Supplementary Information Titles
|
|
- Rudolph Hensley
- 5 years ago
- Views:
Transcription
1 Journal: Nature Medicine Supplementary Information Titles Article Title: Podocyte secreted Angiopoietin-like mediates proteinuria in glucocorticoid sensitive nephrotic syndrome Corresponding Author: Sumant Singh Chugh Supplementary Items and Titles: Supplementary Figure : Changes in mrna expression in experimental glomerular disease. Supplementary Figure : Experimental studies in -/- mice, transgenic mice, wild type rats, and transgenic rats. Supplementary Figure : Characterization of transgenic rats. Supplementary Figure : Serum levels in transgenic (TG) rats, and urine in rats with experimental nephrotic syndrome. Supplementary Figure 5: Assessment of GBM charge in transgenic (TG) rats and mice. Supplementary Figure 6: Assessment of glomerular sialylation. Supplementary Figure 7: Characterization of secreting HEK9 and mouse GEC stable cell lines. Supplementary Figure 8: Albuminuria in ManNAc - treated NPHS- transgenic (TG) rats, and oligomerization of recombinant and transgene expressed. Supplementary Figure 9: Confocal assessment of glomerular expression in human minimal change disease (MCD). Supplementary Figure : Plasma and urine in human primary glomerular disease. Supplementary Figure : Schematic representation of the role of podocyte secreted in nephrotic syndrome. Supplementary Table : Brief clinical profile of individuals whose plasma and urine were assessed for presence and patterns of expression by Western blot. Supplementary Table : List of primers and probes used for Taqman real time PCR. Supplementary Methods Supplementary References Nature Medicine: doi:.8/nm.6
2 Flourescence Blue Red γ NTS NTS PAN Blue Red PAN Day Green PAN Day 6 Orange PAN Day PHN Blue Red PHN Day Green PHN Day 6 Orange PHN Day anti-thy. Blue Red Thy. Day Green Thy. Day Supplementary Figure : Changes in mrna expression in experimental glomerular disease. Real Time PCR tracings for changes in glomerular gene expression shown in Figs. b, e s (control) CG Blue Red CG Day Green CG Day Orange CG Day Nature Medicine: doi:.8/nm.6
3 * PAN a 6 b EFP c 5 FP Antisense EFP d f Spot urine albumin / creatinine +/+ Sheep Ig -/- Sheep Ig +/+ NTS -/- NTS CDAP merged control /+ NTS Fold increase in cortical mrna expression e WT mouse /- NTS *** TG mouse Heterozygous NPHS- TG rat Glomeruli Red TG rat Blue Wild type rat Heterozygous ap- TG rat White adipose tissue Red Blue TG rat Wild type rat Heterozygous ap- TG rat Brown adipose tissue Red TG rat Blue Wild type rat Antisense Sense Sense PAN Antisense PAN Tubules Antisense Tubules Supplementary Figure : Experimental studies in -/- mice, transgenic mice, wild type rats, and transgenic rats. (a) Albuminuria in +/+ and -/- mice 8 hours after injection of γ-nts. (b) Electron microscopy of the glomerular capillary loop in NTS injected +/+ and -/- mice. -/- mice had. +. % (mean + SE) foot process effacement compared to diffuse effacement in +/+ mice. (c) Digoxigenin labeled in situ hybridization for expression in PAN Day 6 and control rats. Signal for expression (dark brown / black) in a peripheral distribution is indicated by arrows. (d) Confocal imaging of transgenic mouse glomeruli showing co-localization of and CDAP expression. (e) Fold increase in kidney cortical mrna expression in transgenic mice. (f) Real time PCR tracings for studies on glomerular and adipose tissue expression in transgenic rats shown in Fig. f. Glomerular control was 8s, adipose tissue control was GAPDH. Scale bars (b).5 µm (c) µm (d) µm. * P<.5, *** P<.. Nature Medicine: doi:.8/nm.6
4 a b NPHS- TG NPHS- TG NPHS- TG Antisense Antisense Sense Antisense Antisense WT WT c N. S. NPHS- TG month * d 5 e Albuminuria (mcg per 8 hours) WT M Hetero.TG M * WT F Homo. TG F Percentage of intact albumin (densitometry) 8 6 WT rat ap- NPHS- MCD relapse MN relapse PAN rat Pulse rate (beats per min) or blood pressure (mm Hg) Pulse WT M Sense Systolic BP Diastolic BP WT *** *** *** MAP Heterozygous TG M Supplementary Figure : Characterization of transgenic rats. (a) Low power electron micrograph of a 5 month old homozygous NPHS- transgenic rat. Arrows point towards effaced foot processes. (b) Early exposure in situ hybridization image for expression in NPHS- transgenic and wild type rat glomeruli. Arrows point towards a prominent peripheral pattern in transgenic rats consistent with increased podocyte expression. A faint signal was noted in wild type rats. Tubular expression was not increased in transgenic rats. (c) Albuminuria in one month old NPHS- transgenic rats. (d) Densitometry of the intact albumin 7 kda band expressed as a percentage of whole lane densitometry in Fig. d. Percentage of intact albumin in urine was significantly higher in NPHS- transgenic rats compared to all other groups (P <.), except MCD relapse (N. S.,not significant). (e) Blood pressure (BP) and pulse rate in 5 month old male wild type and heterozygous NPHS- transgenic rats. MAP, mean arterial pressure. Scale bars (a) µm (b) µm. * P <.5, *** P <.. Nature Medicine: doi:.8/nm.6
5 a 5 *** b c d pi pi D gel markers WT rat ap- TG rat NPHS- TG rat pi D gel markers WT rat ap- TG rat NPHS- TG rat Western blot : anti- Densitometry units e WT NTS f ap- Anti- PAN PAN Anti- NTS PAN PI ** NPHS- NTS PI WT rat ap- TG rat NPHS- TG rat Supplementary Figure : Serum levels in transgenic (TG) rats, and urine in rats with experimental nephrotic syndrome. (a) D gel and Western blot assessment of circulating in serum from wild type and transgenic rats. Area magnified in panel b is demarcated by green rectangles. (b) Magnified images of blots in panel a show presence of fragments and oligomers in the circulation. (c) Densitometry of circulating seen in panel b in wild type and transgenic rats. (d) Ponceau red stained nitrocellulose membrane images (equal loading and transfer controls) taken immediately after transfer of D gels shown in panels a and b. (e) Western blot of urine from rats injected with γ NTS showed presence of low order oligomers. (f) Similar oligomers were noted in urine from PAN Day 6 rats. ** P <., *** P <. Nature Medicine: doi:.8/nm.6
6 a WT mouse d TG mouse b Percentage change in GBM alcian blue staining densitometry TG mouse *** NPHS- TG rat *** ap- TG rat c WT rat NPHS- TG rat WT rat NPHS- TG rat Supplementary Figure 5: Assessment of GBM charge in transgenic (TG) rats and mice. (a) Alcian blue staining of the GBM in month old wild type and transgenic mice. (b) Densitometry of glomerular alcian blue staining in month old trangenic rats and mice, expressed as a percentage difference from their wild type counterparts. (c) Confocal assessment of GBM heparan sulfate proteoglycan expression in 5 month old wild type and NPHS- transgenic rats. (d) Assessment of GBM charge in 5 month old wild type and NPHS- transgenic rats by the polyethyleneimine method. Arrows in the electron micrographs point towards the normal GBM charge in the subepithelial and subendothelial regions. Loss of GBM charge, effacement of foot processes and clustering of cell surface charge were noted in transgenic rat glomeruli. Scale bars (a) µm (c) µm (d). µm. *** P<. Nature Medicine: doi:.8/nm.6
7 a pi range (non linear) Neutral pi High pi b c d 5 Anti- HEK 9 control GEC control 5 5 PAN Anti- Anti-pThr PAN + glucocort. Anti- e PAN PAN + glucocorticoids f g HEK 9 ManNAc 5 N. S. 5 5 WT TG + TG + control ManNAc 6 pi range (non linear) Densitometry units h GEC ManNAc WT rat WT rat NPHS- TG control fed fed NPHS- TG control fed ManNAc fed (antibody blot) ManNAc fed (lectin blot) NPHS- TG ManNAc fed Supplementary Figure 6 NPHS- TG ManNAc fed Nature Medicine: doi:.8/nm.6
8 Supplementary Figure 6: Assessment of glomerular sialylation. (a) D gel electrophoresis and Western blot of protein from perfused glomeruli in control, PAN Day 6, and glucocorticoid treated PAN Day 6 rats revealed presence of small amounts of fragments (red arrow) and monomers (blue arrow), and larger amounts of low order oligomers (pink, orange arrows) migrating at neutral or high pi. Magnified images of oligomers enclosed in red boxes are shown in Fig. a. Neutral pi fragments, but not oligomers, were reactive with anti - phosphothreonine antibodies. (b) Ponceau red stained nitrocellulose membrane images (equal loading and transfer controls) taken immediately after transfer of D gels shown in panel a and Fig. a. (c) Equal loading and transfer controls for Fig. c (as described for panel b). (d) Equal loading and transfer controls for Fig. d (as described for panel b). (e) Equal loading and transfer controls for Fig. e (as described for panel b). (f) D gel electrophoresis and Western blots for glomerular podocalyxin expression on Day of experiment described in Fig. e. In addition, podocalyxin expression in wild type rats was also assessed. (g) Densitometry studies from blots in panel f. (h) Equal loading and transfer controls for panel f (as described for panel b). N. S., not significant, TG, transgenic Nature Medicine: doi:.8/nm.6
9 a b HEK9 HEK9 c 8 Fold increase in mrna expression 8 6 HEK 9 - control line *** HEK 9 - line -HEK9 -HEK kda 55 kda Trypsin inhibitor pi.5 pi to BSA pi Actin pi 5-5. Conalbumin pi GAPDH pi Carbonic anhydrase pi Myoglobin pi 7. d Fold increase in mrna expression Western blot Preimmune serum Anti- antibody Mouse GEC - control line *** Mouse GEC - line e Clone -FA Clone 7-HD Clone -FA 5 kda Clone 7-HD Clone -FA Western blot & markers superimposed Clone 7-HD Anti- Preimmune GelCode antibody blue serum Western blot Supplementary Figure 7: Characterization of secreting HEK9 and mouse GEC stable cell lines. (a) Analysis of mrna upregulation in the -HEK9 stable cell line. Expression in the control (empty vector) stable cell line was given an arbitrary value of. (b) D gel electrophoresis and Western blot for in supernatant from -HEK9 and control-hek9 stable cell lines collected under serum free conditions. (c) A molecular weight marker gel (top image) was superimposed with the right lower image from panel b to generate a composite image (bottom image) using Adobe Photoshop. Most of the intact 7 kda monomer secreted by the -HEK9 stable cell line migrates between pi 8. and 8.5. (d) Analysis of mrna upregulation in the -GEC stable cell line. (e) Western blot and GelCode blue analysis of recombinant protein secreted by different clones of the -GEC stable cell line. *** P <. Nature Medicine: doi:.8/nm.6
10 7 6 8 a Albuminuria (µg per 8 hours) Albuminuria (µg per 8 hours) c AM ap- TG rat plasma ManNAc dose (mg/ml) 8 Day Day ManNAc dose (mg/ml) 8 Day Day Day 6 Recomb Day 9 Day Day 6 Day 6576 Day 6 Day 9 Day Day 6 Day high order oligomers middle order oligomers 7 low order oligomers NPHS- TG rat glom. ap- TG rat plasma b Albuminuria (µg per 8 hours) Albuminuria (µg per 8 hours) NPHS- TG rat glom. 6 6 Recomb. Anti-AM Ab. Anti- Ab. Anti- Ab. 5% gel, hour 5% gel,.5 hours ManNAc mg/ml Day - Day Day Day 9 Day Day Day Day ManNAc mg/ml 68 Day - Day Day Day 9 Day Day Day Day Albuminuria (µg per 8 hours) Albuminuria (µg per 8 hours) Day - Day ManNAc mg/ml 685 Day - Day Day Day 9 Day Day Day Day ManNAc mg/ml 686 Day Day 9 Day Day Day Day Supplementary Figure 8: Albuminuria in ManNAc - treated NPHS- transgenic (TG) rats, and oligomerization of recombinant and transgene expressed. (a) Representative tracings of albuminuria from pilot studies, in which increasing doses of ManNAc were shown to reversibly reduce albuminuria in NPHS- transgenic rats with moderate to heavy albuminuria. (b) Individual tracings of albuminuria from four NPHS- transgenic rats that competed both the ManNAc and washout phase of the 6 day study. Two urine collections days apart were conducted prior to the start of the study to ensure that these rats developed increasing albuminuria with time. (c) Non-reducing SDS PAGE and Western blot to assess for oligomerization of circulating and glomerular expressed from transgenic rats, and recombinant from the HEK9 stable cell line. Gels were run for hour (left) or.5 hours (right) to study all oligomeric forms (low, middle and high order oligomers). α macroglobulin (AM) was used as a high molecular weight market (7 kda). Nature Medicine: doi:.8/nm.6
11 a b MCD Laminin merge High power MCD Laminin merge Laminin merge High power MCD MCD Nephrin merge MCD Laminin merge High power Nephrin merge High power MCD 5 MCD Laminin merge PECAM merge High power MCD 5 High power PECAM merge Aquaporin merge Proximal tubule Supplementary Figure 9: Confocal assessment of glomerular expression in human minimal change disease (MCD). (a) Increased expression and co-localization of with podocyte (nephrin), GBM (laminin) and endothelial cell (PECAM) markers in the biopsy of an individual with MCD. (b) Biopsies from additional individuals with MCD were stained for and other glomerular capillary loop markers listed above. Arrows in high power images point towards overlap of staining patterns. Lowermost panels show presence of in proximal tubules (marked by aquaporin ), most likely due to tubular uptake, since upregulation of mrna expression is not seen in tubules in experimental MCD (puromycin nephrosis) by in situ hybridization. Scale bars µm. Nature Medicine: doi:.8/nm.6
12 a c MCD 6 MCD 6 MCD 7 MCD 8 PI Anti- pi range (non linear) 6 9 MCD relapse Ig heavy chain oligomer fragments Western blot FSGS PI FSGS FSGS FSGS Anti- pi range (non linear) 6 9 MN Ig heavy chain b oligomer e 7 5 MCD 9 Albumin (bleed through) fragments 7 5 pi range 5-8, non linear FSGS fragments Western blot with anti- pi range -, non linear MCD 9 FSGS d Densitometry units MCD remission 8 6 MCD relapse *** MCD remission MN *** FSGS *** FSGS MCD relapse MCD remission Supplementary Figure : Plasma and urine in human primary glomerular disease. Clinical data shown in Supplementary Table. (a) Reducing SDS PAGE and Western blot of urine shows presence of oligomers in individuals with minimal change disease (MCD), and fragments in focal and segmental glomerulosclerosis (FSGS) patients. (b) D gel electrophoresis and Western blot of urine (left panels) confirms the presence of oligomers and fragments in MCD, and only fragments in FSGS. Ponceau red stained nitrocellulose membrane images (equal loading and transfer controls) taken immediately after transfer of D gels are also shown (right panels). (c) Representative D gel electrophoresis and Western blot of plasma from individuals with MCD, FSGS and membranous nephropathy (MN). Only individuals with MCD in relapse had elevated circulating levels of 55-7 kda pi protein (red oval). Increased circulating neutral pi monomers and oligomers were noted in individuals with MCD in relapse (red arrow), and monomers only in MN (green arrow). (d) Densitometry analysis of circulating represented in panel c. (e) Equal loading and transfer controls for blots shown in panel c (as described for panel b). *** P <., comparison with MCD Nature Medicine: doi:.8/nm.6 remission. MN FSGS
13 Foot process GBM Endo Hyposialylated Sialylated Adipose released oligomers secretion Podocyte Outside - in signal Putative podocyte receptor Putative endothelial receptor Adipose tissue Effaced foot process HDL Supplementary Figure : Schematic representation of the role of podocyte secreted in nephrotic syndrome. Sequence of events arranged from top to bottom. Podocytes secrete neutral and high pi that binds to the GBM to alter protein - protein interactions, resulting in proteinuria. Over time, reaches up to the endothelial surface. Progressive accumulation and clustering of in the GBM likely activates signals at the podocyte - GBM interface, induces foot process effacement and further increase in proteinuria. Circulating secreted from other organs in disease states e. g. adipose tissue, forms medium and high order oligomers that are bound to HDL particles, migrate at neutral or low-neutral pi, and do not enter the GBM or cause proteinuria. Nature Medicine: doi:.8/nm.6
14 Patient Diagnosis age (years) sex proteinuria primary treatment (initiated or past) MCD 6 MCD - relapse female nephrotic glucocorticoids MCD 7 MCD - relapse female nephrotic glucocorticoids + cyclosporin MCD 8 MCD - relapse male nephrotic glucocorticoids MCD 9 MCD - relapse male nephrotic glucocorticoids MCD-R MCD remission male <.5 gm/ hours glucocorticoids + cyclophosphamide MCD-R MCD remission 5 male <.5 gm/ hours glucocorticoids + cyclophosphamide MCD-R MCD remission 9 male <.5 gm/ hours glucocorticoids + cyclophosphamide MCD-R MCD remission male <.5 gm/ hours glucocorticoids FSGS FSGS 9 male sub nephrotic AEC inhibitor FSGS FSGS 9 female nephrotic ACE inhibitor FSGS FSGS 9 male sub nephrotic cyclosporin FSGS FSGS 8 male nephrotic glucocorticoids MN MN 59 male sub nephrotic ACE inhibitor MN MN 6 male sub nephrotic ACE inhibitor MN MN female nephrotic unknown MN MN 5 male sub nephrotic ACE inhibitor Supplementary Table : Brief clinical profile of individuals whose plasma and urine were assessed for presence and patterns of expression by Western blot. Gene / transgene Species Forward primer Reverse primer Taqman probe rat tctgggatctccaccatttttg tcaccgtccagcctccat caactgtgagatgacttc rat cgccacccgcttacaca cagaggctggatctggaaaagt tgccaggaactcttt NPHS- construct rat tacaggctaccaccctgttgatc aaccgcgggccctctag ccatggaggctacagca ap- construct rat tgttgatccagcccatgga agggataggcttaccttcgaatg cagcagcctccc Prolactin (genomic) rat cttgaagggattgaaaagataattagc ccatgagtcagaaaagcattgaac aggtgagcattttcctg Supplementary Table. List of primers and probes used for Taqman real time PCR. Supplementary Tables Nature Medicine: doi:.8/nm.6
15 Supplementary Methods Cloning of full length rat, and generation of antibody against full length recombinant : We cloned the full length rat open reading frame from our previous experiments, excluding the stop codon, into pcdna./v5-hisb for eukaryotic expression, and into pet8a for prokaryotic expression. The E. Coli expressed purified full length protein was used to generate a polyclonal antibody in rabbits (Proteintech group) that was tested by ELISA and Western blot. We excised antibody reactive bands from GelCode blue stained gels and confirmed the presence of peptide sequences by MALDI-TOF/TOF. Part of the antiserum was affinity purified to the antigen. All studies described used this antibody. We raised an additional polyclonal antibody against the N-terminal part of rat (amino acids 7 86 excluding signal peptide) in rabbits, and used this for confirmation studies. We purchased the following antibodies: goat anti-mouse CDAP (Santa Cruz Biotechnology), guinea pig anti-human nephrin (Fitzgerald Industries), mouse anti-rat βγ laminin (Abcam), mouse anti-rat PECAM- (BD Pharmingen), mouse anti-human aquaporin (Santa Cruz Biotechnology), goat anti-mouse podocalyxin (Alpha Diagnostic International). Induction of proteinuria in animal models of human glomerular disease. Induction of animal models of proteinuria (n = rats/group) in wild type rats are described in previous publications in parenthesis: Puromycin aminonucleoside nephrosis (PAN), passive Heymann nephritis (PHN), PAN with glucocorticoids 5, non-hiv collapsing glomerulopathy, nephrotoxic serum induced heterologous phase proteinuria. Anti- Thy. nephritis was induced by injection of μg of anti-thy. (Ox-7 hybridoma) or Nature Medicine: doi:.8/nm.6
16 control IgG IV into different groups of male Wistar rats (-5 gm, n = rats/group), and rats euthanized after and 7 hours. The following techniques are described in prior publications: Taqman real time PCR, confocal imaging, in situ hybridization 5, promoter reporter studies, immunogold electron microscopy using nm gold particles, glomerular extraction and processing for Western blot, assessment of charge by polyethyleneimine method 6. Real time PCR studies for screening were performed with a minimum of templates, and if positive, were confirmed with a minimum of 6 templates. In rat models of proteinuria, - fold change in glomerular gene expression was considered significant. In the rat model of non-hiv collapsing glomerulopathy, we assessed glomerular gene expression in sieved and laser captured glomeruli. Taqman real time PCR primers and probes are listed in Supplementary Table. For in situ hybridization (n = rats / condition), we generated a digoxigenin labeled probe for rat that included bp to 58 of the open reading frame. Unless otherwise stated, all D gel electrophoresis was performed using cm Immobiline ph strips (GE Healthcare) and Criterion 8 6% Tris HCl Precast Gels (Bio-Rad Laboratories), using μg protein loaded in the first phase (n = gels / condition). Densitometry of D gel Western blots was assessed using Gel-Pro Analyzer software (Media Cybernetics). For alcian blue staining, the ph of the staining solution was adjusted to.5 using acetic acid, and.% nuclear fast red solution was used as a counterstain. Densitometry of glomerular basement membrane alcian blue stain ( glomeruli / rodent, rodents / group) was assessed using Image-Pro software (Media Cybernetics). Nature Medicine: doi:.8/nm.6
17 Injection of NTS into / mice: / mice were provided to Sander Kersten by Eli Lilly Corporation. The Animal Ethics Committee at Wageningen University approved the study protocol. We injected week old male / or +/+ mice (n = mice / group) intravenously with.5 mg γ-nts or normal sheep serum (Sigma Aldrich) collected spot urine samples at 8 hours, euthanized the mice at 7 hours, collected plasma for biochemical measurements, and preserved kidneys for histological analysis. We assessed urine albumin by ELISA (Bethyl laboratories) and measured urine creatinine by mass spectrometry. To assess for foot process effacement, the mean width of foot processes was first measured in electron micrographs of control treated +/+ mice ( equally spaced readings / loop, loops / glomerulus, glomeruli / kidney, kidneys / group). Effacement was defined as over.5 fold increase in mean width. We assessed the total number of foot processes, and the percentage effaced foot processes in NTS treated or control treated / mice. Injection of lipopolysaccharide (LPS) into / mice: The study protocol was approved by the Animal Ethics Committee at Wageningen University. After a baseline spot urine collection, we injected week old / and +/+ mice (n = 5 mice / group) intraperitoneally with μg / gram body weight of ultrapure LPS (Sigma Aldrich, catalog number L5) or an equal volume of PBS. Each mouse also received.8 ml of normal saline at and 6 hours after the LPS injection to avoid volume depletion. We collected urine at the peak of proteinuria hours after LPS injection. Mice were euthanized 8 hours after LPS injection. We assessed urine albumin and creatinine concentrations as detailed for the NTS study. Nature Medicine: doi:.8/nm.6
18 Measurement of rat blood pressure: Blood pressure and pulse rate were measured in six 5 month old wild type and proteinuric heterozygous NPHS- transgenic rats by the tail cuff method using the SC- apparatus from Hetteras Instruments. A minimum of 8 reading were analyzed per group. Studies on oligomerization of : Since D gel electrophoresis has limitations in resolving high molecular weight proteins, we performed non-reducing D SDS PAGE and Western blot were performed. We loaded μg of human α macroglobulin (AM, high molecular weight marker, 7 kda), 6 μg each of ap- transgenic rat plasma and protein from perfused NPHS- transgenic rat glomeruli, and 5 μg of concentrated supernatant from HEK9 stable cell line in duplicate into 5% nonreducing gels, ran the for hour or.5 hours, transferred them to PVDF membranes, and conducted Western blot studies. We also ran standard molecular weight markers in one lane. Studies with human samples: We conducted immunostaining and confocal imaging of human kidney biopsies (n = 5 biopsies per condition) obtained through protocols approved by the Research Ethics Committee at the Instituto Nacional de Cardiologia, Mexico City. kidney biopsies used for these studies were age, sex and race matched protocol pre-transplant biopsies. We obtained human sera and urine samples for D gel electrophoresis and Western blot ( n = samples / condition) from a previously published study 7 (select details in Supplementary Table ). Nature Medicine: doi:.8/nm.6
19 Supplementary References. Liu, G. at al. Neph and nephrin interaction in the slit diaphragm is an important determinant of glomerular permeability. J. Clin. Invest., 9- (). 5. Dijkman, H.B.P.M., Mentzel, S., de Jong, A.S. & Assmann, K.J.M. RNA in situ hybridization using digoxigenin-labeled crna probes. Biochemica, -7 (995). 6. Isogai, S., Mogami, K., Shiina, N. & Yoshino, G. Initial ultrastructural changes in pore size and anionic sites of the glomerular basement membrane in streptozotocin-induced diabetic rats and their prevention by insulin treatment. Nephron. 8, 5-58 (999). 7. Bakker, W.W. et al. Altered activity of plasma hemopexin in patients with minimal change disease in relapse. Pediatr. Nephrol., -5 (5). Nature Medicine: doi:.8/nm.6
Clinical Case Presentation. Dana Assis, MD
Clinical Case Presentation Dana Assis, MD 4.12.2016 Clinical Presentation 63 year old male with medical history AIDS (CD4 11, VL 62K), Hep C cirrhosis (never treated), DM II c/b diabetic retinopathy, HTN,
More informationEarly changes in gene expression that influence the course of primary glomerular disease
http://www.kidney-international.org & 2007 International Society of Nephrology original article Early changes in gene expression that influence the course of primary glomerular disease LC Clement 1,4,
More informationGlomerular Pathology- 1 Nephrotic Syndrome. Dr. Nisreen Abu Shahin
Glomerular Pathology- 1 Nephrotic Syndrome Dr. Nisreen Abu Shahin The Nephrotic Syndrome a clinical complex resulting from glomerular disease & includes the following: (1) massive proteinuria (3.5 gm /day
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationPodocyte Biology and clinical applications Dr. F. Ahmadi Professor Of Nephrology TUMS
Podocyte Biology and clinical applications Dr. F. Ahmadi Professor Of Nephrology TUMS Proteinuria is a major healthcare problem that affects several hundred million people worldwide. Proteinuria is a cardinal
More informationDr Ian Roberts Oxford. Oxford Pathology Course 2010 for FRCPath Illustration-Cellular Pathology. Oxford Radcliffe NHS Trust
Dr Ian Roberts Oxford Oxford Pathology Course 2010 for FRCPath Present the basic diagnostic features of the commonest conditions causing proteinuria & haematuria Highlight diagnostic pitfalls Nephrotic
More informationNeph1 and nephrin interaction in the slit diaphragm is an important determinant of glomerular permeability
Neph1 and nephrin interaction in the slit diaphragm is an important determinant of glomerular permeability Gang Liu, 1 Beenu Kaw, 2 Jayson Kurfis, 1 Syed Rahmanuddin, 1 Yashpal S. Kanwar, 3 and Sumant
More informationSupplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
More informationSUPPLEMENTARY INFORMATION
Supplemental Figure 1. Furin is efficiently deleted in CD4 + and CD8 + T cells. a, Western blot for furin and actin proteins in CD4cre-fur f/f and fur f/f Th1 cells. Wild-type and furin-deficient CD4 +
More information3. PODOCYTE INJURY IN GLOMERULAR DISEASES
How to Cite this article: Podocyte Injury in Glomerular Diseases - ejifcc 20/01 2009 http://www.ifcc.org 3. PODOCYTE INJURY IN GLOMERULAR DISEASES Mirjana Sabljar Matovinović Podocytes are injured in diabetic
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 Subcellular segregation of VGluT2-IR and TH-IR within the same VGluT2-TH axon (wild type rats). (a-e) Serial sections of a dual VGluT2-TH labeled axon. This axon (blue outline) has
More informationOverview of glomerular diseases
Overview of glomerular diseases *Endothelial cells are fenestrated each fenestra: 70-100nm in diameter Contractile, capable of proliferation, makes ECM & releases mediators *Glomerular basement membrane
More informationSupporting Information
Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)
More informationRENAL HISTOPATHOLOGY
RENAL HISTOPATHOLOGY Peter McCue, M.D. Department of Pathology, Anatomy & Cell Biology Sidney Kimmel Medical College There are no conflicts of interest. 1 Goals and Objectives! Goals Provide introduction
More informationPu Duann, MD, PhD Hideki G. Kawanishi, MD Eugene J. Gross, BS Prasun K. Datta, PhD Elias A. Lianos, MD, PhD
Detection of Injury-induced Changes in Gene Expression of the Glomerular Epithelial Cell-specific Marker, Wilm s Tumor-1, by Laser Capture Microdissection Pu Duann, MD, PhD Hideki G. Kawanishi, MD Eugene
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More informationIslet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot
Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter
More informationCase 3. ACCME/Disclosure. Laboratory results. Clinical history 4/13/2016
Case 3 Lynn D. Cornell, M.D. Mayo Clinic, Rochester, MN Cornell.Lynn@mayo.edu USCAP Renal Case Conference March 13, 2016 ACCME/Disclosure Dr. Cornell has nothing to disclose Clinical history 57-year-old
More informationNature Medicine: doi: /nm.3922
Title: Glucocorticoid-induced tumor necrosis factor receptor-related protein co-stimulation facilitates tumor regression by inducing IL-9-producing helper T cells Authors: Il-Kyu Kim, Byung-Seok Kim, Choong-Hyun
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationCase # 2 3/27/2017. Disclosure of Relevant Financial Relationships. Clinical history. Clinical history. Laboratory findings
Case # 2 Christopher Larsen, MD Arkana Laboratories Disclosure of Relevant Financial Relationships USCAP requires that all planners (Education Committee) in a position to influence or control the content
More informationSupplementary Figure 1
VO (ml kg - min - ) VCO (ml kg - min - ) Respiratory exchange ratio Energy expenditure (cal kg - min - ) Locomotor activity (x count) Body temperature ( C) Relative mrna expression TA Sol EDL PT Heart
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationExpression of acid base transporters in the kidney collecting duct in Slc2a7 -/-
Supplemental Material Results. Expression of acid base transporters in the kidney collecting duct in Slc2a7 -/- and Slc2a7 -/- mice. The expression of AE1 in the kidney was examined in Slc26a7 KO mice.
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationNature Medicine: doi: /nm.4322
1 2 3 4 5 6 7 8 9 10 11 Supplementary Figure 1. Predicted RNA structure of 3 UTR and sequence alignment of deleted nucleotides. (a) Predicted RNA secondary structure of ZIKV 3 UTR. The stem-loop structure
More informationSupplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
More informationSupplementary Fig. S1. Schematic diagram of minigenome segments.
open reading frame 1565 (segment 5) 47 (-) 3 5 (+) 76 101 125 149 173 197 221 246 287 open reading frame 890 (segment 8) 60 (-) 3 5 (+) 172 Supplementary Fig. S1. Schematic diagram of minigenome segments.
More informationMicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells
MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on
More informationSupplementary Figure 1
Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged
More informationGlomerular diseases mostly presenting with Nephritic syndrome
Glomerular diseases mostly presenting with Nephritic syndrome 1 The Nephritic Syndrome Pathogenesis: proliferation of the cells in glomeruli & leukocytic infiltrate Injured capillary walls escape of RBCs
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationRenal Pathology 1: Glomerulus. With many thanks to Elizabeth Angus PhD for EM photographs
Renal Pathology 1: Glomerulus With many thanks to Elizabeth Angus PhD for EM photographs Anatomy of the Kidney http://www.yalemedicalgroup.org/stw/page.asp?pageid=stw028980 The Nephron http://www.beltina.org/health-dictionary/nephron-function-kidney-definition.html
More informationEctopic Notch Activation in Developing Podocytes Causes Glomerulosclerosis
Ectopic Notch Activation in Developing Podocytes Causes Glomerulosclerosis Aoife M. Waters,* Megan Y.J. Wu,* Tuncer Onay,* Jacob Scutaru,* Ju Liu, Corrinne G. Lobe, Susan E. Quaggin, and Tino D. Piscione*
More informationSupplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
More informationGPR120 *** * * Liver BAT iwat ewat mwat Ileum Colon. UCP1 mrna ***
a GPR120 GPR120 mrna/ppia mrna Arbitrary Units 150 100 50 Liver BAT iwat ewat mwat Ileum Colon b UCP1 mrna Fold induction 20 15 10 5 - camp camp SB202190 - - - H89 - - - - - GW7647 Supplementary Figure
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationGeneral Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:
General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems
More informationCase Presentation Turki Al-Hussain, MD
Case Presentation Turki Al-Hussain, MD Director, Renal Pathology Chapter Saudi Society of Nephrology & Transplantation Consultant Nephropathologist & Urological Pathologist Department of Pathology & Laboratory
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Eremina V, Jefferson JA, Kowalewska J, et al. VEGF inhibition
More informationYear 2004 Paper one: Questions supplied by Megan
QUESTION 53 Endothelial cell pathology on renal biopsy is most characteristic of which one of the following diagnoses? A. Pre-eclampsia B. Haemolytic uraemic syndrome C. Lupus nephritis D. Immunoglobulin
More informationSUPPLEMENTAL INFORMATION
SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary Figure 1
Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains
More informationRenal Physiology - Lectures
Renal Physiology 2011 Lisa M. Harrison-Bernard, PhD lharris@lsuhsc.edu Renal Physiology - Lectures Physiology of Body Fluids 2. Structure & Function of the Kidneys 3. Renal Clearance & Glomerular Filtration
More informationInteresting case seminar: Native kidneys Case Report:
Interesting case seminar: Native kidneys Case Report: Proximal tubulopathy and light chain deposition disease presented as severe pulmonary hypertension with right-sided cardiac dysfunction and nephrotic
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure 1: immunoprecipitation with anti-casr antibody The Casr protein was expressed in transiently transfected HEK cells. Cell lysates from HEK cells were subjected
More informationMr. I.K 58 years old
Mr. I.K 58 years old Hospitalized because of marked pitting peripheral edema (bilateral crural and perimalleolar edema) and uncontrolled blood pressure (BP 150/100 mmhg under treatment). since age 54 years
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationElevated Serum Creatinine, a simplified approach
Elevated Serum Creatinine, a simplified approach Primary Care Update Creighton University School of Medicine. April 27 th, 2018 Disclosure Slide I have no disclosures and have no conflicts with this presentation.
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationSupplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk
Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Debiec H, Lefeu F, Kemper MJ, et al. Early-childhood membranous
More informationMohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi
Role of Vitamin D receptor (VDR) in HIV induced tubular injury Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi 07/10/2015 INTRODUCTION Vitamin D is technically not a Vitamin;
More informationRENAL EVENING SPECIALTY CONFERENCE
RENAL EVENING SPECIALTY CONFERENCE Harsharan K. Singh, MD The University of North Carolina at Chapel Hill Disclosure of Relevant Financial Relationships No conflicts of interest to disclose. CLINICAL HISTORY
More informationAAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination
AAV-TBGp-Cre treatment resulted in hepatocyte-specific GH receptor gene recombination Supplementary Figure 1. Generation of the adult-onset, liver-specific GH receptor knock-down (alivghrkd, Kd) mouse
More informationIntroduction. Methods RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES. TCW Poon *, HLY Chan, HWC Leung, A Lo, RHY Lau, AY Hui, JJY Sung
RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES Liver specific glycoforms of serum proteins in chronic hepatitis B infection: identification by lectin affinity chromatography and quantitative proteomic
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1. Neither the activation nor suppression of the MAPK pathway affects the ASK1/Vif interaction. (a, b) HEK293 cells were cotransfected with plasmids encoding
More informationGlomerular pathology-2 Nephritic syndrome. Dr. Nisreen Abu Shahin
Glomerular pathology-2 Nephritic syndrome Dr. Nisreen Abu Shahin 1 The Nephritic Syndrome Pathogenesis: inflammation proliferation of the cells in glomeruli & leukocytic infiltrate Injured capillary walls
More informationSestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury
Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada
More informationsfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL
sfigure 1: Detection of L-fucose in normal mouse renal cortex using the plant lectin LTL LTL staining Negative control Fluorescence microscopy of normal (CL-11 +/+ ) mouse renal tissue after staining with
More informationUNCOVERING THE ROLES OF TOLL-LIKE RECEPTOR 7 AND INTERFERON REGULATORY FACTOR 5 IN IMMUNE COMPLEX GLOMERULONEPHRITIS
Name Email Barry Horne, Jr. bkhorne@bu.edu Institutional Affiliation Campus School Medical Campus Graduate Medical Sciences Division Department Graduate Program in Genetics and Genomics, Immunology Training
More informationSupplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid. HEK293T
More informationC1q nephropathy the Diverse Disease
C1q nephropathy the Diverse Disease Danica Galešić Ljubanović School of Medicine, University of Zagreb Dubrava University Hospital Zagreb, Croatia Definition Dominant or codominant ( 2+), mesangial staining
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationSupplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times.
Supplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times. Western blots shown are representative results from 3 independent
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/ncb222 / b. WB anti- WB anti- ulin Mitotic index (%) 14 1 6 2 T (h) 32 48-1 1 2 3 4 6-1 4 16 22 28 3 33 e. 6 4 2 Time (min) 1-6- 11-1 > 1 % cells Figure S1 depletion leads to mitotic defects
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
More informationSupplementary Figure 1: Co-localization of reconstituted L-PTC and dendritic cells
a CD11c Na + K + ATPase Na + K + ATPase CD11c x-y CD11c Na + K + ATPase Na + K + ATPase CD11c x-z c b x-y view BoNT NAPs CD11c BoNT CD11c NAPs BoNT NAPs CD11c 90 x-z view Apical Basolateral Supplementary
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationTFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry
TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/7/308/ra4/dc1 Supplementary Materials for Antipsychotics Activate mtorc1-dependent Translation to Enhance Neuronal Morphological Complexity Heather Bowling, Guoan
More informationTumor suppressor Spred2 interaction with LC3 promotes autophagosome maturation and induces autophagy-dependent cell death
www.impactjournals.com/oncotarget/ Oncotarget, Supplementary Materials 2016 Tumor suppressor Spred2 interaction with LC3 promotes autophagosome maturation and induces autophagy-dependent cell death Supplementary
More informationFigure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR
Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR and LRRK2 WD40 GST fusion proteins (5 µg) were loaded
More informationThe topic of normal vascular and glomerular anatomy is introduced
Normal Vascular and Glomerular Anatomy Arthur H. Cohen Richard J. Glassock The topic of normal vascular and glomerular anatomy is introduced here to serve as a reference point for later illustrations of
More informationSupplementary Figure S1. Flow cytometric analysis of the expression of Thy1 in NH cells. Flow cytometric analysis of the expression of T1/ST2 and
Supplementary Figure S1. Flow cytometric analysis of the expression of Thy1 in NH cells. Flow cytometric analysis of the expression of T1/ST2 and Thy1 in NH cells derived from the lungs of naïve mice.
More informationA new mouse experimental model of focal segmental glomerulosclerosis produced by the administration of polyclonal anti-mouse nephrin antibody
Original Contribution Kitasato Med J 2015; 45: 29-37 A new mouse experimental model of focal segmental glomerulosclerosis produced by the administration of polyclonal anti-mouse nephrin antibody Chikako
More informationSUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.
Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental
More informationReferences. Plasma renin activity (PRA) PRA was measured by a radioimmunoassay kit (Wallac, Tokyo, Japan).
Detailed Methods Experiment I enos / mice were purchased from Jackson Laboratory (Bar Harbor, USA). C57BL/6J mice on the same genetic background were purchased from KBT Oriental (Hamamatsu, Japan). Eleven-week-old
More informationPodocyte-associated talin1 is critical for glomerular filtration barrier maintenance
Research article Podocyte-associated talin1 is critical for glomerular filtration barrier maintenance Xuefei Tian, 1 Jin Ju Kim, 2 Susan M. Monkley, 3 Nanami Gotoh, 1 Ramiro Nandez, 4,5,6 Keita Soda, 1
More informationSupplemental Figures:
Supplemental Figures: Figure 1: Intracellular distribution of VWF by electron microscopy in human endothelial cells. a) Immunogold labeling of LC3 demonstrating an LC3-positive autophagosome (white arrow)
More informationOrdering Physician. Collected REVISED REPORT. Performed. IgG IF, Renal MCR. Lambda IF, Renal MCR. C1q IF, Renal. MCR Albumin IF, Renal MCR
RenalPath Level IV Wet Ts IgA I Renal IgM I Renal Kappa I Renal Renal Bx Electron Microscopy IgG I Renal Lambda I Renal C1q I Renal C3 I Renal Albumin I Renal ibrinogen I Renal Mayo Clinic Dept. of Lab
More informationSupplementary Figure 1
Supplementary Figure 1 A B mir-141, human cell lines mir-2c, human cell lines mir-141, hepatocytes mir-2c, hepatocytes Relative RNA.1.8.6.4.2 Relative RNA.3.2.1 Relative RNA 1.5 1..5 Relative RNA 2. 1.5
More informationFigure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.
Figure S1. Generation of inducible PTEN deficient mice and the BMMCs (A) B6.129 Pten loxp/loxp mice were mated with B6.129-Gt(ROSA)26Sor tm1(cre/ert2)tyj /J mice. To induce deletion of the Pten locus,
More informationFocal Segmental Glomerulosclerosis and the Nephro6c Syndrome Dr. A. Gangji Dr. P. Marge>s. Part 1: Clinical
Focal Segmental Glomerulosclerosis and the Nephro6c Syndrome Dr. A. Gangji Dr. P. Marge>s Part 1: Clinical Pa#ent DM 18 year old McMaster student Back pain, severe fa#gue Oct 2006 Leg swelling to ER Nov
More informationExpression constructs
Gene expressed in bebe3 ZmBEa Expression constructs 35S ZmBEa Pnos:Hygromycin r 35S Pnos:Hygromycin r 35S ctp YFP Pnos:Hygromycin r B -1 Chl YFP- Merge Supplemental Figure S1: Constructs Used for the Expression
More informationLab 3, case 1. Is this an example of nephrotic or nephritic syndrome? Why? Which portion of the nephron would you expect to be abnormal?
Lab 3, case 1 12-year-old Costa Rican boy is brought into clinic by his parents because of dark brownish-red urine over the last 24 hours. The family has been visiting friends in Indianapolis for two weeks.
More informationGeneral introduction. General introduction
General introduction 1 Chapter 1 Proteinuria is the excretion of proteins into the urine. Presence of abnormal proteinuria, the urinary excretion of abnormal amounts of serum proteins (briefly called proteinuria),
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Nair S, Branagan AR, Liu J, Boddupalli CS, Mistry PK, Dhodapkar
More informationExpression of human nephrin mrna in diabetic nephropathy
Nephrol Dial Transplant (2004) 19: 380 385 DOI: 10.1093/ndt/gfg545 Original Article Expression of human nephrin mrna in diabetic nephropathy Masao Toyoda, Daisuke Suzuki, Tomoya Umezono, Goro Uehara, Mayumi
More informationINTRODUCTION TO GLOMERULAR DISEASES
INTRODUCTION TO GLOMERULAR DISEASES Goal: to explain the general mechanisms leading to glomerular diseases and to analyze what is known about their relationship to morphologic and clinical manifestations
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES 1 Supplementary Figure 1, Adult hippocampal QNPs and TAPs uniformly express REST a-b) Confocal images of adult hippocampal mouse sections showing GFAP (green), Sox2 (red), and REST
More informationNephritic vs. Nephrotic Syndrome
Page 1 of 18 Nephritic vs. Nephrotic Syndrome Terminology: Glomerulus: A network of blood capillaries contained within the cuplike end (Bowman s capsule) of a nephron. Glomerular filtration rate: The rate
More informationGlomerular pathology in systemic disease
Glomerular pathology in systemic disease Lecture outline Lupus nephritis Diabetic nephropathy Glomerulonephritis Associated with Bacterial Endocarditis and Other Systemic Infections Henoch-Schonlein Purpura
More informationSupplementary material: Materials and suppliers
Supplementary material: Materials and suppliers Electrophoresis consumables including tris-glycine, acrylamide, SDS buffer and Coomassie Brilliant Blue G-2 dye (CBB) were purchased from Ameresco (Solon,
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationTSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 TSH Receptor Monoclonal Antibody (49) Catalog Number MA3-218 Product data sheet Details
More informationThe evolution of the classification of nephrotic syndrome Laura Barisoni, MD
The evolution of the classification of nephrotic syndrome Laura Barisoni, MD Department of Pathology and Medicine, Division of Nephrology New York University Old classification schemes: Proteinuria and
More information