Role of BMP-4 during tooth development in a model with complete dentition

Size: px
Start display at page:

Download "Role of BMP-4 during tooth development in a model with complete dentition"

Transcription

1 archives of oral biology 53 (2008) 2 8 available at journal homepage: Role of BMP-4 during tooth development in a model with complete dentition C.B.B. Torres a, *, J.B. Alves b, G.A.B. Silva c, V.S. Goes d, L.Y.S. Nakao b, A.M. Goes c a Health Sciences Center, Federal University of Piauí (UFPI), Brazil b University of Uberaba (UNIUBE), Brazil c Institute of Biological Sciences, Federal University of Minas Gerais (UFMG), Brazil d Industrial Biotechnology (BTI), Brazil article info Article history: Accepted 13 July 2007 Keywords: BMP-4 Cloning Expression pattern Tooth development Didelphis albiventris abstract There are no reports in literature about roles of bone morphogenetic protein 4 (BMP-4) in tooth development in mammals with complete dentition (with all dental groups). The classical model of study is the mouse, which has distinctive incisor and molar patterns. The opossum Didelphis albiventris with five upper and four lower incisors, one canine, three premolars and four molars, on each side of the jaw, seems to be a convenient model for odontogenesis study. This investigation searched for similarities and differences in BMP-4 expression pattern between the opossum and the mouse. BMP-4 cdna was obtained by RT- PCR and the expression pattern during molar tooth development was investigated by the immunoperoxidase method. Opossum BMP-4 mature protein has 95% of sequence similarity in relation to mouse and 94% to human. The BMP-4 expression pattern during opossum tooth development was suggestive of a role in dental organ initiation and morphogenesis. # 2007 Elsevier Ltd. All rights reserved. 1. Introduction The bone morphogenetic proteins (BMPs) are a group of molecules related to the transforming growth factor-b superfamily. 1 They were originally isolated from demineralized bone matrix and initially characterized by their ability to induce ectopic bone formation in vitro. 2 Homozygous mice mutant BMP-4 embryos die between embryonic days 6.5 and 9.5 (E6.5 and E9.5) and show little or no mesodermal differentiation. 3 In relation to mouse tooth development, Bmp-4 transcripts are detected in the presumptive dental epithelium from its thickening to the early bud stage. 4,5 During growth of the epithelial tooth bud (E12 13), Bmp-4 transcripts are present for a short period both in the epithelial cells and in the underlying mesenchymal cells. 4 Subsequently, gene expression shifts to the mesenchyme, which coincides with the transfer of the odontogenic potential from epithelium to mesenchyme. 6,7 Mesenchymal Bmp-4 regulates epithelial morphogenesis beyond E12. Blocking in vitro translation of BMP-4 gene results in lack of cusp formation and ameloblast differentiation. 8 Preodontoblastic cells and odontoblasts in final phase of differentiation also express Bmp-4. 4 Most of the data about BMP signalling underlying tooth development has come from studies in mouse embryos and comparable data from other vertebrates are extremely limited. Extrapolation of data from the mouse to mammals in general must proceed with caution. 9 Marsupials have been considered excellent models for ontogenetic studies due to its short intrauterine development. 10 Moreover, the marsupials of the * Corresponding author at: Universidade Federal de Minas Gerais, Instituto de Ciências Biológicas, Departamento de Morfologia, N3-224, Avenida Presidente Antônio Carlos 6627, CEP , Belo Horizonte, Minas Gerais, Brasil. Tel.: ; fax: address: cristianebbtorres@yahoo.com.br (C.B.B. Torres) /$ see front matter # 2007 Elsevier Ltd. All rights reserved. doi: /j.archoralbio

2 archives of oral biology 53 (2008) Didelphidae family have a full complement of teeth, with five upper and lower incisors, one canine, three premolars and four molars, on each side of the jaw. 11 Marsupials and placentals diverged in the evolutionary line in the early Cretaceous 12 but maintained similar dental features that reflect their common ancestry more than 120 million years ago. 13 Conserved molecular pathways may be responsible for these similarities. Gene expression patterns have been highly correlated with morphological features of dentition. As an example, the distinctions in molar pattern between mice and voles, the first murine group originated in the Middle Miocene and the second in the Early Pliocene, are the result of small changes in the expression of genes that determine the relative position of the secondary cusp. 14 Similarly, differences in BMP-4 expression among species could be responsible for morphological differences in the dentition. Considering that the same or similar genes may control the patterns of molar cusps between marsupials and placentals, the purpose of this work was to characterize the amino acid sequence and the expression pattern of BMP-4 during molar tooth development in Didelphis albiventris in order to search for similarities and differences between the opossum and the mouse. 2. Materials and methods 2.1. Animals and tissue preparation Pregnant D. albiventris females were captured in the nature during reproductive period (July January, in Minas Gerais, Brazil) and maintained in captivity until the animals were born. Newborns were carefully removed from mothers nipples in the pouch, after immobilization of females, in a minimum number of three young animals for each postnatal day (P), from P0 (moment of birth) until P15, in order to collect samples of first molars in dental lamina, bud, cap and early bell stages. Following, the newborns were weighed, measured and decapitated. The heads were fixed in neutral 10% buffered formalin for 48 h at room temperature. After fixation, all specimens were dehydrated through graded ethanol solutions, embedded in paraffin, serially sectioned at 7 mm in the frontal plane and placed on sylanized slides. The Ethics Committee in Animal Experimentation of UFMG (CETEA- UFMG) and Brazilian Institute of Natural Environment and Renewable Resources (IBAMA) previously approved all procedures performed Cloning and sequencing of D. albiventris BMP-4 cdna Adult brain cdna library was generated from D. albiventris total RNA extraction with Trizol reagent (Gibco BRL, Carlsbad, CA). BMP-4 cdna was obtained by reverse transcriptionpolymerase chain reaction (RT-PCR) methods using a Super- Script First-Strand Synthesis System for RT-PCR (Invitrogen Life Technologies, Carlsbad, CA). The oligonucleotides used in PCR were designed taking into account the BMP-4 cdna sequence homology among human, mouse and rat sequences (GenBank-NCBI accession numbers NM_001202, X56848 and NM_012827, respectively). The forward primer was ATGATTCCTGGTAACCGAATGCTG-3 0, and the reverse one 5 0 -TCAGCGGCAYCCRCAYCC-3 0. The amplified fragment was cloned into a pcr2.1-topo-vector (Invitrogen Life Technologies) and sequenced on MegaBACE DNA Analysis System (Amersham Biosciences, Buckinghamshire, England) using M13 primers. BMP-4 sequence homology analysis between D. albiventris and other species was performed with the algorithms BLASTX 15 and ClustalW 16, available in the Internet: and respectively Bacterial expression of BMP-4 recombinant protein BMP-4 cdna was removed from the TOPO vector through enzymatic digestion of EcoRI restriction sites. The fragment was inserted into the pgex-4t-1 expression vector (Amersham Biosciences). Transformed Escherichia coli BL21 (DE3) Star cells (Amersham Biosciences) were cultured in LB Broth media, induced with 1 mm isopropyl b-d-thiogalactoside (IPTG) and then disrupted for protein separation by electrophoresis using 10% polyacrylamide gel under reducing conditions (SDS-PAGE). This expression system allowed production of the 26 kda schistosomal glutathione-s-transferase (GST) fusioned to the BMP-4 recombinant protein Western blot analysis Proteins collected from wild type and transformed E. coli were separated by 10% SDS-PAGE and subsequently transferred to a nitrocellulose membrane (Bio-Rad, Hercules, CA). After blocking with PBS 2% casein for 1 h at room temperature, the membrane was probed for 1 h at room temperature with goat polyclonal primary antibodies against schistosomal GST ( , Amersham Biosciences) and human BMP-4 (sc-6896, Santa Cruz Biotechnologies, Santa Cruz, CA). After incubation with peroxidase-conjugated secondary antibodies (Sigma Aldrich, St. Louis, MO), visualization of staining was obtained by colorimetric detection with 6 mg of diaminobenzidine (DAB), 0.3% (w/v) NiCl 2 and 30% H 2 O 2 in 0.15 M PBS solution. This step had two purposes: to confirm recombinant BMP-4 in vitro translation and to test the suitableness of the primary anti-human BMP-4 antibody for use in the immunohistochemistry Immunohistochemistry After removing of paraffin, hydration, and PBS washing, opossum facial sections were incubated in 10% H 2 O 2 in methanol to neutralize endogenous peroxidase activity. Non-specific binding sites were blocked with 2% BSA in PBS for 1 h. After overnight incubation of sections at 4 8C with the primary antibody anti-bmp-4 (sc-6896, Santa Cruz Biotechnology), sections were rinsed with PBS and incubated for 30 min at room temperature in biotinylated anti-goat antibody (LSAB+ System-HRP, Dako, Glostrup, Denmark). Following PBS washing, sections were incubated for 30 min at room temperature in streptavidin horseradish peroxidase conjugate (LSAB+ System-HRP, Dako). Visualization of staining was obtained by incubating sections with 14 mg of DAB and 10% H 2 O 2 in PBS

3 4 archives of oral biology 53 (2008) 2 8 solution. Then, sections were counterstained with Mayer s haematoxylin. Negative controls were performed by applying normal goat serum instead of the primary antibody. Developing opossum bone sections were used as positive control for the primary antibody. 3. Results 3.1. Cloning and sequencing of BMP-4 cdna BMP-4 cdna is a 1233-base pair sequence comprising the entire BMP-4 gene open reading frame. Nucleotide sequence homology was 44.7% in relation to human, 43.8% in relation to mouse and 44.3% in relation to rat (NM_001202, X56848 and NM_012827, respectively). Translation resulted in a 410- residue polypeptide corresponding to the precursor protein with a predicted molecular mass of 46.7 kda (ExPASy Proteomics Server, 17 The amino acid sequence homology in relation to human was 86.3% of identity and 90.5% of similarity. In relation to mouse, the sequence identity was 86.8% and the similarity 91%. In relation to rat, the sequence identity was 86.3% and the similarity 90.7%. Precursor BMP-4 protein presents a TGF-b pro-peptide which represents the main part of the protein. The C-terminal region of the precursor protein contains the conserved central core of the TGF-b family and, after cleavage, functions as the mature BMP-4 protein and presents 116 residues and a molecular mass of 13.2 kda. The opossum mature BMP-4 has 95.7% of sequence similarity in relation to mouse, rat and monkey (CAA40179, NP_ and XP_ , respectively) and 94.8% of similarity in relation to human (AAC72278). The cleavage site of the precursor protein has the conformation RAKR and is situated in the positions In the Fig. 1 BMP-4 amino acid sequence homology among D. albiventris and other species through ClustalW (1.82) multiple sequence alignment: underlined, high-affinity type I receptor-binding sites (BMPR-IA); arrows, conserved cysteines of the TGF-b superfamily; boxes, presumptive heparin-binding sites ( * identical residues; : conserved substitution;. semiconserved substitution; - gap; no consensus).

4 archives of oral biology 53 (2008) C-terminal region, the seven conserved cysteines of the TGF-b family are localized at the residues 310, 339, 343, 374, 375, 407 and 409 (Fig. 1). In the opossum precursor BMP-4 there is a glutamic acid at the position 95 that is not present in the dog, rabbit, mouse and rat sequences (XP_547817, AAB97467, NP_ and AAH78901, respectively). In relation to the human sequence (P12644), there are two extra glutamic acids at residues 95 and 99 of the opossum sequence. The N- terminal region presents various triplets of basic residues (K, R and H), which are considered presumptive heparin-binding sites of BMP-4. The presumptive binding sites for the highaffinity receptor type I (BMPR-IA) are the residues C-310, R-311, V-322, G-323, W-324, D-326, W-327, I-328, P-344, F-345, P-346, L- 347, T-348, D-349, H-350, N-352, I-358, V-359, L-362, S-365, V- 366, M-385, Y-387, L-388, K-397, Y-399, Q-400, E-401 and M-402. D. albiventris BMP-4 cdna was submitted to the GenBank database and has been assigned the accession number DQ Bacterial expression and Western blot analysis In E. coli samples transformed with pgex-4t-1/bmp-4 and probed with polyclonal anti-human BMP-4, the GST/BMP-4 fusion protein was resolved as a band of approximately 72.7 kda, which is consistent with its predicted molecular mass (Fig. 2). Non-transformed E. coli samples did not show any specific reaction Histological analysis In the moment of birth (P0), the first molars of D. albiventris were observed at the dental lamina stage with a condensation of the mesenchyme around the epithelial thickening (Fig. 3A and B). The bud stage occurred between P2 and P4 (Fig. 3C and D shows the dental organs at P2). The cap stage occurred between P4 and P8. At P5, the formative elements of the tooth (dental organ, dental papilla and dental follicle) were evident and the primary enamel knot was completely formed (Fig. 4A and B). The bell stage lasted from P8 to P15. At P13, the dental organs were still at the early bell stage (Fig. 4C and D) Immunohistochemistry In the developing bone sections, used as positive controls, BMP-4 was detected in the osteoblasts, osteocytes, and in the extracellular matrix adjacent to the sites of bone formation (Fig. 3F and F). Immunohistochemical data on BMP-4 expression was similar for both upper and lower first molars in D. albiventris. At the dental lamina stage, BMP-4 expression was evident at the dental epithelium (Fig. 3A and B). Subsequently, during the bud stage, the expression progressively shifted to the dental mesenchyme (Fig. 3C and D). During the cap stage, immunostaining was restricted to the enamel knot, inner enamel epithelium, outer enamel epithelium and dental follicle (Fig. 4A and B). There was no staining in the dental papilla. At the bell stage, the intensity of BMP-4 expression was significantly reduced. At this stage, staining was stronger at the dental follicle and enamel knots and there was no BMP-4 expression in dental papilla (Fig. 4C and D). 4. Discussion The mechanisms involved in epithelial mesenchymal interactions regulating tooth development have been studied in the mouse for decades. 4,18 20 The mouse is a classical model for investigation of molecular patterning of odontogenesis because of the great conservation of signalling molecules among species and along evolution. However, the dentition of the mouse contains highly specialized incisors, reduced tooth Fig. 2 Western blot analysis of the bacterial expression of GST/BMP-4 fusion protein. Non-transformed E. coli sample did not react with the primary antibody anti-bmp-4 (lane 1). In E. coli sample transformed with pgex-4t-1/bmp-4, the BMP-4/ GST fusion protein was recognized by the primary antibody anti-bmp-4 (lane 2). In E. coli sample transformed with pgex- 4T-1, the GST was recognized by the anti-gst antibody (lane 3) but not by the anti-bmp-4 antibody (not shown).

5 6 archives of oral biology 53 (2008) 2 8 Fig. 3 Immunolocalization of BMP-4 in developing D. albiventris first molars. (A) Epithelial expression of BMP-4 at the dental lamina stage (P0) of the lower first molar; (B) similar expression pattern for the upper first molar at the dental lamina stage; (C) strong staining for BMP-4 in the condensed mesenchyme around the lower first molar at the bud stage (P2); (D) similar expression pattern for the upper first molar at the bud stage; (E) negative control; (F) section of intramembranous ossification of maxilla was used as positive control (P2). Bars = 50 mm (DL, dental lamina; TB, tooth bud; OC, oral cavity; EC, ectomesenchyme; BN, bone). pattern and lack of enamel in molar cusp tips, and cannot be considered a typical representative of mammals. The opossum D. albiventris has been demonstrating a great suitableness to ontogenetic studies. 21 The great morphological differences of mammalian dentitions may be a result of distinctive patterns of gene expression. 14 Fibroblast growth factors (FGFs) and BMPs are key regulators of dental morphogenesis 22 and studying members of these families in the opossum is a good start point to understand possible correlation between speciesdependent variations in molecular regulation of odontogenesis and morphological variations in dentitions. In a previous study, it was demonstrated that, despite of the great conservation of FGF-9 among species, its involvement in tooth development is apparently different between the opossum and rodents. While in rodents FGF-9 is involved in both tooth initiation and morphogenesis, in the opossum, there was evidence of its participation only in dental organ initiation. 21 Such observation reinforces the necessity for further research on the regulation of odontogenesis in biological models with complete tooth pattern. The sequence analysis of the D. albiventris BMP-4 showed its high degree of conservation among human, mouse and rat. In relation to tooth development, previous studies demonstrated the occurrence of Bmp-4 expression in dental epithelium during tooth initiation in the mouse 4,23 and rat. 24 Similarly, opossum BMP-4 was preferentially expressed in the dental lamina epithelium than in the dental mesenchyme. In tooth initiation, epithelial BMP-4 is a regulator of mesenchymal transcription factors necessary to the proliferation of epithelial cells. 4,5 Epithelial expression of BMP-4 in the opossum was transient. During growth of the epithelial bud, the expression was transferred to the dental mesenchyme as occurs in the mouse 4,23 and rat. 24 The transfer of BMP-4 expression from the epithelium to the mesenchyme coincides with the transfer of the odontogenic potential in the same direction. 25

6 archives of oral biology 53 (2008) Fig. 4 Immunolocalization of BMP-4 in the developing D. albiventris first molars. (A) Expression of BMP-4 in the enamel knot, inner enamel epithelium, outer enamel epithelium and dental follicle at the cap stage (P5). (B) Similar expression pattern for the upper first molar at the cap stage. (C) BMP-4 expression at the inner enamel epithelium of the lower first molar, especially in the enamel knot (*), at the early bell stage (P13). The dental follicle showed intense BMP-4 expression. (D) Similar expression pattern for the upper first molar at the early bell stage. (E) Negative control. (F) Section of intramembranous ossification of maxilla was used as positive control (P5). Bars = 50 mm in panels A, B, F and 100 mm in C E (EK, enamel knot; DF, dental follicle; DP, dental papilla; IE, inner enamel epithelium; OE, outer enamel epithelium; OC, oral cavity; EC, ectomesenchyme; BN, bone). During opossum tooth morphogenesis, BMP-4 expression was observed in the enamel knots and inner enamel epithelium. This data suggests that BMP-4 has a role in opossum tooth crown formation and ameloblast differentiation since these cellular structures are involved in cusps formation. 26 While Bmp-4 expression is evident in the murine dental papilla cells 4,7, there was no BMP-4 expression in the opossum dental papilla at the cap and early bell stages. This is the most significant difference in relation to mouse. There are few studies about the roles of BMPs and other signalling molecules in stages of tooth development later than the cap stage, but they suggest an implication of BMP-4 in the differentiation of dental papilla cells. In bovine adult pulp cells, BMP-4 is considered and important inducer of odontoblast differentiation and extracellular matrix proteins expression. 27,28 In embryonic rat pulp, there are multiple receptors for BMPs, implicating diverse functions in cell differentiation and tissue repair. 29 Opossum BMP-4 does not appear to play a role in early maturation of dental papilla cells but the data presented here cannot be extrapolated to the entire process of odontoblastic differentiation. Further studies on later stages of tooth development will help to clarify if BMP-4 may regulate or not dental papilla cells differentiation in the opossum. It was demonstrated here for the first time that BMP-4 is involved in tooth initiation and morphogenesis in the opossum molar tooth development. Acknowledgements This investigation was supported by Coordination of Perfectioning of Staff of Superior Level (CAPES) and National Advice

7 8 archives of oral biology 53 (2008) 2 8 of Scientific and Technological Development (CNPq), agencies of the Ministry of Education and Culture of Brazil, and by the Program of Support to the Research of the University of Uberaba (UNIUBE, Minas Gerais, Brazil). references 1. Massagué J, Blain SW, Lo RS. TGF-b signaling in growth control, cancer, and heritable disorders. Cell 2000;103: Wozney JM, Rosen V, Celeste AJ, Mitsock LM, Whitters MJ, Kriz RW, et al. Novel regulators of bone formation: molecular clones and activity. Science 1988;242: Winnier G, Blessing M, Labosky PA, Hogan BLM. Bone morphogenetic protein-4 is required for mesoderm formation and patterning in the mouse. Genes Dev 1995;9: Vainio S, Karavanova I, Jowett A, Thesleff I. Identification of BMP-4 as a signal mediating secondary induction between epithelial and mesenchymal tissues during early tooth development. Cell 1993;75: Neubüser A, Peters H, Balling R, Martin GR. Antagonistic interactions between FGF and BMP signaling pathways: a mechanism for positioning the sites of tooth formation. Cell 1997;90: Bennett JH, Hunt P, Thorogood P. Bone morphogenetic protein-2 and 4 expression during murine orofacial development. Arch Oral Biol 1995;40: Keränen SVE, Åberg T, Kettunen P, Thesleff I, Jernvall J. Association of developmental regulatory genes with the development of different molar tooth shapes in two species of rodents. Dev Genes Evol 1998;208: Tabata MJ, Fujii T, Liu JG, Ohmori T, Abe M, Wakisaka S, et al. Bone morphogenetic protein 4 is involved in cusp formation in molar tooth germ of mice. Eur J Oral Sci 2002;110: Fuenzalida M, Lemus S, Illanes J, Montiel E, Acuna O, Lemus D. Histochemical detection of sugar residues in lizard teeth (Liolaemus gravenhorst): a lectin-binding study. Biol Res 2000;33: Jurgelski Jr W. The opossum (Didelphis virginiana Kerr) as a biomedical model. I. Research perspective, husbandry and laboratory technics. Lab Anim Sci 1974;24: Stonehouse B, Gilmore D, editors. The biology of marsupials. London: Macmillan Press; Jacobs LL, Winkler DA, Murry PA. Modern mammal origins: evolutionary grades in the early cretaceous of North America. Proc Natl Acad Sci USA 1989;86: Tyndale-Biscoe H. Life of marsupials. Melbourne: CSIRO; Jernvall J, Keränen SVE, Thesleff I. Evolutionary modification of development in mammalian teeth: quantifying gene expression patterns and topography. Proc Natl Acad Sci USA 2000;97: Altschul SF, Madden TL, Schäffer AA, Chang J, Zhang Z, Miller W, et al. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 1997;25: Thompson JD, Higgins DG, Gibson TJ. ClustalW: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res 1994;22: Gasteiger E, Gattiker A, Hoogland C, Ivanyi L, Appel RD, Bairoch A. ExPASy: the proteomics server for in-depth protein knowledge and analysis. Nucleic Acids Res 2003;31: Lumsden AG. Pattern formation in the molar dentition of the mouse. J Biol Buccale 1979;7: Mina M, Kollar EJ. The induction of odontogenesis in nondental mesenchyme combined with early murine mandibular arch epithelium. Arch Oral Biol 1987;32: Xu X, Jeong L, Han J, Ito Y, Bringas Jr P, Chai Y. Developmental expression of smad1-7 suggests critical function of TGF-beta/BMP signaling in regulating epithelial mesenchymal interaction during tooth morphogenesis. Int J Dev Biol 2003;47: Torres CBB, Goes VS, Goes AM, Pacifico LGG, Silva GAB, Lopes Jr N et al. Fibroblast growth factor 9: cloning and immunolocalization during tooth development in Didelphis albiventris. Arch Oral Biol 2006;51: Jernvall J, Thesleff I. Reiterative signaling and patterning during mammalian tooth morphogenesis. Mech Dev 2000;92: Bitgood MJ, McMahon AP. Hedgehog and Bmp genes are coexpressed at many diverse sites of cell-cell interaction in the mouse embryo. Dev Biol 1995;172: Kriangkrai R, Iseki S, Eto K, Chareonvit S. Dual odontogenic origins develop at the early stage of rat maxillary incisor development. Anat Embryol 2006;211: Peters H, Balling R. Teeth where and how to make them. Trends Genet 1999;15: Dassule H, Lewis P, Bei M, Maas R, MacMahon AP. Sonic hedgehog regulates growth and morphogenesis of the tooth. Development 2000;127: Nakashima M. Induction of dentin formation on canine amputated pulp by recombinant human bone morphogenetic proteins (BMP)-2 and 4. J Dent Res 1994;733: Nakashima M, Nagasawa H, Yamada Y, Reddi H. Regulatory role of transforming growth factor-b, bone morphogenetic protein-2, and protein-4 on gene expression of extracellular matrix proteins and differentiation of dental pulp cells. Dev Biol 1994;162: Toyono T, Nakashima M, Kuhara S, Akamine A. Expression of TGF-superfamily receptors in dental pulp. J Dent Res 1997;76:

The Epithelial-Mesenchymal Interaction Plays a Role in the Maintenance of the Stem Cell Niche of Mouse Incisors via Fgf10 and Fgf9 Signaling

The Epithelial-Mesenchymal Interaction Plays a Role in the Maintenance of the Stem Cell Niche of Mouse Incisors via Fgf10 and Fgf9 Signaling The Open Biotechnology Journal, 2008, 2, 111-115 111 The Epithelial-Mesenchymal Interaction Plays a Role in the Maintenance of the Stem Cell Niche of Mouse Incisors via Fgf10 and Fgf9 Signaling Tamaki

More information

Development of teeth. 5.DM - Pedo

Development of teeth. 5.DM - Pedo Development of teeth 5.DM - Pedo Tooth development process of continuous changes in predetermined order starts from dental lamina A band of ectodermal cells growing from the epithelium of the embryonic

More information

ODONTOGENESIS- A HIGHLY COMPLEX CELL-CELL INTERACTION PROCESS

ODONTOGENESIS- A HIGHLY COMPLEX CELL-CELL INTERACTION PROCESS ODONTOGENESIS- A HIGHLY COMPLEX CELL-CELL INTERACTION PROCESS AMBRISH KAUSHAL, MALA KAMBOJ Department of Oral and Maxillofacial Pathology Career Post Graduate Institute of Dental Sciences and Hospital

More information

06 Tooth Development and Eruption

06 Tooth Development and Eruption + 06 Tooth Development and Eruption Tooth development Root development PDL and alveolar bone development Primary tooth eruption and shedding Permanent tooth eruption Q. Where and how tooth starts to form?

More information

evolution and development of primate teeth

evolution and development of primate teeth evolution and development of primate teeth diversity of mammalian teeth upper left molars buccal mesial distal lingual Jernvall & Salazar-Ciudad 07 trends in dental evolution many similar single-cusped

More information

Anti-Lamin B1/LMNB1 Picoband Antibody

Anti-Lamin B1/LMNB1 Picoband Antibody Anti-Lamin B1/LMNB1 Picoband Antibody Catalog Number:PB9611 About LMNB1 Lamin-B1 is a protein that in humans is encoded by the LMNB1 gene. The nuclear lamina consists of a two-dimensional matrix of proteins

More information

Chapter 2 Tooth Development

Chapter 2 Tooth Development Chapter 2 Tooth Development Experimental research on tooth development or odontogenesis is based very largely on the teeth of murine rodents (Butler 1967 ). Pioneering work by Shirley Glasstone on rat

More information

Tooth development in the 'crooked' mouse

Tooth development in the 'crooked' mouse /. Embryo!, exp. Morph. Vol. 41, pp. 279-287, 1977 279 Printed in Great Britain Company of Biologists Limited 1977 Tooth development in the 'crooked' mouse By J. A. SOFAER 1 From the University of Edinburgh,

More information

BCL11B Regulates Epithelial Proliferation and Asymmetric Development of the Mouse Mandibular Incisor

BCL11B Regulates Epithelial Proliferation and Asymmetric Development of the Mouse Mandibular Incisor BCL11B Regulates Epithelial Proliferation and Asymmetric Development of the Mouse Mandibular Incisor Kateryna Kyrylkova 1, Sergiy Kyryachenko 1, Brian Biehs 2 *, Ophir Klein 2, Chrissa Kioussi 1 *, Mark

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Tooth eruption and movement

Tooth eruption and movement Tooth eruption and movement Dr. Krisztián Nagy Diphydont dentition Deciduous dentition primary dentition Diphydont dentition Permanent dentition secondary dentition Mixed Dentition: Presence of both dentitions

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

The eternal tooth germ is formed at the apical end of continuously growing teeth*

The eternal tooth germ is formed at the apical end of continuously growing teeth* The eternal tooth germ is formed at the apical end of continuously growing teeth* Hayato Ohshima 1, Naohiro Nakasone 1, 2, Emi Hashimoto 1, Hideo Sakai 1, Kuniko Nakakura-Ohshima 3 and Hidemitsu Harada

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on

More information

Teeth, orofacial development and

Teeth, orofacial development and Teeth, orofacial development and cleft anomalies Miroslav Peterka Variability of jaws in vertebrates. (A) cartilaginous fish shark; (B) an example of a bone fish; (C ) amphibian frog; (D) reptile - turtle;

More information

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences. Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental

More information

Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein

Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.

More information

Sonic hedgehog regulates growth and morphogenesis of the tooth

Sonic hedgehog regulates growth and morphogenesis of the tooth Development 127, 4775-4785 (2000) Printed in Great Britain The Company of Biologists Limited 2000 DEV3251 4775 Sonic hedgehog regulates growth and morphogenesis of the tooth Hélène R. Dassule 1, Paula

More information

CAP STAGE. Ans 1 The following are the stages of tooth development :

CAP STAGE. Ans 1 The following are the stages of tooth development : Ans 1 The following are the stages of tooth development : 1. Bud stage 2. Cap stage 3. Bell stage 4. Advanced bell stage 5. Formation of Hertwig s epithelial root sheath BUD STAGE 1. Around the eighth

More information

The developing murine molar tooth germ provides a powerful

The developing murine molar tooth germ provides a powerful Conservation of early odontogenic signaling pathways in Aves YiPing Chen*, Yanding Zhang*, Ting-Xing Jiang, Amanda J. Barlow, Tara R. St. Amand, Yueping Hu, Shaun Heaney*, Philippa Francis-West, Cheng-Ming

More information

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry: General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems

More information

IMMUNOHISTOCHEMICAL PROFILE OF ODONTOGENIC EPITHELIUM OF DEVELOPING DOG TEETH (CANIS FAMILIARIS)

IMMUNOHISTOCHEMICAL PROFILE OF ODONTOGENIC EPITHELIUM OF DEVELOPING DOG TEETH (CANIS FAMILIARIS) IMMUNOHISTOCHEMICAL PROFILE OF ODONTOGENIC EPITHELIUM OF DEVELOPING DOG TEETH (CANIS FAMILIARIS) By SULETTE NEL Submitted in partial fulfilment of the requirements for the degree of Master of Science (Odontology)

More information

Tooth development, in common with the formation of many

Tooth development, in common with the formation of many Development of teeth in chick embryos after mouse neural crest transplantations Thimios A. Mitsiadis*, Yvonnick Chéraud, Paul Sharpe*, and Josiane Fontaine-Pérus *Department of Craniofacial Development,

More information

Australian Dental Journal

Australian Dental Journal Australian Dental Journal The official journal of the Australian Dental Association Australian Dental Journal 2014; 59:(1 Suppl): 55 80 doi: 10.1111/adj.12130 Three-dimensional analysis of the early development

More information

Plasmids Western blot analysis and immunostaining Flow Cytometry Cell surface biotinylation RNA isolation and cdna synthesis

Plasmids Western blot analysis and immunostaining Flow Cytometry Cell surface biotinylation RNA isolation and cdna synthesis Plasmids psuper-retro-s100a10 shrna1 was constructed by cloning the dsdna oligo 5 -GAT CCC CGT GGG CTT CCA GAG CTT CTT TCA AGA GAA GAA GCT CTG GAA GCC CAC TTT TTA-3 and 5 -AGC TTA AAA AGT GGG CTT CCA GAG

More information

Changes in the distribution of tenascin during tooth development

Changes in the distribution of tenascin during tooth development Development 101, 289-2% (1987) Printed in Great Britain The Company of Biologists Limited 1987 289 Changes in the distribution of tenascin during tooth development IRMA THESLEFF 1, ELEANOR MACKIE 2, SEPPO

More information

Supporting Information

Supporting Information Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)

More information

Ahtiainen et al., http :// /cgi /content /full /jcb /DC1

Ahtiainen et al., http ://  /cgi /content /full /jcb /DC1 Supplemental material JCB Ahtiainen et al., http ://www.jcb.org /cgi /content /full /jcb.201512074 /DC1 THE JOURNAL OF CELL BIOLOGY Figure S1. Distinct distribution of different cell cycle phases in the

More information

Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v)

Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) SUPPLEMENTARY MATERIAL AND METHODS Soft Agar Assay. For each cell pool, 100,000 cells were resuspended in 0.35% (w/v) top agar (LONZA, SeaKem LE Agarose cat.5004) and plated onto 0.5% (w/v) basal agar.

More information

CHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000)

CHAPTER 4 RESULTS. showed that all three replicates had similar growth trends (Figure 4.1) (p<0.05; p=0.0000) CHAPTER 4 RESULTS 4.1 Growth Characterization of C. vulgaris 4.1.1 Optical Density Growth study of Chlorella vulgaris based on optical density at 620 nm (OD 620 ) showed that all three replicates had similar

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Yatsenko AN, Georgiadis AP, Röpke A, et al. X-linked TEX11

More information

Cell Culture. The human thyroid follicular carcinoma cell lines FTC-238, FTC-236 and FTC-

Cell Culture. The human thyroid follicular carcinoma cell lines FTC-238, FTC-236 and FTC- Supplemental material and methods Reagents. Hydralazine was purchased from Sigma-Aldrich. Cell Culture. The human thyroid follicular carcinoma cell lines FTC-238, FTC-236 and FTC- 133, human thyroid medullary

More information

Restriction of sonic hedgehog signalling during early tooth development

Restriction of sonic hedgehog signalling during early tooth development Research article 2875 Restriction of sonic hedgehog signalling during early tooth development Martyn T. Cobourne 1, Isabelle Miletich 2 and Paul T. Sharpe 2, * 1 Department of Craniofacial Development

More information

Development of the dentition

Development of the dentition 4 Development of the dentition 85 Humans have two dentitions, the deciduous (primary) and permanent (secondary). Each dentition is heterodont, meaning that it consists of teeth with different shapes and

More information

INTRODUCTION. Developmental Biology 229, (2001) doi: /dbio , available online at

INTRODUCTION. Developmental Biology 229, (2001) doi: /dbio , available online at Developmental Biology 229, 443 455 (2001) doi:10.1006/dbio.2000.9955, available online at http://www.idealibrary.com on TNF Signaling via the Ligand Receptor Pair Ectodysplasin and Edar Controls the Function

More information

SUPPLEMENTAL INFORMATION

SUPPLEMENTAL INFORMATION SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The

More information

Generation of tooth periodontium complex structures using high-odontogenic potential dental epithelium derived from mouse embryonic stem cells

Generation of tooth periodontium complex structures using high-odontogenic potential dental epithelium derived from mouse embryonic stem cells Zhang et al. Stem Cell Research & Therapy (2017) 8:141 DOI 10.1186/s13287-017-0583-5 RESEARCH Open Access Generation of tooth periodontium complex structures using high-odontogenic potential dental epithelium

More information

Mesial Step Class I or Class III Dependent upon extent of step seen clinically and patient s growth pattern Refer for early evaluation (by 8 years)

Mesial Step Class I or Class III Dependent upon extent of step seen clinically and patient s growth pattern Refer for early evaluation (by 8 years) Orthodontics and Dentofacial Development Overview Development of Dentition Treatment Retention and Relapse Growth of Naso-Maxillary Complex Develops postnatally entirely by intramenbranous ossification

More information

Epithelial-mesenchymal interactions are required for msx 1 and msx 2 gene expression in the developing murine molar tooth

Epithelial-mesenchymal interactions are required for msx 1 and msx 2 gene expression in the developing murine molar tooth Development 117, 461-470 (1993) Printed in Great Britain The Company of Biologists Limited 1993 461 Epithelial-mesenchymal interactions are required for msx 1 and msx 2 gene expression in the developing

More information

Msx1 controls inductive signaling in mammalian tooth morphogenesis

Msx1 controls inductive signaling in mammalian tooth morphogenesis Development 122, 3035-3044 (1996) Printed in Great Britain The Company of Biologists Limited 1996 DEV9494 3035 Msx1 controls inductive signaling in mammalian tooth morphogenesis YiPing Chen, Marianna Bei,

More information

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway

Supplemental Information. Otic Mesenchyme Cells Regulate. Spiral Ganglion Axon Fasciculation. through a Pou3f4/EphA4 Signaling Pathway Neuron, Volume 73 Supplemental Information Otic Mesenchyme Cells Regulate Spiral Ganglion Axon Fasciculation through a Pou3f4/EphA4 Signaling Pathway Thomas M. Coate, Steven Raft, Xiumei Zhao, Aimee K.

More information

Supplemental Data. Wnt/β-Catenin Signaling in Mesenchymal Progenitors. Controls Osteoblast and Chondrocyte

Supplemental Data. Wnt/β-Catenin Signaling in Mesenchymal Progenitors. Controls Osteoblast and Chondrocyte Supplemental Data Wnt/β-Catenin Signaling in Mesenchymal Progenitors Controls Osteoblast and Chondrocyte Differentiation during Vertebrate Skeletogenesis Timothy F. Day, Xizhi Guo, Lisa Garrett-Beal, and

More information

Supplemental Materials and Methods Plasmids and viruses Quantitative Reverse Transcription PCR Generation of molecular standard for quantitative PCR

Supplemental Materials and Methods Plasmids and viruses Quantitative Reverse Transcription PCR Generation of molecular standard for quantitative PCR Supplemental Materials and Methods Plasmids and viruses To generate pseudotyped viruses, the previously described recombinant plasmids pnl4-3-δnef-gfp or pnl4-3-δ6-drgfp and a vector expressing HIV-1 X4

More information

Analysis of small RNAs from Drosophila Schneider cells using the Small RNA assay on the Agilent 2100 bioanalyzer. Application Note

Analysis of small RNAs from Drosophila Schneider cells using the Small RNA assay on the Agilent 2100 bioanalyzer. Application Note Analysis of small RNAs from Drosophila Schneider cells using the Small RNA assay on the Agilent 2100 bioanalyzer Application Note Odile Sismeiro, Jean-Yves Coppée, Christophe Antoniewski, and Hélène Thomassin

More information

Ability of Hydroxyapatite-Bone Morphologenetic Protein (BMP) Complex to Induce Dentin Formation in Dogs

Ability of Hydroxyapatite-Bone Morphologenetic Protein (BMP) Complex to Induce Dentin Formation in Dogs Okajimas Folia Anat. Jpn., 70(5): 195-202, December, 1993 Ability of Hydroxyapatite-Bone Morphologenetic Protein (BMP) Complex to Induce Dentin Formation in Dogs By Fumihiko SUWA, Lianjia Yang, Yoshikuni

More information

Contribution of the Tooth Bud Mesenchyme to Alveolar Bone

Contribution of the Tooth Bud Mesenchyme to Alveolar Bone JOURNAL OF EXPERIMENTAL ZOOLOGY (MOL DEV EVOL) 312B (2009) Contribution of the Tooth Bud Mesenchyme to Alveolar Bone LISA DIEP 1, EVA MATALOVA 2,3, THIMIOS A. MITSIADIS 4, AND ABIGAIL S. TUCKER 1 1 Department

More information

A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS

A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism SUPPLEMENTARY FIGURES, LEGENDS AND METHODS A Hepatocyte Growth Factor Receptor (Met) Insulin Receptor hybrid governs hepatic glucose metabolism Arlee Fafalios, Jihong Ma, Xinping Tan, John Stoops, Jianhua Luo, Marie C. DeFrances and Reza Zarnegar

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

SOMAPLEX REVERSE PHASE PROTEIN MICROARRAY HUMAN KIDNEY TUMOR & NORMAL TISSUE

SOMAPLEX REVERSE PHASE PROTEIN MICROARRAY HUMAN KIDNEY TUMOR & NORMAL TISSUE SOMAPLEX REVERSE PHASE PROTEIN MICROARRAY HUMAN KIDNEY TUMOR & NORMAL TISSUE 45 CLINICAL CASES SERIAL DILUTION MULTIPLE PROTEIN CONCENTRATION QUANTITATIVE ASSAY PRODUCT NUMBER: PM1-001-N SOMAPLEX REVERSE

More information

Proteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival

Proteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival Supplementary Information for Proteomic profiling of small-molecule inhibitors reveals dispensability of MTH1 for cancer cell survival Tatsuro Kawamura 1, Makoto Kawatani 1, Makoto Muroi, Yasumitsu Kondoh,

More information

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum

More information

Inhibition of tooth germ differentiation in vitro

Inhibition of tooth germ differentiation in vitro /. Embryo!, exp. Morph. Vol. 50, pp. 99-109, 1979 Printed in Great Britain Company of Biologists Limited 1979 99 Inhibition of tooth germ differentiation in vitro By KIRSTI HURMERINTA, 1 IRMA THESLEFF

More information

Supplementary data Supplementary Figure 1 Supplementary Figure 2

Supplementary data Supplementary Figure 1 Supplementary Figure 2 Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna

More information

Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent Protein.

Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent Protein. prfp-vector RFP Exon1 Intron RFP Exon2 prfp-mir-124 mir-93/124 RFP Exon1 Intron RFP Exon2 Untransfected prfp-vector prfp-mir-93 prfp-mir-124 Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent

More information

Sequencing-Based Identification of a Novel Coronavirus in Ferrets with Epizootic Catarrhal Enteritis and Development of Molecular Diagnostic Tests

Sequencing-Based Identification of a Novel Coronavirus in Ferrets with Epizootic Catarrhal Enteritis and Development of Molecular Diagnostic Tests Sequencing-Based Identification of a Novel Coronavirus in Ferrets with Epizootic Catarrhal Enteritis and Development of Molecular Diagnostic Tests A. Wise, Matti Kiupel,, C. Isenhour, R. Maes Coronaviruses

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

Dentin Formation(Dentinogenesis)

Dentin Formation(Dentinogenesis) Lecture four Dr. Wajnaa Oral Histology Dentin Formation(Dentinogenesis) Dentinogenesis begins at the cusp tips after the odontoblasts have differentiated and begin collagen production. Dentinogenesis growth

More information

Independent regulation of Dlx2 expression in the epithelium and mesenchyme of the first branchial arch

Independent regulation of Dlx2 expression in the epithelium and mesenchyme of the first branchial arch Development 127, 217-224 (2000) Printed in Great Britain The Company of Biologists Limited 2000 DEV2450 217 Independent regulation of Dlx2 expression in the epithelium and mesenchyme of the first branchial

More information

Tooth organogenesis and regeneration

Tooth organogenesis and regeneration Tooth organogenesis and regeneration Irma Thesleff and Mark Tummers, Developmental Biology Program, Institute of Biotechnology, PO Box 56, University of Helsinki, FIN-00014, Helsinki, Finland Table of

More information

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage

More information

Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION

Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION Supplementary Information POLO-LIKE KINASE 1 FACILITATES LOSS OF PTEN-INDUCED PROSTATE CANCER FORMATION X. Shawn Liu 1, 3, Bing Song 2, 3, Bennett D. Elzey 3, 4, Timothy L. Ratliff 3, 4, Stephen F. Konieczny

More information

Integrin v 3 targeted therapy for Kaposi s sarcoma with an in vitro evolved antibody 1

Integrin v 3 targeted therapy for Kaposi s sarcoma with an in vitro evolved antibody 1 Integrin v 3 targeted therapy for Kaposi s sarcoma with an in vitro evolved antibody 1 CHRISTOPH RADER, 2 MIKHAIL POPKOV, JOHN A. NEVES, AND CARLOS F. BARBAS III 2 Department of Molecular Biology and The

More information

Waking-up the Sleeping Beauty: Recovery of the Ancestral Bird Odontogenic Program

Waking-up the Sleeping Beauty: Recovery of the Ancestral Bird Odontogenic Program JOURNAL OF EXPERIMENTAL ZOOLOGY (MOL DEV EVOL) 306B:227 233 (2006) Waking-up the Sleeping Beauty: Recovery of the Ancestral Bird Odontogenic Program THIMIOS A. MITSIADIS 1, JAVIER CATON 1, AND MARTYN COBOURNE

More information

JOURNAL OF EXPERIMENTAL ZOOLOGY (MOL DEV EVOL) 306B: (2006)

JOURNAL OF EXPERIMENTAL ZOOLOGY (MOL DEV EVOL) 306B: (2006) JOURNAL OF EXPERIMENTAL ZOOLOGY (MOL DEV EVOL) 306B:183 203 (2006) Developmental and Evolutionary Origins of the Vertebrate Dentition: Molecular Controls for Spatio-temporal Organisation of Tooth Sites

More information

and Non-Human MODULE No.17: Structural Variation in Teeth- Human and Non-Human

and Non-Human MODULE No.17: Structural Variation in Teeth- Human and Non-Human SUBJECT Paper No. and Title Module No. and Title Module Tag MODULE No.17: Structural Variation in Teeth- Human and FSC_P11_M17 TABLE OF CONTENTS 1. Learning Outcomes 2. Introduction 3. Structure of Human

More information

Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2],

Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2], Supplementary information Methods Cells and viruses. Human isolates (A/Kawasaki/173/01 [H1N1], A/Yokohama/2057/03 [H3N2], and A/Hong Kong/213/03 [H5N1]) were grown in Madin-Darby canine kidney (MDCK) cells

More information

Disturbed tooth germ development in the absence of MINT in the cultured mouse mandibular explants

Disturbed tooth germ development in the absence of MINT in the cultured mouse mandibular explants Disturbed tooth germ development in the absence of MINT in the cultured mouse mandibular explants Molecular Biology Reports An International Journal on Molecular and Cellular Biology ISSN 0301-4851 Volume

More information

Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot system

Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot system Debiais-Thibaud et al. BMC Evolutionary Biology (2015) 15:292 DOI 10.1186/s12862-015-0557-0 RESEARCH ARTICLE Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot

More information

Semester Credits: 3 Lecture Hours: 3. Prerequisites:

Semester Credits: 3 Lecture Hours: 3. Prerequisites: Revised: Fall 2015 Semester Credits: 3 Lecture Hours: 3 21THistology DNH 115 Admission into dental hygiene program. Prerequisites: Course Description: Presents a study of the microscopic and macroscopic

More information

TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer

TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer AD Award Number: TITLE: The Role of hcdc4 as a Tumor Suppressor Gene in Genomic Instability Underlying Prostate Cancer PRINCIPAL INVESTIGATOR: Audrey van Drogen, Ph.D. CONTRACTING ORGANIZATION: Sidney

More information

Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in

Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right

More information

Immunostaining was performed on tumor biopsy samples arranged in a tissue-microarray format or on

Immunostaining was performed on tumor biopsy samples arranged in a tissue-microarray format or on Supplemental Methods Immunohistochemical Analyses Immunostaining was performed on tumor biopsy samples arranged in a tissue-microarray format or on prostatectomy sections obtained post-study. Briefly,

More information

Arrangement of posterior artificial teeth Standardized parameters Curve of Wilson Curve of Spee

Arrangement of posterior artificial teeth Standardized parameters Curve of Wilson Curve of Spee . Arrangement of posterior artificial teeth Posterior teeth are set up in tight centric occlusion. The mandibular teeth are set in the wax occlusion rim over the residual ridge in their ideal buccolingual

More information

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial Supplementary Information Häuselmann et al. Monocyte induction of E-selectin-mediated endothelial activation releases VE-cadherin junctions to promote tumor cell extravasation in the metastasis cascade

More information

Index. Note: Page numbers of article titles are in boldface type.

Index. Note: Page numbers of article titles are in boldface type. Index Note: Page numbers of article titles are in boldface type. A Alginate, tooth-shaped, for constructs, encapsulated pulp cells in, 589 590 Antibiotic paste, triple, change in root length and width

More information

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I

More information

Supplementary Materials and Methods

Supplementary Materials and Methods Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis

More information

BIOL2005 WORKSHEET 2008

BIOL2005 WORKSHEET 2008 BIOL2005 WORKSHEET 2008 Answer all 6 questions in the space provided using additional sheets where necessary. Hand your completed answers in to the Biology office by 3 p.m. Friday 8th February. 1. Your

More information

Fundamental & Preventive Curvatures of Teeth and Tooth Development. Lecture Three Chapter 15 Continued; Chapter 6 (parts) Dr. Margaret L.

Fundamental & Preventive Curvatures of Teeth and Tooth Development. Lecture Three Chapter 15 Continued; Chapter 6 (parts) Dr. Margaret L. Fundamental & Preventive Curvatures of Teeth and Tooth Development Lecture Three Chapter 15 Continued; Chapter 6 (parts) Dr. Margaret L. Dennis Proximal contact areas Contact areas are on the mesial and

More information

Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot system.

Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot system. Tooth and scale morphogenesis in shark: an alternative process to the mammalian enamel knot system Mélanie Debiais-Thibaud, Roxane Chiori, Sébastien Enault, Silvan Oulion, Isabelle Germon, Camille Martinand-Mari,

More information

CONTRACTING ORGANIZATION: University of Southern California Los Angeles, CA 90033

CONTRACTING ORGANIZATION: University of Southern California Los Angeles, CA 90033 AD Award Number: W81XWH-07-01-0264 TITLE: Function of Klotho and is MicroRNA in Prostate Cancer and Aging PRINCIPAL INVESTIGATOR: Shao-Yao Ying, Ph.D. CONTRACTING ORGANIZATION: University of Southern California

More information

Origin of Odontogenic Cysts & Tumors

Origin of Odontogenic Cysts & Tumors Origin of Odontogenic Cysts & Tumors Odontogenic Apparatus Origin of Odontogenic Cysts & Tumors Odontogenic Apparatus Remnants of dental lamina Reduced enamel epithelium Odontogenic rests Basal cell layer

More information

Dental Morphology and Vocabulary

Dental Morphology and Vocabulary Dental Morphology and Vocabulary Palate Palate Palate 1 2 Hard Palate Rugae Hard Palate Palate Palate Soft Palate Palate Palate Soft Palate 4 Palate Hard Palate Soft Palate Maxillary Arch (Maxilla) (Uppers)

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: van Seters M, van Beurden M, ten Kate FJW, et al. Treatment

More information

Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation

Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation Construction of a hepatocellular carcinoma cell line that stably expresses stathmin with a Ser25 phosphorylation site mutation J. Du 1, Z.H. Tao 2, J. Li 2, Y.K. Liu 3 and L. Gan 2 1 Department of Chemistry,

More information

Cellular Physiology and Biochemistry

Cellular Physiology and Biochemistry Original Paper 2015 The Author(s). 2015 Published The Author(s) by S. Karger AG, Basel Published online: November 27, 2015 www.karger.com/cpb Published by S. Karger AG, Basel 2194 1421-9778/15/0376-2194$39.50/0

More information

Medical NBDE-II. Dental Board Exams Part I.

Medical NBDE-II. Dental Board Exams Part I. Medical NBDE-II Dental Board Exams Part I http://killexams.com/exam-detail/nbde-ii Question: 149 Anatomically, the term "clinical root" can be defined as which of the following: A. The space in the tooth

More information

The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein

The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein THESIS BOOK The functional investigation of the interaction between TATA-associated factor 3 (TAF3) and p53 protein Orsolya Buzás-Bereczki Supervisors: Dr. Éva Bálint Dr. Imre Miklós Boros University of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with

More information

Anti-PD-L1 antibody [28-8] ab205921

Anti-PD-L1 antibody [28-8] ab205921 Anti-PD-L1 antibody [28-8] ab205921 2 Abreviews 16 References 15 Images Overview Product name Anti-PD-L1 antibody [28-8] Description Tested applications Species reactivity Immunogen Rabbit monoclonal [28-8]

More information

AIDS - Knowledge and Dogma. Conditions for the Emergence and Decline of Scientific Theories Congress, July 16/ , Vienna, Austria

AIDS - Knowledge and Dogma. Conditions for the Emergence and Decline of Scientific Theories Congress, July 16/ , Vienna, Austria AIDS - Knowledge and Dogma Conditions for the Emergence and Decline of Scientific Theories Congress, July 16/17 2010, Vienna, Austria Reliability of PCR to detect genetic sequences from HIV Juan Manuel

More information

T O O T H A T L A S C O U R S E G U I D E A S S I S T A N T E D I T I O N

T O O T H A T L A S C O U R S E G U I D E A S S I S T A N T E D I T I O N T O O T H A T L A S C O U R S E G U I D E A S S I S T A N T E D I T I O N The information in this guide was prepared by ehuman with contributions from: Cara Miyasaki, RDHEF, MS, Foothill College Kay Murphy,

More information

Applied Equine Dental Development

Applied Equine Dental Development Published in IVIS with the permission of the AAEP Close this window to return to IVIS Applied Equine Dental Development Kirstie Dacre, BVMS, MSc, Cert EM (Int Med), PhD Author s address: Veterinary Teaching

More information

It has been shown that in human embryos and fetuses with cleft lips

It has been shown that in human embryos and fetuses with cleft lips SCIENTIFIC FOUNDATION Crown Morphologic Abnormalities in the Permanent: Dentition of Patients With Cleft Lip and Palate Ma amon A. Rawashdeh, BDS, MScD, FDSRCS (En),*Þ and Emad Omar Abu Sirdaneh, BDS,

More information

(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment

(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.

More information

WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT. Product: Alere q HIV-1/2 Detect WHO reference number: PQDx

WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT. Product: Alere q HIV-1/2 Detect WHO reference number: PQDx WHO Prequalification of In Vitro Diagnostics PUBLIC REPORT Product: Alere q HIV-1/2 Detect WHO reference number: PQDx 0226-032-00 Alere q HIV-1/2 Detect with product codes 270110050, 270110010 and 270300001,

More information

Product Datasheet. CD133 Antibody NB Unit Size: 0.1 mg

Product Datasheet. CD133 Antibody NB Unit Size: 0.1 mg Product Datasheet CD133 Antibody NB120-16518 Unit Size: 0.1 mg Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 8 Protocols, Publications, Related Products,

More information

Study on the expression of MMP-9 and NF-κB proteins in epithelial ovarian cancer tissue and their clinical value

Study on the expression of MMP-9 and NF-κB proteins in epithelial ovarian cancer tissue and their clinical value Study on the expression of MMP-9 and NF-κB proteins in epithelial ovarian cancer tissue and their clinical value Shen Wei 1,a, Chen Juan 2, Li Xiurong 1 and Yin Jie 1 1 Department of Obstetrics and Gynecology,

More information

1. What is the highest and sharpest cusp on the lower first deciduous molar? 2. Which of the following is NOT the correct location of an embrasure?

1. What is the highest and sharpest cusp on the lower first deciduous molar? 2. Which of the following is NOT the correct location of an embrasure? 1 1. What is the highest and sharpest cusp on the lower first deciduous molar? a. mesiobuccal b. distobuccal c. distolingual d.mesiolingual 2. Which of the following is NOT the correct location of an embrasure?

More information