Is there a need of new RAAS blockers in diabetic hypertension?

Save this PDF as:

Size: px
Start display at page:

Download "Is there a need of new RAAS blockers in diabetic hypertension?"


1 Is there a need of new RAAS blockers in diabetic hypertension? Dr. Dominik N. Müller First World Congress on Controversies in Obesity, Diabetes and Hypertension Berlin October 2006

2 Renin-Angiotensin System Prorenin Angiotensinogen Renin Sequence: RILLKKMPSV AT 1, AT 2 Renin receptor Ang I ACE, chymase Ang II ACE2 AT 4 Ang IV Ang-(1-7) AT 1-7

3 Tissue RAS leads to damage in many organs especially in patients with metabolic disorders Brain Pituitary Gland Eye 2 in diabetes Adrenal Glands Blood Vessels 3 with atherosclerosis Adipose Tissue 4,5 in obesity, hypertension Aorta 6 with atherosclerosis Heart 7-9 in diabetes, post-mi, failing ventricle Kidney in diabetes, membranous nephropathy Pancreas 13 in nephropathy Ang II levels are much higher in tissue than in plasma 1 Phillips MI. Tissue renin-angiotensin systems. In: Izzo JL Jr, Black HR, eds. Hypertension Primer: The Essentials of High Blood Pressure. 3rd ed. Philadelphia, Pa; Lippincott Williams & Wilkins; 2003: Strain WD et al. JRAAS. 2002;3: Dzau VJ. Hypertension. 2001;37; Faloia E et al. J Endocrinol Invest. 2002;25: Vega GL. Minerva Endocrinol. 2004;29: Arakawa K et al. Hypertension. 2000; 36: Frustaci A et al. Circ Res. 2000;87: Danser AH et al. Circulation. 1997;96: Hokimoto S et al. Circulation. 1996;94: Hollenberg NK et al. Kidney Int. 2003;63: Mezzano S et al. Kidney Int Suppl. 2003;86;S64-S Mezzano SA et al. Kidney Int. 2003;64:S39-S Leung PS. J Pancreas. 2003;4:89-91.

4 The Cardiovascular Continuum Development and Progression of CV Disease Maladaptive remodelling Endothelial dysfunction Vascular disease Constriction, inflammation, hypertrophy, hyperplasia, atherogenesis, thrombosis Endothelial dysfunction Diabetes, hypertension, insulin resistance Tissue injury MI, stroke, glomerular ischaemia Pathologic remodelling LVH, LV dilation, glomerulosclerosis Target-organ dysfunction HF, nephropathy Target-organ damage End-stage organ failure Death Dzau VJ. Hypertension. 2001; 37: Dzau V et al. Am Heart J. 1991; 121: Anderson S. In: Izzo JL Jr, Black HR, eds. Hypertension Primer: The Essentials of High Blood Pressure. 3rd ed. Philadelphia, Pa: Lippincott Williams & Wilkins; 2003:

5 PRA Predicts the Incidence of MI Interrelation Between PRA and CV Risk Factors MI rate/1000 personyears High Moderate Risk Status Low For every 2-unit increase in PRA, there is an overall 25% increase in MI incidence* Low Normal High Plasma Renin Activity *Association strongest in white men. Risk status: high, 2 risk factors (smoking, cholesterol, LVH); moderate, 1 risk factor; low, no risk factors. PRA, plasma renin activity. Alderman MH et al. Am J Hypertens. 1997; 10: 1-8.

6 Renin inhibition

7 Current Renin System blockers & diuretics raise plasma renin activity (PRA)* Kidney Angiotensinogen Renin Feedback Loop Plasma Renin Activity Ang I Ang II ARBs AT 1 Receptor ACEIs Non ACE pathways ACE Glomerular vasoconstriction Inflammation Fibrosis Heart Hypertrophy Fibrosis Vasoconstriction Vessels Hyperplasia hypertrophy Inflammation Oxidation Fibrosis Brain *Increased peptide levels have not been shown to overcome the BP lowering effect of these agents Vasoconstriction

8 Renin inhibition acts at the Renin System s point of activation and neutralizes the PRA rise Renin inhibitor Kidney Angiotensinogen Glomerular vasoconstriction Inflammation Fibrosis Renin Ang I Heart Feedback Loop Plasma Renin Activity Ang II ARBs AT 1 Receptor ACEIs ACE Hypertrophy Fibrosis Vasoconstriction Vessels Hyperplasia hypertrophy Inflammation Oxidation Fibrosis Brain Vasoconstriction

9 Aliskiren binds to the active site of renin Renin Aliskiren Angiotensinogen Aliskiren binds to a pocket in the renin molecule, blocking cleavage of angiotensinogen to angiotensin I Adapted from Wood JM, et al. 2003

10 Renin inhibition Experimental studies

11 Renin inhibition vs. anti-hypertensive treatment Systolic Blood Pressure ( mm Hg ) ** ## *** *** dtgr Age (weeks) Triple RI SD 24-hour Albuminuria ( mg / d ) ** dtgr *** ### Age (weeks) Triple RI SD Hypertension 2000;35:587-94

12 Circ Res 2005; 97: Albuminuria

13 Aliskiren provides renoprotective effects in a rat model of hypertensive diabetic nephropathy Urinary albumin (mg/24h) Vehicle Aliskiren 10 mg/kg/d 30 mg/kg/d Days Treatment starts Feldman D, et al. 2005

14 Aliskiren preclinical data Summary Aliskiren demonstrates organ protective effects in animal models renoprotection comparable with ACEIs and ARBs LVH reductions comparable with ARBs suppresses markers of renal damage in diabetic nephropathy atherogenesis prevention

15 Aliskiren clinical data Aliskiren is under evaluation in clinical studies for the treatment of hypertension. To date, no clinical trials have assessed the effect of aliskiren on morbidity and mortality

16 Aliskiren compared with ramipril and combination therapy in patients with diabetes and hypertension Study design Aliskiren 150 mg Aliskiren 300 mg n=282 Washout Placebo Ramipril 5 mg Ramipril 10 mg n=278 Single-blind Aliskiren 150 mg + ramipril 5 mg Aliskiren 300 mg + ramipril 10 mg n=277 2 weeks 2 4 weeks 4 weeks 4 weeks Uresin Y, et al (Study 2307)

17 Aliskiren/ramipril combination provides significantly greater reductions in BP than component monotherapies Ramipril mono Aliskiren mono DBP Aliskiren/ ramipril combination Mean change from baseline in BP (mmhg) Ramipril mono Aliskiren mono SBP Aliskiren/ ramipril combination n=275 n=279 n=274 n=275 n=279 n= * * * 16.6 *p<0.05 for superiority vs ramipril monotherapy; p<0.05 for superiority vs aliskiren monotherapy; p<0.05 for non-inferiority for aliskiren monotherapy vs ramipril monotherapy Error bars indicate standard error from the mean Uresin Y, et al (Study 2307)

18 Aliskiren in combination with valsartan Study design (2101) Double-blind 4-period crossover study in healthy male subjects with mild salt depletion 14-day washout 14-day washout 14-day washout Aliskiren 300 mg single dose Valsartan 160 mg single dose Aliskiren 150 mg/ valsartan 80 mg single dose Placebo single dose Azizi M, et al. 2004

19 Aliskiren neutralizes ARB-induced increase in PRA PRA at 24 hours after dosing (ng/ml/h) 5 4 * * Aliskiren 300 mg Valsartan 160 mg Aliskiren + Valsartan 150/80 mg Placebo *p<0.05 vs aliskiren 150 mg/valsartan 80 mg p<0.05 vs aliskiren 300 mg p<0.05 vs valsartan 160 mg n=12 Azizi M, et al. 2004

20 Aliskiren neutralizes ARB-induced rises in Ang II Plasma Ang II (pg/ml) 80 * *p<0.05 vs aliskiren 150 mg/valsartan 80 mg p<0.05 vs aliskiren 300 mg p<0.05 vs valsartan 160 mg n=12 0 * Time (hours) * * * 48 * * Placebo Aliskiren 300 mg Valsartan 160 mg Aliskiren 150 mg + Valsartan 80 mg Azizi M, et al. 2004

21 Aliskiren significantly decreases urinary aldosterone excretion in healthy volunteers Urinary aldosterone excretion (µg/24h) 10 Pretreatment (Day 1) Day * * * Placebo Aliskiren 40 mg Aliskiren 80 mg Aliskiren 160 mg Aliskiren 640 mg Enalapril 20 mg *p<0.05 vs pretreatment (Day 1) Nussberger J, et al. 2002

22 Aliskiren demonstrates persistence of effect after discontinuation SeDBP (mmhg) Drug discontinuation Week Aliskiren 300 mg (n=169) Aliskiren 600 mg (n=166) Placebo (n=165) Aliskiren 150 mg (n=172) Herron J, et al (Study 2308)

23 Change from baseline in PRA (%) Suppression of PRA is maintained following discontinuation of aliskiren treatment Week 8 Placebo (n=66) Aliskiren 150 mg (n=66) Double-blind treatment Aliskiren 300 mg (n=66) Aliskiren 600 mg (n=66) Treatment-free withdrawal 10 Herron J, et al (Study 2308)

24 Aliskiren in hypertension Clinical summary Aliskiren provides long-term suppression of PRA Aliskiren effectively reduces PRA from baseline as monotherapy, and blocks the rise in PRA seen during treatment with other antihypertensives such as ARB Aliskiren monotherapy provides dose-dependent reductions in DBP and SBP Additional BP lowering when combined with other antihypertensives Sustained 24-hour BP control with prolonged effect after discontinuation Increased peptide levels have not been shown to overcome the BP lowering effect of these agents

25 Prorenin and the (Pro)renin Receptor: Functional Significance

26 Origin of Prorenin a significant % of plasma prorenin is of extrarenal origin, whereas renin is of renal origin only Expression of prorenin High levels Low levels Eye prorenin-renin conversion appears to occur exclusively in the kidney Kidneys Adrenal glands Reproductive system: Testes Ovaries Placenta

27 (Pro)Renin Disappearance after Bilateral Nephrectomy comparison with Ang I 100 % of total level at t=0 50 renin prorenin Ang I time after nephrectomy (minutes)

28 Renin Prorenin Relationship Derkx FHM et al. Clin Exp Hypertens 1988; A10:

29 Prorenin as a marker of microvascular complications in diabetes Luetscher et al., NEJM 1985 patient with microvascular complications

30 Diabetes: increased prorenin levels are associated with the development of retinopathy Prorenin levels were significantly (p 0.01) higher in diabetic patients with retinopathy compared with those without retinopathy 1-3 Prorenin levels may be correlated with the degree of retinopathy 4 Prorenin concentration (mu/l) n=99 No retinopathy ** n=60 Background retinopathy ** n=64 Proliferative retinopathy **p< Franken et al. 1990; 2 Wilson et al. 1990; 3 Yokata et al. 2005; 4 Davies et al

31 Diabetes: prorenin levels are increased in diabetic patients with microalbuminuria (MA) Prorenin concentration (mu/l) 300 p< n=39 n=50 0 No diabetes Diabetes Diabetes MA p< n=25 n=25 Diabetes +MA Prorenin is elevated in patients with diabetes compared with non-diabetic siblings 1 Prorenin can constitute up to 95% of total renin in these patients 2 Prorenin levels are significantly elevated in diabetes patients with microalbuminuria (p<0.0001) compared with those without microalbuminuria Deinum et al. 1999a; 2 Deinum et al. 1999b; 3 Daneman et al. 1994; Chiarelli et al

32 Diabetes: elevated levels of prorenin may predict the development of nephropathy Prorenin mu/l * * * Time (years) * * * Onset of microalbuminuria Increase in prorenin levels precedes the development of nephropathy in patients with diabetes 1,2 Prorenin may identify diabetes patients at risk of developing nephropathy * * 4 Developed nephropathy (n=10) No nephropathy (n=87) *p< Chiarelli et al. 2001; 2 Deinum et al

33 New (Pro)renin receptor

34 Receptor-bound prorenin is enzymatically active Prorenin Handle region Prosegment Cell membrane Proteolytic cleavage Nonproteolytic activation (Pro)renin receptor Angiotensinogen pocket Active renin 1 Suzuki et al. 2003; 2 Nguyen et al. 2002; 3 Methot et al

35 Human prorenin: two crucial regions T 7P FKR 10P (gate) and I 11P FLKR 15P (handle) for non-proteolytic activation handle gate human prorenin model N-terminus

36 Sequence of the prosegment seves as blocker Prorenin prosegment Handle region Renin - LPTDTASFORILLKKMPSVREILEERGVDMTRISAEWGEFIKK - Proenin NH 2 -RILLKKMPSV-COOH HRP Decoy decapeptide

37 Role of the Renin Receptor Blockade on Diabetic Nephropathy (Ichihara et al.) J Clin Invest 2004;114:

38 Role of the Renin Receptor Blockade in Diabetic Nephropathy WT mice

39 Role of the Renin Receptor Blockade in Diabetic Nephropathy WT mice AT1 receptor KO mice


41 Human Renin-induced TGF-β mrna Expression dose-dependent Ang II-independent Huang Y. et al. Kidney Int. 2006;69:105-13

42 Renin-induced PAI-1 is mediated via TGF-β PAI-1 mrna anti-tgf-β ab Huang Y. et al. Kidney Int. 2006;69: Fibronectin and Collagen I

43 Renin-induced TGF-β is mediated via the Renin Receptor sirna against Renin Receptor TGF-β mrna Huang Y. et al. Kidney Int. 2006;69:105-13

44 Signaling Pathway prorenin renin receptor HRP?? NOT via EGFR PLZF? Th. Unger (Charite, Berlin, Germany, GRC 2006) MEK 1/2 PD98059 p38, JNK? ERK1/2 Cellular effects?

45 Summary (Pro)Renin receptor is most likely expressed in all cell types. (Pro)Renin induces ERK 1/2 phosphorylation independent of Ang II. Renin signaling depends on MEK-1/2 kinase, not on EGF receptor. In mesangial cells, TGF-β is involved leading to PAI-1, collagen and fibronectin expression. Location is on the surface of the cells, but also intracellular (endosomes??, lysosomes?? or ER??). Where does signaling take place? Affymetrix genes expression and signaling in (pro)renin receptordeficient cells might help us to elucidate the function of the renin receptor.

46 Open Questions Does renin and prorenin activate the same signaling pathways? Is renin and prorenin signaling cell type-specific? Where does it exist (all cells)? Why is the time course different from other known ERK 1/2 activators (e.g. Ang II)? Are other MAP kinases (JNK or p38) involved? Does homodimerization affect signaling? Does renin signaling regulate its own receptor? Does a soluble truncated renin receptor exist?

47 Perspectives We still have to elucidate whether the major function of the renin receptor is related to cardiovascular disease and whether the blockade of the renin receptor would ameliorate diabetic nephropathy.

48 Collaborators S. Feldt I. Mazak M. Wellner F. C. Luft C. Burckle M. Bader INSERM U36 C. Burckle G. Nguyen Erasmus MC Rotterdam W. Batenburg J. Danser

49 Aliskiren suppresses key markers of renal damage in a rat model of hypertensive diabetic nephropathy Urinary excretion and glomerular gene expression of TGF-β are elevated in diabetes TGF-β is an important mediator of renal damage Aliskiren suppressed glomerular gene expression of TGF-β in a rat model of hypertensive diabetic neuropathy Aliskiren showed a trend towards reducing urinary TGF-β excretion compared with vehicle Aliskiren showed a trend towards reducing renal collagen III and IV expression compared with vehicle Feldman D, et al. 2005

50 Cardiac Ang II Depends on Renal Renin 20 Angiotensin II 60 Renin fmol/g 10 fmol Ang I/ min/g Control Nx Nx, nephrectomy. Danser AHJ et al. Hypertension. 1994;24: Control Nx

The Road to Renin System Optimization: Renin Inhibitor

The Road to Renin System Optimization: Renin Inhibitor The Road to Renin System Optimization: Renin Inhibitor A New Perspective on the Renin-Angiotensin System (RAS) Yong-Jin Kim, MD Seoul National University Hospital Human and Economic Costs of Hypertension

More information

Renin inhibition with aliskiren in hypertension: focus on aliskiren/hydrochlorothiazide combination therapy

Renin inhibition with aliskiren in hypertension: focus on aliskiren/hydrochlorothiazide combination therapy REVIEW Renin inhibition with aliskiren in hypertension: focus on aliskiren/hydrochlorothiazide combination therapy Kalathil K Sureshkumar Division of Nephrology and Hypertension, Allegheny General Hospital,

More information

Drugs acting on the reninangiotensin-aldosterone

Drugs acting on the reninangiotensin-aldosterone Drugs acting on the reninangiotensin-aldosterone system John McMurray Eugene Braunwald Scholar in Cardiovascular Diseases, Brigham and Women s Hospital, Boston & Visiting Professor, Harvard Medical School

More information


LXIV: DRUGS: 4. RAS BLOCKADE LXIV: DRUGS: 4. RAS BLOCKADE ACE Inhibitors Components of RAS Actions of Angiotensin i II Indications for ACEIs Contraindications RAS blockade in hypertension RAS blockade in CAD RAS blockade in HF Limitations

More information

Where are we with RAS blockade? New Targets.

Where are we with RAS blockade? New Targets. Where are we with RAS blockade? New Targets. Pr. M. Burnier Service of Nephrology and Hypertension Consultation Centre Hospitalier Universitaire Vaudois Lausanne, Switzerland Introduction of new antihypertensive

More information

Hypertension Management Focus on new RAAS blocker. Disclosure

Hypertension Management Focus on new RAAS blocker. Disclosure Hypertension Management Focus on new RAAS blocker Rameshkumar Raman M.D Endocrine Associates of The Quad Cities Disclosure Speaker bureau Abbott, Eli Lilly, Novo Nordisk, Novartis, Takeda, Merck, Solvay

More information



More information


THE RENIN-ANGIOTENSIN-ALDOSTERONE SYSTEM THE RENIN-ANGIOTENSIN-ALDOSTERONE SYSTEM The renin angiotensin system (RAS) or the renin angiotensin aldosterone system (RAAS) is a hormone system that is involved in the regulation of the plasma sodium

More information

Unmet Need in Hypertension and Heart Failure

Unmet Need in Hypertension and Heart Failure Angioplasty Summit 2008: Novartis Symposium Unmet Need in Hypertension and Heart Failure -ASPIRE HIGHER: Are there still existing unmet needs? What we expect from new antihypertensive treatment Sang Hong

More information


VALUE OF ACEI IN THE MANAGEMENT OF HYPERTENSION VALUE OF ACEI IN THE MANAGEMENT OF HYPERTENSION Dr Catherine BESEME Paris 6 th December 2005 6 th International Congress of Bangladesh Society of Medicine Hypertension is a risk factor at the source, with

More information

Byvalson. (nebivolol, valsartan) New Product Slideshow

Byvalson. (nebivolol, valsartan) New Product Slideshow Byvalson (nebivolol, valsartan) New Product Slideshow Introduction Brand name: Byvalson Generic name: Nebivolol, valsartan Pharmacological class: Beta-blocker + angiotensin II receptor blocker (ARB) Strength

More information

Aldosterone synthase inhibitors. John McMurray BHF Cardiovascular Research Centre University of Glasgow

Aldosterone synthase inhibitors. John McMurray BHF Cardiovascular Research Centre University of Glasgow Aldosterone synthase inhibitors John McMurray BHF Cardiovascular Research Centre University of Glasgow Inhibition of aldosterone synthesis is hypothesized to be of benefit to patients with cardiovascular

More information

Management of Hypertension. M Misra MD MRCP (UK) Division of Nephrology University of Missouri School of Medicine

Management of Hypertension. M Misra MD MRCP (UK) Division of Nephrology University of Missouri School of Medicine Management of Hypertension M Misra MD MRCP (UK) Division of Nephrology University of Missouri School of Medicine Disturbing Trends in Hypertension HTN awareness, treatment and control rates are decreasing

More information

The renin-angiotensin aldosterone system (RAAS) is

The renin-angiotensin aldosterone system (RAAS) is James L. Pool, MD Abstract Background: Despite the availability of many effective, well-tolerated drugs, a significant proportion of treated hypertensive patients still have uncontrolled high blood pressure

More information

The real picture. Prorenin (Renin) PRR AT3 AT4. AT4 receptor. PAI 1 Abassi, Biochem Pharm, 2009

The real picture. Prorenin (Renin) PRR AT3 AT4. AT4 receptor. PAI 1 Abassi, Biochem Pharm, 2009 The real picture. Prorenin (Renin) PRR AT3-8 AT4 AT10-12 AT3 AT4 receptor PAI 1 Abassi, Biochem Pharm, 2009 Resistant Hypertension; Case based discussion Moving Targets? RAAS blockade in hypertensive CKD

More information

Hypertension Update Clinical Controversies Regarding Age and Race

Hypertension Update Clinical Controversies Regarding Age and Race Hypertension Update Clinical Controversies Regarding Age and Race Allison Helmer, PharmD, BCACP Assistant Clinical Professor Auburn University Harrison School of Pharmacy July 22, 2017 DISCLOSURE/CONFLICT

More information

Entresto Development of sacubitril/valsartan (LCZ696) for the treatment of heart failure with reduced ejection fraction

Entresto Development of sacubitril/valsartan (LCZ696) for the treatment of heart failure with reduced ejection fraction Cardio-Metabolic Franchise Entresto Development of sacubitril/valsartan (LCZ696) for the treatment of heart failure with reduced ejection fraction Randy L Webb, PhD Rutgers Workshop October 21, 2016 Heart

More information

Diabetic Nephropathy. Anna Vinnikova, M.D. Associate Professor Division of Nephrology

Diabetic Nephropathy. Anna Vinnikova, M.D. Associate Professor Division of Nephrology Diabetic Nephropathy Anna Vinnikova, M.D. Associate Professor Division of Nephrology Syndrome of inappropriate hyperglycemia due to either insulin deficiency or insulin resistance Type 1: is absolute deficiency

More information

Cedars Sinai Diabetes. Michael A. Weber

Cedars Sinai Diabetes. Michael A. Weber Cedars Sinai Diabetes Michael A. Weber Speaker Disclosures I disclose that I am a Consultant for: Ablative Solutions, Boston Scientific, Boehringer Ingelheim, Eli Lilly, Forest, Medtronics, Novartis, ReCor

More information

Lessons learned from AASK (African-American Study of Kidney Disease and Hypertension)

Lessons learned from AASK (African-American Study of Kidney Disease and Hypertension) Lessons learned from AASK (African-American Study of Kidney Disease and Hypertension) Janice P. Lea, MD, MSc, FASN Professor of Medicine Chief Medical Director of Emory Dialysis ASH Clinical Specialist

More information

Methodologic Issues in the Measurement of Urinary Renin

Methodologic Issues in the Measurement of Urinary Renin Article Methodologic Issues in the Measurement of Urinary Renin Lodi C.W. Roksnoer, Koen Verdonk, Ingrid M. Garrelds, Jeanette M.G. van Gool, Robert Zietse, Ewout J. Hoorn, and A.H. Jan Danser Abstract

More information

LCZ696 A First-in-Class Angiotensin Receptor Neprilysin Inhibitor

LCZ696 A First-in-Class Angiotensin Receptor Neprilysin Inhibitor The Angiotensin Receptor Neprilysin Inhibitor LCZ696 in Heart Failure with Preserved Ejection Fraction The Prospective comparison of ARNI with ARB on Management Of heart failure with preserved ejection

More information

By Edward Wassef, RPh, PharmD

By Edward Wassef, RPh, PharmD CE Free OBJECTIVES Continuing Education Lesson Upon successfully completing this lesson, the pharmacist will be able to: 1. discuss the importance of controlling hypertension. 2. describe the current Canadian

More information

Metabolic Syndrome and Chronic Kidney Disease

Metabolic Syndrome and Chronic Kidney Disease Metabolic Syndrome and Chronic Kidney Disease Definition of Metabolic Syndrome National Cholesterol Education Program (NCEP) Adult Treatment Panel (ATP) III Abdominal obesity, defined as a waist circumference

More information

Best Therapy for Resistant Hypertension: The PATHWAY-2 2 Study

Best Therapy for Resistant Hypertension: The PATHWAY-2 2 Study Best Therapy for Resistant Hypertension: The PATHWAY-2 2 Study Antonio Coca MD, PhD, FRCP, FESC Council on Hypertension. European Society of Cardiology Hypertension and Vascular Risk Unit. Department of

More information

RAS Blockade Across the CV Continuum

RAS Blockade Across the CV Continuum A Summary of Recent International Meetings RAS Blockade Across the CV Continuum Copyright New Evidence Presented at the 2009 Congress of the European Society of Cardiology (August 29-September 2, Barcelona)

More information

Endocrine hypertensionmolecules. Marie Freel Caledonian Endocrine Society Meeting 29 th November 2015

Endocrine hypertensionmolecules. Marie Freel Caledonian Endocrine Society Meeting 29 th November 2015 Endocrine hypertensionmolecules and genes Marie Freel Caledonian Endocrine Society Meeting 29 th November 2015 Plan Mineralocorticoid hypertension Myths surrounding Primary Aldosteronism (PA) New developments

More information

A Fresh Look at ARBs : Focus on HF survival data

A Fresh Look at ARBs : Focus on HF survival data A Fresh Look at ARBs : Focus on HF survival data Seok-Min Kang, MD, Ph D. Division of Cardiology, Severance Cardiovascular Hospital, Yonsei University College of Medicine, Seoul, Korea HF specialists ARBs,

More information

Overview & Update on the Utilization of the Natriuretic Peptides in Heart Failure

Overview & Update on the Utilization of the Natriuretic Peptides in Heart Failure June 28, 2016 Overview & Update on the Utilization of the Natriuretic Peptides in Heart Failure Linda C. Rogers, PhD, DABCC, FACB. Agenda Overview of the Natriuretic Peptides and Efficacy studies Similarities

More information

Preventing the cardiovascular complications of hypertension

Preventing the cardiovascular complications of hypertension European Heart Journal Supplements (2004) 6 (Supplement H), H37 H42 Preventing the cardiovascular complications of hypertension Peter Trenkwalder* Department of Internal Medicine, Starnberg Hospital, Ludwig

More information

Launch Meeting 3 rd April 2014, Lucas House, Birmingham

Launch Meeting 3 rd April 2014, Lucas House, Birmingham Angiotensin Converting Enzyme inhibitor (ACEi) / Angiotensin Receptor Blocker (ARB) To STOP OR Not in Advanced Renal Disease Launch Meeting 3 rd April 2014, Lucas House, Birmingham Prof Sunil Bhandari

More information

Albuminuria: A target for treatment? Todd W.B. Gehr, M.D. Professor of Medicine

Albuminuria: A target for treatment? Todd W.B. Gehr, M.D. Professor of Medicine Albuminuria: A target for treatment? Todd W.B. Gehr, M.D. Professor of Medicine Virginia Commonwealth University ESRD Incidence Rates* by 150 Primary Diagnosis, 1988 1997 Rate/Million Pop./Year 100 Diabetes

More information

The CARI Guidelines Caring for Australians with Renal Impairment. Specific effects of calcium channel blockers in diabetic nephropathy GUIDELINES

The CARI Guidelines Caring for Australians with Renal Impairment. Specific effects of calcium channel blockers in diabetic nephropathy GUIDELINES Specific effects of calcium channel blockers in diabetic nephropathy Date written: September 2004 Final submission: September 2005 Author: Kathy Nicholls GUIDELINES a. Non-dihydropyridine calcium channel

More information

Circulation. Blood Pressure and Antihypertensive Medications. Venous Return. Arterial flow. Regulation of Cardiac Output.

Circulation. Blood Pressure and Antihypertensive Medications. Venous Return. Arterial flow. Regulation of Cardiac Output. Circulation Blood Pressure and Antihypertensive Medications Two systems Pulmonary (low pressure) Systemic (high pressure) Aorta 120 mmhg Large arteries 110 mmhg Arterioles 40 mmhg Arteriolar capillaries

More information

Kidney Disease, Hypertension and Cardiovascular Risk

Kidney Disease, Hypertension and Cardiovascular Risk 1 Kidney Disease, Hypertension and Cardiovascular Risk George Bakris, MD, FAHA, FASN Professor of Medicine Director, Hypertensive Diseases Unit The University of Chicago-Pritzker School of Medicine Chicago,

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Wanner C, Inzucchi SE, Lachin JM, et al. Empagliflozin and

More information

Updates in primary hyperaldosteronism and the rule

Updates in primary hyperaldosteronism and the rule Updates in primary hyperaldosteronism and the 20-50 rule I. David Weiner, M.D. C. Craig and Audrae Tisher Chair in Nephrology Professor of Medicine and Physiology and Functional Genomics University of

More information

Renal protection by inhibition of the renin-angiotensinaldosterone

Renal protection by inhibition of the renin-angiotensinaldosterone Renal protection by inhibition of the renin-angiotensinaldosterone system Tomas Berl Key words: angiotensinconverting enzyme inhibitor, angiotensin receptor blocker, combination therapy, direct renin inhibitor,

More information


Review article: RENIN INHIBITORS IN DIABETES AND HYPERTENSION: AN UPDATE Review article: RENIN INHIBITORS IN DIABETES AND HYPERTENSION: AN UPDATE Selçuk Şen, Baran Ufuktepe, Zeynep Güneş Özünal, Yağız Üresin* Department of Medical Pharmacology, Istanbul Faculty of Medicine,

More information

Introduction. Kristina Allikmets REVIEW

Introduction. Kristina Allikmets REVIEW REVIEW Aliskiren an orally active renin inhibitor. Review of pharmacology, pharmacodynamics, kinetics, and clinical potential in the treatment of hypertension Kristina Allikmets Department of Drug Development

More information

The promise of the thiazolidinediones in the management of type 2 diabetes-associated cardiovascular disease

The promise of the thiazolidinediones in the management of type 2 diabetes-associated cardiovascular disease The promise of the thiazolidinediones in the management of type 2 diabetes-associated cardiovascular disease Steve Smith, Group Director Scientific Affairs, Diabetes & Metabolism GlaxoSmithKline R & D

More information

Review. Rationale for the use of multiple blockers of the renin angiotensin aldosterone system in specific patient populations

Review. Rationale for the use of multiple blockers of the renin angiotensin aldosterone system in specific patient populations Rationale for the use of multiple blockers of the renin angiotensin aldosterone system in specific patient populations Review Blockers of the renin angiotensin aldosterone system (RAAS) have an established

More information

By Prof. Khaled El-Rabat

By Prof. Khaled El-Rabat What is The Optimum? By Prof. Khaled El-Rabat Professor of Cardiology - Benha Faculty of Medicine HT. Introduction Despite major worldwide efforts over recent decades directed at diagnosing and treating

More information

Estrogens vs Testosterone for cardiovascular health and longevity

Estrogens vs Testosterone for cardiovascular health and longevity Estrogens vs Testosterone for cardiovascular health and longevity Panagiota Pietri, MD, PhD, FESC Director of Hypertension Unit Athens Medical Center Athens, Greece Women vs Men Is there a difference in

More information

Direct renin inhibitors: the dawn of a new era, or just a variation on a theme?

Direct renin inhibitors: the dawn of a new era, or just a variation on a theme? Nephrol Dial Transplant (2007) 22: 2435 2439 doi:10.1093/ndt/gfm363 Advance Access publication 7 June 2007 Editorial Review Direct renin inhibitors: the dawn of a new era, or just a variation on a theme?

More information

RENAAL, IRMA-2 and IDNT. Three featured trials linking a disease spectrum IDNT RENAAL. Death IRMA 2

RENAAL, IRMA-2 and IDNT. Three featured trials linking a disease spectrum IDNT RENAAL. Death IRMA 2 Treatment of Diabetic Nephropathy and Proteinuria Background End stage renal disease is a major cause of death and disability among diabetics BP reduction is important to slow the progression of diabetic

More information

Combination therapy Giuseppe M.C. Rosano, MD, PhD, MSc, FESC, FHFA St George s Hospitals NHS Trust University of London

Combination therapy Giuseppe M.C. Rosano, MD, PhD, MSc, FESC, FHFA St George s Hospitals NHS Trust University of London Combination therapy Giuseppe M.C. Rosano, MD, PhD, MSc, FESC, FHFA St George s Hospitals NHS Trust University of London KCS Congress: Impact through collaboration CONTACT: Tel. +254 735 833 803 Email:

More information

Jared Moore, MD, FACP

Jared Moore, MD, FACP Hypertension 101 Jared Moore, MD, FACP Assistant Program Director, Internal Medicine Residency Clinical Assistant Professor of Internal Medicine Division of General Medicine The Ohio State University Wexner

More information

ALLHAT Role of Diuretics in the Prevention of Heart Failure - The Antihypertensive and Lipid- Lowering Treatment to Prevent Heart Attack Trial

ALLHAT Role of Diuretics in the Prevention of Heart Failure - The Antihypertensive and Lipid- Lowering Treatment to Prevent Heart Attack Trial 1 ALLHAT Role of Diuretics in the Prevention of Heart Failure - The Antihypertensive and Lipid- Lowering Treatment to Prevent Heart Attack Trial Davis BR, Piller LB, Cutler JA, et al. Circulation 2006.113:2201-2210.

More information

Dr. Mehmet Kanbay Department of Medicine Division of Nephrology Istanbul Medeniyet University School of Medicine Istanbul, Turkey.

Dr. Mehmet Kanbay Department of Medicine Division of Nephrology Istanbul Medeniyet University School of Medicine Istanbul, Turkey. The uric acid dilemma: causal risk factor for hypertension and CKD or mere bystander? Mehmet Kanbay, Istanbul, Turkey Chairs: Anton H. van den Meiracker, Rotterdam, The Netherlands Claudia R.C. Van Roeyen,

More information

Since 1898, when renin was isolated from

Since 1898, when renin was isolated from NARRATIVE REVIEW Dual Blockade of the Renin-Angiotensin System for Cardiorenal Protection: An Update Mustafa Arıcı, MD, and Yunus Erdem, MD The renin-angiotensin system (RAS) has an important role in hypertension

More information

Changes in Guideline Trends and Applications in Practice: JNC 2013

Changes in Guideline Trends and Applications in Practice: JNC 2013 Changes in Guideline Trends and Applications in Practice: JNC 2013 George L. Bakris, MD, FAHA, FASN Professor of Medicine Director of the ASH Hypertension Center The University of Chicago Medicine Chicago,

More information

The renin inhibitor aliskiren (Tekturna

The renin inhibitor aliskiren (Tekturna AJH 2007; 20:587 597 Aliskiren, the First Renin Inhibitor for Treating Hypertension: Reactive Renin Secretion May Limit Its Effectiveness Jean E. Sealey and John H. Laragh A review of six clinical trials

More information

Hypertension management and renin-angiotensin-aldosterone system blockade in patients with diabetes, nephropathy and/or chronic kidney disease

Hypertension management and renin-angiotensin-aldosterone system blockade in patients with diabetes, nephropathy and/or chronic kidney disease Hypertension management and renin-angiotensin-aldosterone system blockade in patients with diabetes, nephropathy and/or chronic kidney disease July 2017 Indranil Dasgupta DM FRCP, Debasish Banerjee MD

More information

Scientific conclusions and detailed explanation of the scientific grounds for the differences from the PRAC recommendation

Scientific conclusions and detailed explanation of the scientific grounds for the differences from the PRAC recommendation Annex I Scientific conclusions, grounds for variation to the terms of the marketing authorisations and detailed explanation of the scientific grounds for the differences from the PRAC recommendation 1

More information

Abbreviations Cardiology I

Abbreviations Cardiology I Cardiology I and Clinical Controversies Joseph J. Saseen, Pharm.D., FCCP, BCPS (AQ Cardiology) Reviewed by Stuart T. Haines, Pharm.D., FCCP, BCPS; and Michelle M. Richardson, Pharm.D., FCCP, BCPS Learning

More information

This clinical study synopsis is provided in line with Boehringer Ingelheim s Policy on Transparency and Publication of Clinical Study Data.

This clinical study synopsis is provided in line with Boehringer Ingelheim s Policy on Transparency and Publication of Clinical Study Data. abcd Clinical Study Synopsis for Public Disclosure This clinical study synopsis is provided in line with s Policy on Transparency and Publication of Clinical Study Data. The synopsis which is part of the

More information

Therapeutic approaches to slowing the progression of diabetic nephropathy is less best?

Therapeutic approaches to slowing the progression of diabetic nephropathy is less best? The journal of interventions in clinical practice REVIEW Therapeutic approaches to slowing the progression of diabetic nephropathy is less best? FULL TEXT ARTICLE Eva Vivian, 1 Chelsea

More information

Causes of Poor BP control Rates

Causes of Poor BP control Rates Goals Of Hypertension Management in Clinical Practice World Hypertension League (WHL) Meeting Adel E. Berbari, MD, FAHA, FACP Professor of Medicine and Physiology Head, Division of Hypertension and Vascular

More information

Difficult to Treat Hypertension

Difficult to Treat Hypertension Difficult to Treat Hypertension According to Goldilocks JNC 8 Blood Pressure Goals (2014) BP Goal 60 years old and greater*- systolic < 150 and diastolic < 90. (Grade A)** BP Goal 18-59 years old* diastolic

More information

Hypertension Update 2009

Hypertension Update 2009 Hypertension Update 2009 New Drugs, New Goals, New Approaches, New Lessons from Clinical Trials Timothy C Fagan, MD, FACP Professor Emeritus University of Arizona New Drugs Direct Renin Inhibitors Endothelin

More information



More information

Tiny Jaarsma Linköping University No conflict of interest

Tiny Jaarsma Linköping University No conflict of interest Detrimental effects of sodium in heart failure - Tiny Jaarsma Linköping University No conflict of interest Sodium restriction in Heart Failure Why? Prevention of heart failure Blood pressure treatment

More information

The renin angiotensin aldosterone system (RAAS) is a

The renin angiotensin aldosterone system (RAAS) is a Original Article Multiple Ascending Dose Study With the New Renin Inhibitor VTP-27999 Nephrocentric Consequences of Too Much Renin Inhibition Joanna Balcarek,* Bruno Sevá Pessôa,* Catherine Bryson, Michel

More information

Hypertension in Geriatrics. Dr. Allen Liu Consultant Nephrologist 10 September 2016

Hypertension in Geriatrics. Dr. Allen Liu Consultant Nephrologist 10 September 2016 Hypertension in Geriatrics Dr. Allen Liu Consultant Nephrologist 10 September 2016 Annual mortality (%) Cardiovascular Mortality Rates are Higher among Dialysis Patients 100 10 1 0.1 0.01 0.001 25-34

More information

Hypertension Management and End Organ Protection: Focus on Aliskiren

Hypertension Management and End Organ Protection: Focus on Aliskiren REVIEW Hypertension Management and End Organ Protection: Focus on Toshio Imanishi, Hiroto Tsujioka and Takashi Akasaka Department of Cardiovascular Medicine, Wakayama Medical University. 811-1, Kimiidera,

More information

Primary Aldosteronism

Primary Aldosteronism Primary Aldosteronism Odelia Cooper, MD Assistant Professor of Medicine Division of Endocrinology, Diabetes, and Metabolism Cedars-Sinai Medical Center HYPERTENSION CENTER Barriers to diagnosing primary

More information

Amlodipine/Valsartan (Exforge ) Changing the Landscape of BP Management

Amlodipine/Valsartan (Exforge ) Changing the Landscape of BP Management Amlodipine/Valsartan (Exforge ) Changing the Landscape of BP Management Bum-Kee Hong Yongdong Severance Hospital Yonsei University College of Medicine Rationale for Multiple-Mechanism Therapy Inadequacy

More information

Faculty. Disclosures. Learning Objectives. Definitions. Definitions (cont) The Role of the Kidney in Cardiometabolic Disease

Faculty. Disclosures. Learning Objectives. Definitions. Definitions (cont) The Role of the Kidney in Cardiometabolic Disease Faculty The Role of the Kidney in Cardiometabolic Disease Christian W. Mende, MD, FACP, FACN, FASN, FASH Clinical Professor of Medicine University of California at San Diego San Diego, California Disclosures

More information

Introduction. Original Article

Introduction. Original Article 530018JRA0010.1177/1470320314530018Journal of the Renin-Angiotensin-Aldosterone SystemImbalzano et al. research-article2014 Original Article Combination therapy with aliskiren versus ramipril or losartan

More information

Can Anti-hypertension Therapy Reverse Vascular Aging and Dementia?

Can Anti-hypertension Therapy Reverse Vascular Aging and Dementia? 2012. 4. 20-21 춘계심장학회 _ 부산 Can Anti-hypertension Therapy Reverse Vascular Aging and Dementia? Jeong Bae Park, MD, PhD Cardiology, Cheil General Hospital, Kwandong University, Seoul, Korea The Pulse : revived

More information

COMPLEX HYPERTENSION. Anita Ralstin, FNP-BC Next Step Health Consultant, LLC

COMPLEX HYPERTENSION. Anita Ralstin, FNP-BC Next Step Health Consultant, LLC COMPLEX HYPERTENSION Anita Ralstin, FNP-BC Next Step Health Consultant, LLC Incidence Of Hypertension About 70 million American adults have high blood pressure. About 33% of the population Only 52% have

More information

Amlodipine/olmesartan (Azor ) is indicated for the treatment of hypertension, alone or in combination with other antihypertensive medications.

Amlodipine/olmesartan (Azor ) is indicated for the treatment of hypertension, alone or in combination with other antihypertensive medications. Page 1 of 8 Policies Repository Policy Title Policy Number Oral Antihypertensive Agents FS.CLIN.9 Application of Pharmacy Policy is determined by benefits and contracts. Benefits may vary based on product

More information

Approach to patient with hypertension. Dr. Amitesh Aggarwal

Approach to patient with hypertension. Dr. Amitesh Aggarwal Approach to patient with hypertension Dr. Amitesh Aggarwal Definition A systolic blood pressure ( SBP) >139 mmhg and/or A diastolic (DBP) >89 mmhg. Based on the average of two or more properly measured,

More information

E.Ritz Heidelberg (Germany)

E.Ritz Heidelberg (Germany) Predictive capacity of renal function in cardiovascular disease E.Ritz Heidelberg (Germany) If a cure is not achieved, the kidneys will pass on the disease to the heart Huang Ti Nei Ching Su Wen The Yellow

More information

Hypertension Management Controversies in the Elderly Patient

Hypertension Management Controversies in the Elderly Patient Hypertension Management Controversies in the Elderly Patient Juan Bowen, MD Geriatric Update for the Primary Care Provider November 17, 2016 2016 MFMER slide-1 Disclosure No financial relationships No

More information

Val-MARC: Valsartan-Managing Blood Pressure Aggressively and Evaluating Reductions in hs-crp

Val-MARC: Valsartan-Managing Blood Pressure Aggressively and Evaluating Reductions in hs-crp Página 1 de 5 Return to Medscape coverage of: American Society of Hypertension 21st Annual Scientific Meeting and Exposition Val-MARC: Valsartan-Managing Blood Pressure Aggressively and Evaluating Reductions

More information

ISPUB.COM. Comparing Weight Reduction and Medications in Treating Mild Hypertension: A Systematic Literature Review. S Hamlin, T Brown BACKGROUND

ISPUB.COM. Comparing Weight Reduction and Medications in Treating Mild Hypertension: A Systematic Literature Review. S Hamlin, T Brown BACKGROUND ISPUB.COM The Internet Journal of Advanced Nursing Practice Volume 3 Number 2 Comparing Weight Reduction and Medications in Treating Mild Hypertension: A Systematic Literature S Hamlin, T Brown Citation

More information

Combination of renin-angiotensinaldosterone. how to choose?

Combination of renin-angiotensinaldosterone. how to choose? Combination of renin-angiotensinaldosterone system inhibitors how to choose? Karl Swedberg Professor of Medicine Sahlgrenska Academy University of Gothenburg Disclosures Research grants

More information

A systematic review and meta-analysis of aliskiren and angiotension receptor blockers in the management of essential hypertension

A systematic review and meta-analysis of aliskiren and angiotension receptor blockers in the management of essential hypertension Article A systematic review and meta-analysis of aliskiren and angiotension receptor blockers in the management of essential hypertension Journal of the Renin-Angiotensin- Aldosterone System 12(2) 102

More information

신장환자의혈압조절 나기영. Factors involved in the regulation of blood pressure

신장환자의혈압조절 나기영. Factors involved in the regulation of blood pressure 신장환자의혈압조절 K/DOQI Clinical practice guidelines on Hypertension and Antihypertensive agents in CKD 나기영 Factors involved in the regulation of blood pressure Renal function curve MAP (mmhg) Central role of

More information

1. Antihypertensive agents 2. Vasodilators & treatment of angina 3. Drugs used in heart failure 4. Drugs used in arrhythmias

1. Antihypertensive agents 2. Vasodilators & treatment of angina 3. Drugs used in heart failure 4. Drugs used in arrhythmias 1. Antihypertensive agents 2. Vasodilators & treatment of angina 3. Drugs used in heart failure 4. Drugs used in arrhythmias Only need to know drugs discussed in class At the end of this section you should

More information

AMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD

AMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD AMDCC Progress Report Duke/UNC/Stanford Unit Program Director Thomas M. Coffman, MD Susceptibility Mutation Model Development + ApoE-/- +STZ Kidney Phenotype Screen Vascular & Kidney Phenotype Screen Generate

More information

Clinical cases with Coversyl 10 mg

Clinical cases with Coversyl 10 mg Clinical cases Coversyl 10 mg For upgraded benefits in hypertension A Editorial This brochure, Clinical cases Coversyl 10 mg for upgraded benefits in hypertension, illustrates a variety of hypertensive

More information

Management of Hypertension in special groups. DR-Mohammed Salah Assistant Lecturer of Cardiology Mansoura University

Management of Hypertension in special groups. DR-Mohammed Salah Assistant Lecturer of Cardiology Mansoura University Management of Hypertension in special groups BY DR-Mohammed Salah Assistant Lecturer of Cardiology Mansoura University AGENDA SPECIAL GROUPS SPECIFIC DRUDS FOR SPECIAL GROUPS TARGET BP FOR SPECIAL GROUPS:

More information

Hypertension Management in Diabetic Patients

Hypertension Management in Diabetic Patients Hypertension Management in Diabetic Patients Park, Chang G, MD, PhD Cardiovascular Center, Guro Hospital, Korea University Medical School Contents (Treatment of 2 Cases) Type 2 Diabetes Mellitus Hypertension

More information

Hypertension Putting the Guidelines into Practice

Hypertension Putting the Guidelines into Practice Hypertension 2017 Putting the Guidelines into Practice Disclosures Relationships with commercial interests: Grants/Research Support: Speakers Bureau/Honoraria: Consulting Fees: Data Safety and Monitoring:

More information

Combination therapy in the treatment of arterial hypertension. Franco Veglio SIIIA. UNIVERSITA degli STUDI di TORINO


More information



More information

Management of New-Onset Proteinuria in the Ambulatory Care Setting. Akinlolu Ojo, MD, PhD, MBA

Management of New-Onset Proteinuria in the Ambulatory Care Setting. Akinlolu Ojo, MD, PhD, MBA Management of New-Onset Proteinuria in the Ambulatory Care Setting Akinlolu Ojo, MD, PhD, MBA Urine dipstick results Negative Trace between 15 and 30 mg/dl 1+ between 30 and 100 mg/dl 2+ between 100 and

More information

Cardiovascular Implications of Proteinuria

Cardiovascular Implications of Proteinuria Cardiovascular Implications of Proteinuria B. S. Kasinath, MD University of Texas Health Science Center South Texas Veterans Health Care System San Antonio Objectives Mechanisms of albumin handling by

More information

Valsartan Amlodipine HCT Combination: Control To Goal. Dr. Sameh Shaheen M.B.B.Ch, MSc, MD, FESC, FSCAI. Prof of cardiology Ain Shams University

Valsartan Amlodipine HCT Combination: Control To Goal. Dr. Sameh Shaheen M.B.B.Ch, MSc, MD, FESC, FSCAI. Prof of cardiology Ain Shams University Valsartan Amlodipine HCT Combination: Control To Goal Dr. Sameh Shaheen M.B.B.Ch, MSc, MD, FESC, FSCAI Prof of cardiology Ain Shams University Sonesta Hotel Cairo Egypt December 4 th 5 th ; 213 Hypertension

More information

Cardiovascular Disease in CKD. Parham Eftekhari, D.O., M.Sc. Assistant Clinical Professor Medicine NSUCOM / Broward General Medical Center

Cardiovascular Disease in CKD. Parham Eftekhari, D.O., M.Sc. Assistant Clinical Professor Medicine NSUCOM / Broward General Medical Center Cardiovascular Disease in CKD Parham Eftekhari, D.O., M.Sc. Assistant Clinical Professor Medicine NSUCOM / Broward General Medical Center Objectives Describe prevalence for cardiovascular disease in CKD

More information

Ejection Fraction in Patients With Chronic Heart Failure. Diastolic Heart Failure or Heart Failure with Preserved Ejection Fraction

Ejection Fraction in Patients With Chronic Heart Failure. Diastolic Heart Failure or Heart Failure with Preserved Ejection Fraction Diastolic Heart Failure or Heart Failure with Preserved Ejection Fraction Keith Miller MD Diastolic Heart Failure Risk Factors Common Risk Factors Aging Female gender Obesity Hypertension Diabetes mellitus

More information

Risk Stratification in Heart Failure: The Role of Emerging Biomarkers

Risk Stratification in Heart Failure: The Role of Emerging Biomarkers Risk Stratification in Heart Failure: The Role of Emerging Biomarkers David G. Grenache, PhD Associate Professor of Pathology, University of Utah Medical Director, ARUP Laboratories Salt Lake City, UT

More information

Renal Denervation. Henry Krum MBBS PhD FRACP. Centre of Cardiovascular Research & Monash University/Alfred Hospital;

Renal Denervation. Henry Krum MBBS PhD FRACP. Centre of Cardiovascular Research & Monash University/Alfred Hospital; Renal Denervation Henry Krum MBBS PhD FRACP Centre of Cardiovascular Research & Education in Therapeutics, Monash University/Alfred Hospital; Alfred Heart Centre, The Alfred Hospital, Melbourne Australia

More information

Blood Pressure Monitoring in Chronic Kidney Disease

Blood Pressure Monitoring in Chronic Kidney Disease Blood Pressure Monitoring in Chronic Kidney Disease Aldo J. Peixoto, MD FASN FASH Associate Professor of Medicine (Nephrology), YSM Associate Chief of Medicine, VACT Director of Hypertension, VACT American

More information

Uric acid and CKD. Sunil Badve Conjoint Associate Professor, UNSW Staff Specialist, St George

Uric acid and CKD. Sunil Badve Conjoint Associate Professor, UNSW Staff Specialist, St George Uric acid and CKD Sunil Badve Conjoint Associate Professor, UNSW Staff Specialist, St George Hospital @Badves Case Mr J, 52 Male, referred in June 2015 DM type 2 (4 years), HTN, diabetic retinopathy, diabetic

More information

Angiotensin Converting Enzyme inhibitor (ACEi) / Angiotensin Receptor Blocker (ARB) To STOP OR Not in Advanced Renal Disease

Angiotensin Converting Enzyme inhibitor (ACEi) / Angiotensin Receptor Blocker (ARB) To STOP OR Not in Advanced Renal Disease Angiotensin Converting Enzyme inhibitor (ACEi) / Angiotensin Receptor Blocker (ARB) To STOP OR Not in Advanced Renal Disease Investigator Meetings 1 st and 2 nd September 2016 - London and Leeds Prof Sunil

More information