of Yap knockdown efficiency with sh-yap (#1 to #4 independent constructs) in Raw264.7 cells. (b) IFN- -Luc and PRDs

More information

Hip1r is expressed in gastric parietal cells and is required for tubulovesicle formation and cell survival in mice

Hip1r is expressed in gastric parietal cells and is required for tubulovesicle formation and cell survival in mice Research article Hip1r is expressed in gastric parietal cells and is required for tubulovesicle formation and cell survival in mice Renu N. Jain, 1 Asma A. Al-Menhali, 1 Theresa M. Keeley, 1 Jianhua Ren,

More information

Figure 26.1 An Introduction to the Urinary System

Figure 26.1 An Introduction to the Urinary System Chapter 26 Figure 26.1 An Introduction to the Urinary System Components of the Urinary System Kidney Produces urine Ureter Transports urine toward the urinary bladder Urinary Bladder Temporarily stores

More information

Glands Histology lab 5 Notes by Lojayn Salah

Glands Histology lab 5 Notes by Lojayn Salah Glands Histology lab 5 Notes by Lojayn Salah There are two types of glands: - 1) Endocrine gland: collection of epithelial cells with no connection with the epithelial surface, it has no duct, its secretory

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces

More information

Dr Nadine Gravett School of Anatomical Sciences Room 2B10B

Dr Nadine Gravett School of Anatomical Sciences Room 2B10B Dr Nadine Gravett School of Anatomical Sciences Room 2B10B Nadine.Gravett@wits.ac.za Oral cavity Mechanical breakdown Formation of bolus Oesophagus Conduit from mouth to stomach Stomach Digestion Temporary

More information

Urinary system. Urinary system

Urinary system. Urinary system INTRODUCTION. Several organs system Produce urine and excrete it from the body Maintenance of homeostasis. Components. two kidneys, produce urine; two ureters, carry urine to single urinary bladder for

More information

Supplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons

Supplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons Supplementary Figure 1 ETBF activate Stat3 in B6 and Min mice colons a pstat3 controls Pos Neg ETBF 1 2 3 4 b pstat1 pstat2 pstat3 pstat4 pstat5 pstat6 Actin Figure Legend: (a) ETBF induce predominantly

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

Supplementary Materials for

Supplementary Materials for www.sciencetranslationalmedicine.org/cgi/content/full/4/117/117ra8/dc1 Supplementary Materials for Notch4 Normalization Reduces Blood Vessel Size in Arteriovenous Malformations Patrick A. Murphy, Tyson

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

A adipose cells. B capillary. C epithelium

A adipose cells. B capillary. C epithelium EPITHELIA Objective The objective of this class is to observe how different epithelia vary in terms of cell shape, size and number of cell layers enabling them to be well adapted for functions in different

More information

Epithelium tissue system

Epithelium tissue system Epithelium tissue system Histology : is the study of the microscopic anatomy (microanatomy) of cells and tissues of plants and animals. It is commonly performed by examining cells and tissues under a light

More information

Basic Histology. By Mrs. Bailey

Basic Histology. By Mrs. Bailey Basic Histology By Mrs. Bailey Primary Tissues 1. Epithelial Tissue 2. Connective Tissue 3. Muscle Tissue 4. Nervous Tissue Very cellular Supported by underlying connective tissue Epithelial & connective

More information

Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response. Supplementary Results

Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response. Supplementary Results Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response Shi-Ying Cai 1, Xinshou Ouyang 1, Yonglin Chen 1, Carol J. Soroka 1, Juxian Wang 2, Albert Mennone 1,

More information

1 (a) State the maximum magnification that can be achieved by a light microscope and a transmission electron microscope.

1 (a) State the maximum magnification that can be achieved by a light microscope and a transmission electron microscope. 1 (a) State the maximum magnification that can be achieved by a light microscope and a transmission electron microscope. Select your answers from the list below. 10x 40x 100x light microscope... x transmission

More information

STEIN IN-TERM EXAM -- BIOLOGY APRIL 19, PAGE

STEIN IN-TERM EXAM -- BIOLOGY APRIL 19, PAGE STEIN IN-TERM EXAM -- BIOLOGY 3058 -- APRIL 19, 2018 -- PAGE 1 of 9 There are 25 questions in this Biology 3058 exam. All questions are "A, B, C, D, E, F, G, H" questions worth one point each. There is

More information

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.

c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p. a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8

More information

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript.

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript. Supplemental Materials: I. Supplemental Methods II. Supplemental Figure Legends III. Supplemental Figures Supplemental Methods Cell Culture and Transfections for Wild Type and JNK1-/-,JNK2-/- MEFs: The

More information