Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System

Size: px
Start display at page:

Download "Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System"

Transcription

1 BASIC RESEARCH Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System Yan Zhang,* Juan Kong,* Dilip K. Deb,* Anthony Chang, and Yan Chun Li* Departments of *Medicine and Pathology, Division of Biological Sciences, University of Chicago, Chicago, Illinois ABSTRACT Analogs of vitamin D attenuate renal injury in several models of kidney disease, but the mechanism underlying this renoprotective effect is unknown. To address the role of the vitamin D receptor (VDR) in renal fibrogenesis, we subjected VDR-null mice to unilateral ureteral obstruction for 7 days. Compared with wild-type mice, VDR-null mice developed more severe renal damage in the obstructed kidney, with marked tubular atrophy and interstitial fibrosis. Significant induction of extracellular matrix proteins (fibronectin and collagen I), profibrogenic and proinflammatory factors (TGF-, connective tissue growth factor, and monocyte chemoattractant protein 1), and epithelial-to-mesenchymal transition accompanied this histologic damage. Because VDR ablation activates the renin-angiotensin system and leads to accumulation of angiotensin II (AngII) in the kidney, we assessed whether elevated AngII in the VDR-null kidney promotes injury. Treatment with the angiotensin type 1 antagonist losartan eliminated the difference in obstruction-induced interstitial fibrosis between wild-type and VDR-null mice, suggesting that AngII contributes to the enhanced renal fibrosis observed in obstructed VDR-null kidneys. Taken together, these results suggest that the VDR attenuates obstructive renal injury at least in part by suppressing the renin-angiotensin system. J Am Soc Nephrol 21: , doi: /ASN Interstitial fibrosis is a hallmark of chronic renal failure and strongly correlates with deterioration of renal function, regardless of the underlying disease. Unilateral ureteral obstruction (UUO) is a well-established model of tubulointerstitial fibrosis of the kidney. In this model, damage of the obstructed kidney is accompanied by tubular atrophy and progressive interstitial fibrosis, as a result of excessive production and deposition of extracellular matrix (ECM) in the interstitium. 1 The ECM proteins (e.g., fibronectin [FN], collagens) are secreted from myofibroblasts derived from resident interstitial fibroblasts or from transformed epithelial cells, a process termed epithelial-to-mesenchymal transition (EMT). 2 During this transition process, the epithelial cells lose epithelial markers and gain mesenchymal markers. With the loss of epithelial cell properties, myofibroblasts proliferate, migrate, and produce and deposit a large amount of ECM. In addition, infiltration of immune cells, particularly macrophages, which secret numerous profibrotic factors, is important for the progression of tubulointerstitial fibrosis. 3 Angiotensin II (AngII) and TGF- are two major fibrogenic factors that mediate fibrogenesis in the kidney. 4 The intrarenal renin-angiotensin system (RAS) is activated in obstructive nephropathy, leading to increased production of AngII within the kidney. 3 AngII promotes renal fibrosis directly via the angiotensin type 1 receptor (AT1R) or activation of the TGF- pathway. 5 TGF- is a potent profibrotic factor that directly stimulates the expression of many ECM proteins in renal cells 6 and promotes EMT in the kidney. 2 Received August 27, Accepted January 20, Published online ahead of print. Publication date available at Correspondence: Dr. Yan Chun Li, Department of Medicine, University of Chicago, 900 E. 57th Street, KCBD, Mailbox 9, Chicago, IL Phone: ; Fax: ; cyan@medicine.bsd.uchicago.edu Copyright 2010 by the American Society of Nephrology 966 ISSN : / J Am Soc Nephrol 21: , 2010

2 BASIC RESEARCH Figure 1. VDR-null mice develop more severe renal fibrosis in UUO. VDR( / ) and VDR( / ) mice are subjected to sham-operation or UUO surgery and killed after 7 days. (A) PAS-stained sections from sham-operated and obstructed kidneys of VDR( / ) and VDR( / ) mice. (B) Masson s trichrome stained sections from VDR( / ) and VDR( / ) mice. (C) Semiquantitative score (on a scale of 0 to 4) of renal fibrosis in VDR( / ) and VDR( / ) mice. **P 0.01 versus VDR( / ) (n 4). AngII and TGF- also activate other fibrogenic factors, such as connective tissue growth factor (CTGF), which also plays an important role in renal fibrosis and EMT. 7,8 The vitamin D receptor (VDR) mediates the activity of 1,25-dihydroxyvitamin D 3 [1,25(OH) 2 D 3 ], the active hormonal form of vitamin D. 9 VDR is highly expressed in the kidney and has been shown to play a renoprotective role by targeting the RAS. 10 1,25(OH) 2 D 3 negatively regulates renin expression, 11 and VDR deletion leads to hyperreninemia and activation of the RAS. 12 Mice carrying VDR-null mutation develop substantially worse diabetic renal injury than their wildtype diabetic counterparts, 13 and vitamin D analogs can prevent or attenuate renal injury in a number of experimental models of kidney diseases Liu and colleagues reported that a vitamin D analog was able to ameliorate tubulointerstitial fibrosis by blocking EMT in the UUO model. 18 In this study, by using this model, we demonstrate that VDR attenuates renal fibrosis in vivo by suppressing the RAS. RESULTS VDR( / ) Mice Develop More Severe Renal Fibrosis in the UUO Model To determine the role of VDR in renal fibrogenesis, we subjected wild-type [VDR( / )] and VDR knockout [VDR( / )] mice to UUO and analyzed the mice on day 7 after surgery. Histologic examination by periodic acid-schiff (PAS; Figure 1A) and Masson s trichrome (Figure 1B) staining showed normal renal cortex in the sham-operated kidney from either VDR( / ) or VDR( / ) mice. The obstructed VDR( / ) kidney exhibited prominent dilation with sloughed cells or cellular debris in the tubular lumina, but no obvious interstitial fibrosis or tubular atrophy was detectable. In contrast, the obstructed VDR( / ) kidney showed marked reduction in kidney mass with severe thinning of the renal cortex; the glomeruli were clustered close together, indicating substantial tubular loss. There was severe tubular atrophy and interstitial fibrosis in the obstructed VDR( / ) kidney, as shown by the strong collagen deposition (blue staining in Figure 1B) in the interstitium. Semiquantitative scoring (on a scale of 0 to 4) confirmed that all VDR( / ) mice examined developed severe interstitial fibrosis, whereas VDR( / ) mice showed only mild renal fibrosis within 7 days of UUO (Figure 1C). We then examined the expression of ECM protein FN and collagen I, surrogate markers of renal fibrosis, in the kidney. Quantitative reverse transcriptase PCR (RT-PCR) showed a marked increase in FN and collagen I in the obstructed kidney compared with the sham controls; however, the increase in VDR( / ) mice was more robust than in VDR( / ) mice (Figure 2A). Immunostaining with anti-fn antibody showed strong staining in the fibrotic areas that was more intense in the obstructed VDR( / ) kidney than in the VDR( / ) counterpart (Figure 2B). Western blot analyses of total kidney lysates confirmed the more robust induction of FN protein in the obstructed VDR( / ) kidney (Figure 2, C and D). Induction of Fibrogenic and Inflammatory Factors RT-PCR showed that TGF- and CTGF were induced in the obstructed kidney in both VDR( / ) and VDR( / ) mice, but the induction was more robust in VDR( / ) mice than in the VDR( / ) counterpart (Figure 3). The expression of monocyte chemoattractant protein 1 (MCP-1), a chemokine promoting macrophage infiltration, was also highly induced in the obstructed kidney; however, the induction was also more dramatic in VDR( / ) mice than in VDR( / ) mice (Figure 3). This is consistent with a previous observation that MCP-1 is downregulated by vitamin D hormone 19 ; therefore, VDR deficiency leads to more robust induction of profibrotic and proinflammatory factors in UUO. VDR( / ) Mice Show More Robust EMT EMT is a key feature of UUO. E-cadherin, an epithelial marker, was moderately reduced at mrna and protein levels in the J Am Soc Nephrol 21: , 2010 VDR and Obstructive Nephropathy 967

3 BASIC RESEARCH Figure 2. More robust induction of ECM proteins in VDR-null mice. (A) Real-time RT-PCR quantification of FN and collagen I expression in sham-operated and obstructed kidneys from VDR( / ) and VDR( / ) mice. (B) Immunostaining of kidney sections with anti-fn antibody. Note the strong staining in the obstructed VDR( / ) kidney. (C) Western blot analysis of FN levels in total lysates from sham-operated and obstructed kidneys. (D) Densitometric quantification of FN proteins. *P 0.05 versus sham of the same genotype; #P 0.05 versus VDR( / )-UUO (n 4 to 5). Each lane represents one mouse. obstructed VDR( / ) kidney, consistent with the relatively well-preserved tubular structure; in contrast, the obstructed VDR( / ) kidney showed very dramatic reduction of E-cadherin (Figure 4A), with mrna and protein levels reduced by 80% (Figure 4B) relative to the sham VDR( / ) control. The loss of epithelial markers accompanied the appearance of Figure 3. More robust induction of pro-fibrotic and pro-inflammatory factors in VDR-null mice. (A) RT-PCR examination of TGF-, CTGF, and MCP-1 in sham-operated and obstructed kidneys from VDR( / ) and VDR( / ) mice. (B) Densitometric quantification of the RT-PCR data. *P 0.05, **P 0.01 versus sham of the same genotype; #P 0.05, ##P 0.01 versus VDR( / )-UUO. Each lane represents one mouse. fibroblast markers in the obstructed kidney. -Smooth muscle actin ( -SMA), a marker of myofibroblasts, 20 was barely detectable in sham-operated kidneys (Figure 4, C and D), and immunostaining showed positive staining only in the smooth muscle layer of the blood vessels in sham-operated kidneys (Figure 4G). UUO led to marked upregulation of -SMA in the obstructed kidneys, as shown by Western blot (Figure 4, C and D) and immunostaining (Figure 4G). The induction was much more robust in the obstructed VDR( / ) kidney than in the VDR( / ) counterpart (Figure 4, C, D, and G). The induction of -SMA was mainly localized in the highly fibrotic area (Figure 4G). Consistently, Snail, the transcription factor known to play a key role in EMT, 21 was also highly induced in the obstructed kidney, and, as expected, Snail induction was much higher in the obstructed VDR( / ) kidney than in the VDR( / ) counterpart (Figure 4, E and F). Activation of the RAS in UUO To understand the mechanism underlying the enhanced renal fibrosis in VDR( / ) mice, we focused on the RAS, which was previously shown to be regulated by 1,25(OH) 2 D Immunostaining showed marked accumulation of AngI/II in the interstitium of the sham VDR( / ) kidney (Figure 5A), which thus predisposes the VDR( / ) kidney to fibrosis under ureteral ligation. AngI/II remained high in the fibrotic region of VDR( / ) mice 7 days after UUO (Figure 5A). Semiquantitative analysis of the immunostained sections confirmed that the sham VDR( / ) kidneys showed more intense AngI/II staining than the VDR( / ) counterpart, and the obstructed VDR( / ) kidney had the highest score (Figure 5B). Consistently, Northern blot showed that the baseline renin level was elevated in the sham VDR( / ) kidney, as expected, and renin expression was induced in the obstructed kidney from both VDR( / ) and VDR( / ) mice, with VDR( / ) mice showing much more robust induction (by 35-fold on the basis of the quantitative data; Figure 5, C and D). Further examinations by real-time RT-PCR revealed that renin, (pro)renin receptor, angiotensinogen (AGT), and AT1R all were induced in the obstructed kidney in both VDR( / ) and VDR( / ) mice, with VDR( / ) mice showing more robust induction in renin, (pro) renin receptor, AGT, and AT1R (Figure 5D). In fact, as reported previously, 12,22 the baseline levels of renin and AGT were already elevated in VDR( / ) mice (Figure 5D). These data support the notion that the local renal RAS is activated in UUO, and in the absence of VDR, the RAS is even more activated. Fibrogenic Effect of AngII on Primary Tubular Cells To confirm the fibrogenic activity of AngII in kidney cells, we 968 Journal of the American Society of Nephrology J Am Soc Nephrol 21: , 2010

4 BASIC RESEARCH Figure 4. VDR ablation promotes EMT. (A) Western blot analysis of E-cadherin (E-cad) in sham-operated and obstructed kidneys from VDR( / ) and VDR( / ) mice. (B) Real time RT-PCR and densitometric quantifications of E-cadherin mrna and protein levels in kidneys from VDR( / ) and VDR( / ) mice. (C and D) Western blot (C) and densitometric quantification (D) of -SMA protein. (E and F) Western blot (E) and densitometric quantification (F) of Snail protein in these kidneys. (G) Immunostaining of kidney sections with anti- -SMA antibody. *P 0.05, **P 0.01, ***P versus sham of the same genotype; #P 0.05, ##P 0.01 versus VDR( / )-UUO. treated primary tubular cells isolated from VDR( / ) and VDR( / ) mice with AngII, using TGF- as a positive control. As shown in Figure 6, like TGF-, AngII markedly suppressed E-cadherin expression while stimulating -SMA and Snail in these cells (Figure 6, A and B). Interestingly, the effect of AngII on VDR( / ) cells seemed to be more robust than on VDR( / ) cells (Figure 6C), suggesting that VDR( / ) tubular cells might be more susceptible to AngII EMT stimulation. Given that these cells were cultured in the absence of 1,25(OH) 2 D 3, it is plausible that VDR might negatively regulate EMT in a ligand-independent manner. Blockade of the RAS Blunts the Enhanced Renal Fibrosis in VDR( / ) Mice The data prompted us to hypothesize that activation of the local RAS and hence AngII overproduction in the kidney are responsible for the more robust renal fibrosis seen in the VDR( / ) kidney. To test this hypothesis, we treated VDR( / ) and VDR( / ) mice under UUO with the AT1R blocker losartan for 7 days. Histologic examination with PAS (Figure 7A) and Masson s trichrome (Figure 7B) staining showed mild tubular dilation but little fibrosis in the obstructed kidneys; importantly, the morphologic abnormalities became indistinguishable between VDR( / ) and VDR( / ) mice (Figure 7, A and B). As expected, there was very mild induction of FN and collagen I (Figure 7C), as well as TGF- and CTGF (Figure 7D), in the obstructed kidneys; however, there was no difference in the magnitude of induction for these proteins between VDR( / ) and VDR( / ) kidneys (Figure 7, C and D). The mild induction of FN and collagen I led to no detectable fibrosis in the kidney, because their induction usually precedes the formation of detectable fibrosis. Our renal pathologist s assessment of the fibrosis score was 0 and 0 (on a scale of 0 to 4) for the obstructed VDR( / ) and VDR( / ) kidneys, respectively. Compared with the score of 0.5 and 4.0 obtained in untreated obstructed VDR( / ) and VDR( / ) kidneys (Figure 1C), these results demonstrated a clear renoprotective effect of losartan treatment in UUO. In losartan-treated mice, there was marked reduction of E- cadherin and marked induction of -SMA and Snail in the obstructed kidneys compared with the sham controls; however, the magnitude of changes of these proteins was indistinguishable between VDR( / ) and VDR( / ) mice (Figure 8). These data indicate that blockade of the RAS in the kidney blunts the enhanced EMT and renal fibrosis seen in VDR( / ) mice. DISCUSSION Renal fibrosis is a common downstream event leading to renal J Am Soc Nephrol 21: , 2010 VDR and Obstructive Nephropathy 969

5 BASIC RESEARCH Figure 5. More robust activation of the RAS in VDR-null mice under UUO. (A) Immunostaining of sham-operated and obstructed kidney sections with AngI/II-specific antibody. (B) Semiquantitative score of the AngI/II immunostaining of the kidney sections. (C) Northern blot analysis of renin expression in these kidneys. (D) Real-time RT-PCR analysis of the components of the RAS in the sham-operated and obstructed kidneys from VDR( / ) and VDR( / ) mice. Renin R, (pro)renin receptor; ACE, angiotensin-converting enzyme. *P 0.05, **P 0.01, ***P versus sham of the same genotype; #P 0.05, ##P 0.01, ###P versus corresponding VDR( / ) (sham or UUO). Figure 6. TGF- and Ang II induce EMT in primary tubular cells derived from VDR( / ) and VDR( / ) mice. (A and B) Primary tubular cells isolated from VDR( / ) and VDR( / ) mice are exposed to 10 ng/ml TGF- (A) or 100 nm AngII (B) for 24 hours, and protein levels of E-cadherin, -SMA, and Snail are determined by Western blotting. (C) Densitometric quantification of E-cadherin, -SMA, and Snail proteins. *P 0.05 versus control of the same genotype; #P 0.05 versus VDR( / ) treated. failure; thus, understanding the development of renal fibrosis has important implications for therapeutic intervention of kidney disease. Previous studies demonstrated that paricalcitol, an activated vitamin D analog, was able to attenuate interstitial fibrosis, EMT, and renal inflammation in the UUO model. 18,23 In those studies, paricalcitol was shown to suppress TGF- expression as well as block directly TGF- induced EMT and ECM proteins in tubular cell cultures and to inhibit RANTES expression via antagonizing NF- B activity. In this study, we assessed the effect of VDR deficiency on the development of renal fibrosis using the UUO model. Our data suggest that VDR attenuates renal fibrosis by blocking the RAS. Together, these studies suggest that vitamin D VDR signaling suppresses renal fibrosis through multiple mechanisms. In this study, we demonstrated that VDR( / ) mice developed severe tubular atrophy and tubulointerstitial fibrosis with robust EMT and ECM deposition after 7 days of UUO; in contrast, VDR( / ) mice showed only moderate, histologically 970 Journal of the American Society of Nephrology J Am Soc Nephrol 21: , 2010

6 BASIC RESEARCH Figure 7. Losartan blocks renal fibrosis in VDR( / ) and VDR( / ) mice. Sham-operated or obstructed VDR( / ) and VDR( / ) mice are treated with losartan at 30 mg/kg per d for 7 days. (A and B) Kidney sections from the losartan-treated VDR( / ) and VDR( / ) mice are stained with PAS (A) or Masson s trichrome (B). (C) RT-PCR quantification of FN and collagen I expression in these kidneys. (D) RT-PCR quantification of MCP-1, TGF-, and CTGF expression in these kidneys. Shown also are the PCR ethidium bromide staining gels of these cytokines. *P 0.05, ***P versus sham of the same genotype (n 3). identifiable renal injury and minimal fibrosis. At the molecular level, the expression of ECM proteins (FN and collagens), fibrogenic and inflammatory factors (TGF-, CTGF, and MCP-1), and EMT markers (E-cadherin, -SMA, and Snail) was increased more in VDR( / ) mice than in VDR( / ) mice in the obstructed kidney. EMT is a major pathway that leads to fibrosis in the kidney. The induction of -SMA, the marker of myofibroblasts, and the reduction of E-cadherin, the marker of tubular epithelial cells, were much more dramatic in VDR( / ) mice compared with VDR( / ) mice. Most striking is the observation that E-cadherin was almost undetectable in the VDR( / ) kidney after 7 days of UUO, indicating an extensive loss of tubular epithelial cells, which is consistent with the massive tubular atrophy and fibrosis seen in the obstructed VDR( / ) kidney. Also consistent is Snail, a transcription factor that is involved in EMT and negatively regulates E-cadherin. 21 Snail was induced more in VDR( / ) mice than in VDR( / ) mice after UUO. Together, these data suggest that VDR( / ) mice developed more severe renal injury mostly because of more robust EMT. The main mechanism underlying the severe renal fibrosis in VDR( / ) mice appears to be the action of the local RAS in the kidney. VDR mediates the action of 1,25(OH) 2 D 3 to suppress renin and AGT, 11,22 and VDR inactivation leads to activation of the RAS and overproduction of AngII. 12 AngII is a potent inducer of EMT and renal fibrosis 4 and stimulates TGF- production and renal inflammation in UUO. 24,25 We confirmed with in vitro tubular cell cultures that AngII has potent fibrogenic activity by directly inducing EMT in VDR( / ) and VDR( / ) cells. Thus, the high baseline intrarenal AngII level likely predisposes the VDR( / ) kidney to fibrosis. Indeed, we showed that treatment with losartan markedly reduced interstitial fibrosis in both VDR( / ) and VDR( / ) mice. The fibrosis scores as well as the magnitude of induction for ECM proteins (FN and collagen I) and profibrotic factors (TGF- and CTGF) were dramatically reduced in VDR( / ) and VDR( / ) mice after losartan treatment (compare the data in Figure 7 with Figures 1, 2, and 3). Interestingly, whereas losartan completely blocked fibrosis in UUO, it did not seem to block completely the EMT response (see Figure 8). This disconnect between EMT and fibrosis suggests that AngII might act downstream of EMT and upstream of fibrosis in this model. Obviously, more studies are required to clarify this issue. Importantly, we demonstrated that blockade of AngII activity with losartan not only reduced the development of renal fibrosis but also eliminated the difference in the severity of the renal phenotypes between VDR( / ) and VDR( / ) mice in UUO. The difference in the induction of ECM proteins, profibrotic cytokines, and EMT markers between VDR( / ) and VDR( / ) J Am Soc Nephrol 21: , 2010 VDR and Obstructive Nephropathy 971

7 BASIC RESEARCH to UUO operation. Briefly, UUO was performed under ketamine/ xylazine anesthesia in which a midline incision was made and the left ureter was exposed and tied off at two points. Sham operation was performed similarly but without ureter ligation. All mice were killed on day 7 after the surgical operation by cardiac exsanguination. Kidneys were collected for analyses. For losartan treatment, mice were fed water containing 0.1 mg/ml (30 mg/kg per d) losartan starting 3 days before UUO surgery until day 7 after surgery. The animal study protocols were approved by the Institutional Animal Care and Use Committee at the University of Chicago. Figure 8. Losartan treatment eliminates the difference in EMT between VDR( / ) and VDR( / ) mice. (A) Western blot analyses of E-cadherin, -SMA, and Snail in the sham-operated and obstructed kidneys of losartan-treated VDR( / ) and VDR( / ) mice. (B) Densitometric quantification of these proteins. *P 0.05, **P 0.01, ***P versus sham of the same genotype. mice also disappeared after losartan treatment, suggesting that these genes are directly or indirectly affected by the high AngII level in VDR( / ) mice. Therefore, VDR seems to attenuate renal fibrosis in large part by suppressing the RAS. VDR is a pleiotropic ligand-activated transcription factor. In addition to the RAS, VDR may directly or indirectly regulate other targets involved in renal fibrosis. In VDR or vitamin D deficiency, these targets might lead to a network of cascades to accelerate renal fibrosis. For example, MCP-1 is known to be directly downregulated by 1,25(OH) 2 D 3 in kidney cells. 19 Recently, the Wnt/ catenin pathway was shown to play a key role in renal fibrosis. 26 We found that -catenin was induced in the obstructed kidney but the induction was not different between VDR( / ) and VDR( / ) mice (data not shown). This is not unexpected, because VDR inhibits -catenin signaling by physically interacting with -catenin, not by transcriptional regulation. 27 In the absence of VDR, -catenin may be more activated in the kidney. VDR may also directly suppress Snail 18 and stimulate E-cadherin expression 27 in cell cultures as a way to prevent EMT. Together, the data obtained in this study further enforce the notion established in recent years that VDR plays a crucial renoprotective role in pathophysiologic conditions. CONCISE METHODS Animal Studies Three-month-old C57BL/6J wild-type [VDR( / )] and VDR-null [VDR( / )] mice were used in the study. These mice were subjected Histology and Immunohistochemistry Freshly dissected kidneys were fixed overnight with 4% formaldehyde in PBS (ph 7.2), processed, and embedded in paraffin. Kidney sections were cut at 3 mm, and the sections were stained with PAS or Masson s trichrome by standard procedure. The kidneys were scored by a renal pathologist (A.C.) for interstitial fibrosis and tubular atrophy on a scale from0to4. 28 For immunostaining, paraffin sections were first boiled in 10 mm Na citrate solution (ph 6.0) for 10 minutes to retrieve the antigens before antibody staining. The sections were stained with primary antibodies (against -SMA [Chemicon], FN [Sigma] or AngI/II [Santa Cruz Biotechnology]), followed by incubation with horseradish peroxidase conjugated secondary antibodies. Antigens were visualized with a peroxidase substrate diaminobenzidine kit (Vector Laboratories, Burlingame, CA) under a microscope. The intensity of AngI/II immunostaining was evaluated using a semiquantitative scale of 0 to 3 (none, mild, moderate, and severe) by a single observer (A.C.) without previous knowledge of the treatment groups. Staining with secondary antibodies only served as negative controls, and no stained signals were detected in the negative control slides. Primary Tubular Cell Cultures Primary tubular cells were isolated from VDR( / ) and VDR( / ) mice according to our previously described methods. 29 The tubular cells were cultured to confluence when they were treated with TGF- (4 ng/ml) or AngII (100 nm) for 2 days. Then cell lysates were prepared for Western blot analyses. Western Blot Whole kidneys or tubular cells were homogenized or lysed in Laemmli buffer (Boston Bioproducts, Worcester, MA), followed by 5 minutes of boiling and centrifugation to obtain the lysates. Protein concentrations were determined using a BioRad Protein Assay kit (BioRad, Hercules, CA). Proteins were separated by SDS-PAGE and transferred onto Immobilon membranes. Western blotting was carried out as described previously, 30 using antibodies against -SMA, E-cadherin (Santa Cruz Biotechnology), or Snail (Santa Cruz Biotechnology). RT-PCR and Northern Blot Total cellular RNAs were isolated using TRIzol reagents (Invitrogen, Carlsbad, CA). First-strand cdnas were synthesized from 2 g of total RNAs in a 20- l reaction using MML-V reverse transcriptase (Invitrogen) and hexanucleotide random primers. The first-strand cdnas served as the template for the PCR performed using a BioRad DNA Engine (BioRad). Real time RT-PCR was performed in Applied 972 Journal of the American Society of Nephrology J Am Soc Nephrol 21: , 2010

8 BASIC RESEARCH Biosystems 7900 Real Time PCR System using a SYBR green PCR reagent kit (Applied Biosystems, Foster City, CA) as described previously. 13 Glyceraldehyde-3-phosphate dehydrogenase or 2 microglobulin served as the internal control. The PCR primers used in this study were as described previously. 13,17 Northern blot analysis of renin expression was performed as described. 12 Statistical Analysis Data were presented as means SEM. Statistical comparisons were made using t test, with P 0.05 being considered statistically significant. ACKNOWLEDGMENTS This work was supported in part by National Institutes of Health grant HL DISCLOSURES None. REFERENCES 1. Iwano M, Neilson EG: Mechanisms of tubulointerstitial fibrosis. Curr Opin Nephrol Hypertens 13: , Kalluri R, Neilson EG: Epithelial-mesenchymal transition and its implications for fibrosis. J Clin Invest 112: , Chevalier RL: Obstructive nephropathy: Towards biomarker discovery and gene therapy. Nat Clin Pract Nephrol 2: , Wolf G: Renal injury due to renin-angiotensin-aldosterone system activation of the transforming growth factor-beta pathway. Kidney Int 70: , Wolf G, Mueller E, Stahl RA, Ziyadeh FN: Angiotensin II-induced hypertrophy of cultured murine proximal tubular cells is mediated by endogenous transforming growth factor-beta. J Clin Invest 92: , Border WA, Noble NA: Cytokines in kidney disease: The role of transforming growth factor-beta. Am J Kidney Dis 22: , Burns WC, Twigg SM, Forbes JM, Pete J, Tikellis C, Thallas-Bonke V, Thomas MC, Cooper ME, Kantharidis P: Connective tissue growth factor plays an important role in advanced glycation end productinduced tubular epithelial-to-mesenchymal transition: Implications for diabetic renal disease. J Am Soc Nephrol 17: , Gupta S, Clarkson MR, Duggan J, Brady HR: Connective tissue growth factor: Potential role in glomerulosclerosis and tubulointerstitial fibrosis. Kidney Int 58: , Haussler MR, Whitfield GK, Haussler CA, Hsieh JC, Thompson PD, Selznick SH, Dominguez CE, Jurutka PW: The nuclear vitamin D receptor: Biological and molecular regulatory properties revealed. J Bone Miner Res 13: , Li YC: Renoprotective effects of vitamin D analogs. Kidney Int May 27, 2009 [epub ahead of print] 11. Yuan W, Pan W, Kong J, Zheng W, Szeto FL, Wong KE, Cohen R, Klopot A, Zhang Z, Li YC: 1,25-Dihydroxyvitamin D3 suppresses renin gene transcription by blocking the activity of the cyclic AMP response element in the renin gene promoter. J Biol Chem 282: , Li YC, Kong J, Wei M, Chen ZF, Liu SQ, Cao LP: 1,25-Dihydroxyvitamin D(3) is a negative endocrine regulator of the renin-angiotensin system. J Clin Invest 110: , Zhang Z, Sun L, Wang Y, Ning G, Minto AW, Kong J, Quigg RJ, Li YC: Renoprotective role of the vitamin D receptor in diabetic nephropathy. Kidney Int 73: , Freundlich M, Quiroz Y, Zhang Z, Zhang Y, Bravo Y, Weisinger JR, Li YC, Rodriguez-Iturbe B: Suppression of renin-angiotensin gene expression in the kidney by paricalcitol. Kidney Int 74: , Makibayashi K, Tatematsu M, Hirata M, Fukushima N, Kusano K, Ohashi S, Abe H, Kuze K, Fukatsu A, Kita T, Doi T: A vitamin D analog ameliorates glomerular injury on rat glomerulonephritis. Am J Pathol 158: , Mizobuchi M, Morrissey J, Finch JL, Martin DR, Liapis H, Akizawa T, Slatopolsky E: Combination therapy with an angiotensin-converting enzyme inhibitor and a vitamin D analog suppresses the progression of renal insufficiency in uremic rats. J Am Soc Nephrol 18: , Zhang Z, Zhang Y, Ning G, Deb DK, Kong J, Li YC: Combination therapy with AT1 blocker and vitamin D analog markedly ameliorates diabetic nephropathy: Blockade of compensatory renin increase. Proc Natl Acad Sci U S A 105: , Tan X, Li Y, Liu Y: Paricalcitol attenuates renal interstitial fibrosis in obstructive nephropathy. J Am Soc Nephrol 17: , Zhang Z, Yuan W, Sun L, Szeto FL, Wong KE, Li X, Kong J, Li YC: 1,25-Dihydroxyvitamin D(3) targeting of NF-kappaB suppresses high glucose-induced MCP-1 expression in mesangial cells. Kidney Int 72: , Liu Y: Epithelial to mesenchymal transition in renal fibrogenesis: Pathologic significance, molecular mechanism, and therapeutic intervention. J Am Soc Nephrol 15: 1 12, Cano A, Perez-Moreno MA, Rodrigo I, Locascio A, Blanco MJ, del Barrio MG, Portillo F, Nieto MA: The transcription factor snail controls epithelial-mesenchymal transitions by repressing E-cadherin expression. Nat Cell Biol 2: 76 83, Deb DK, Chen Y, Zhang Z, Zhang Y, Szeto FL, Wong KE, Kong J, Li YC: 1,25-Dihydroxyvitamin D3 suppresses high glucose-induced angiotensinogen expression in kidney cells by blocking the NF-kappaB pathway. Am J Physiol Renal Physiol 296: F1212 F1218, Tan X, Wen X, Liu Y: Paricalcitol inhibits renal inflammation by promoting vitamin D receptor-mediated sequestration of NF-kappaB signaling. J Am Soc Nephrol 19: , Esteban V, Lorenzo O, Ruperez M, Suzuki Y, Mezzano S, Blanco J, Kretzler M, Sugaya T, Egido J, Ruiz-Ortega M: Angiotensin II, via AT1 and AT2 receptors and NF-kappaB pathway, regulates the inflammatory response in unilateral ureteral obstruction. J Am Soc Nephrol 15: , Pimentel JL Jr, Sundell CL, Wang S, Kopp JB, Montero A, Martinez- Maldonado M: Role of angiotensin II in the expression and regulation of transforming growth factor-beta in obstructive nephropathy. Kidney Int 48: , He W, Dai C, Li Y, Zeng G, Monga SP, Liu Y: Wnt/beta-catenin signaling promotes renal interstitial fibrosis. J Am Soc Nephrol 20: , Palmer HG, Gonzalez-Sancho JM, Espada J, Berciano MT, Puig I, Baulida J, Quintanilla M, Cano A, de Herreros AG, Lafarga M, Munoz A: Vitamin D(3) promotes the differentiation of colon carcinoma cells by the induction of E-cadherin and the inhibition of beta-catenin signaling. J Cell Biol 154: , Bao L, Wang Y, Chang A, Minto AW, Zhou J, Kang H, Haas M, Quigg RJ: Unrestricted C3 activation occurs in Crry-deficient kidneys and rapidly leads to chronic renal failure. J Am Soc Nephrol 18: , Cao LP, Bolt MJ, Wei M, Sitrin MD, Li YC: Regulation of calbindin-d9k expression by 1,25-dihydroxyvitamin d(3) and parathyroid hormone in mouse primary renal tubular cells. Arch Biochem Biophys 400: , Li YC, Bolt MJ, Cao L-P, Sitrin MD: Effects of vitamin D receptor inactivation on the expression of calbindins and calcium metabolism. Am J Physiol Endocrinol Metab 281: E558 E564, 2001 J Am Soc Nephrol 21: , 2010 VDR and Obstructive Nephropathy 973

A novel role for vitamin D: modulation of expression and function of the local renin angiotensin system in mouse pancreatic islets

A novel role for vitamin D: modulation of expression and function of the local renin angiotensin system in mouse pancreatic islets Diabetologia () 5:77 DOI.7/s5--- SHORT COMMUNICATION A novel role for vitamin D: modulation of expression and function of the local renin angiotensin system in mouse pancreatic islets Q. Cheng & Y. C.

More information

renoprotection therapy goals 208, 209

renoprotection therapy goals 208, 209 Subject Index Aldosterone, plasminogen activator inhibitor-1 induction 163, 164, 168 Aminopeptidases angiotensin II processing 64 66, 214 diabetic expression 214, 215 Angiotensin I intrarenal compartmentalization

More information

Introduction. Acute sodium overload produces renal tubulointerstitial inflammation in normal rats

Introduction. Acute sodium overload produces renal tubulointerstitial inflammation in normal rats Acute sodium overload produces renal tubulointerstitial inflammation in normal rats MI Roson, et al. Kidney International (2006) Introduction Present by Kanya Bunnan and Wiraporn paebua Tubular sodium

More information

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Hong Lu 1, Bicheng Chen 2, Weilong Hong 2, Yong Liang 2 and Yongheng Bai 2 1

More information

Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury

Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury BASIC RESEARCH www.jasn.org Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury Weichun He, Young Sun Kang, Chunsun Dai, and Youhua Liu Department of Pathology,

More information

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Lili Zhou,* Yingjian Li, Dong Zhou, Roderick J. Tan, and Youhua Liu* *Division of Nephrology, Nanfang Hospital, Southern

More information

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice J Am Soc Nephrol 13: 2464 2477, 2002 Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice JUNWEI YANG, CHUNSUN DAI, and YOUHUA

More information

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral Supplementary Information Downregulation of angiotensin type 1 receptor and nuclear factor-κb by sirtuin 1 contributes to renoprotection in unilateral ureteral obstruction Shao-Yu Yang 1,2, Shuei-Liong

More information

The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury

The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury Scott R. Manson, Robert A. Niederhoff, Keith A. Hruska and Paul F. Austin* From the Division of Pediatric Urology,

More information

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Summary of Doctoral Thesis Hidenori Yasuda Graduate School of Veterinary

More information

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population.

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population. CHAPTER I INTRODUCTION I.1 Background Nowadays chronic kidney disease (CKD) becomes one of the most common diseases found in the population. Based on community survey that is held by PERNEFRI (Perhimpunan

More information

Niki Prakoura. Calreticulin upregulation in renal fibrosis

Niki Prakoura. Calreticulin upregulation in renal fibrosis Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,

More information

Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi

Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi Role of Vitamin D receptor (VDR) in HIV induced tubular injury Mohammad Husain Department of Biotechnology, Jamia Millia Islamia New Delhi 07/10/2015 INTRODUCTION Vitamin D is technically not a Vitamin;

More information

Renal angiotensin II up-regulation and myofibroblast activation in human membranous nephropathy

Renal angiotensin II up-regulation and myofibroblast activation in human membranous nephropathy Kidney International, Vol. 64, Supplement 86 (2003), pp. Renal angiotensin II up-regulation and myofibroblast activation in human membranous nephropathy SERGIO A. MEZZANO, CLAUDIO A. AROS, ALEJANDRA DROGUETT,

More information

Valsartan Inhibited the Accumulation of Dendritic Cells in Rat Fibrotic Renal Tissue

Valsartan Inhibited the Accumulation of Dendritic Cells in Rat Fibrotic Renal Tissue Cellular & Molecular Immunology 213 Article Valsartan Inhibited the Accumulation of Dendritic Cells in Rat Fibrotic Renal Tissue Kaiyin Wu 1, Tong Zhou 1, 3, Guizhi Sun 1, Weiming Wang 1, Yumei Zhang 1,

More information

INTRODUCTION. Induction of Monocyte Chemoattractant Protein-1 (MCP-1) Expression by Angiotensin II (AngII) in the Pancreatic Islets and Beta Cells

INTRODUCTION. Induction of Monocyte Chemoattractant Protein-1 (MCP-1) Expression by Angiotensin II (AngII) in the Pancreatic Islets and Beta Cells Induction of Monocyte Chemoattractant Protein-1 (MCP-1) Expression by Angiotensin II (AngII) in the Pancreatic Islets and Beta Cells Galina Chipitsyna, Qiaoke Gong, Chance F. Gray et al. Endocrinology,

More information

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention REVIEW J Am Soc Nephrol 15: 1 12, 2004 Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention YOUHUA LIU Division of Cellular

More information

Obstructive nephropathy: Insights from genetically engineered animals

Obstructive nephropathy: Insights from genetically engineered animals Kidney International, Vol. 68 (2005), pp. 925 937 Obstructive nephropathy: Insights from genetically engineered animals JEAN-LOUP BASCANDS and JOOST P. SCHANSTRA Inserm U388, Institut Louis Bugnard, Touluse

More information

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry: General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems

More information

Doctor of Philosophy

Doctor of Philosophy Regulation of Gene Expression of the 25-Hydroxyvitamin D la-hydroxylase (CYP27BI) Promoter: Study of A Transgenic Mouse Model Ivanka Hendrix School of Molecular and Biomedical Science The University of

More information

References. Plasma renin activity (PRA) PRA was measured by a radioimmunoassay kit (Wallac, Tokyo, Japan).

References. Plasma renin activity (PRA) PRA was measured by a radioimmunoassay kit (Wallac, Tokyo, Japan). Detailed Methods Experiment I enos / mice were purchased from Jackson Laboratory (Bar Harbor, USA). C57BL/6J mice on the same genetic background were purchased from KBT Oriental (Hamamatsu, Japan). Eleven-week-old

More information

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Na Liu,* Jian-Kan Guo, Maoyin Pang, Evelyn Tolbert, Murugavel Ponnusamy, Rujun Gong, George Bayliss, Lance D. Dworkin, Haidong Yan,* and

More information

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal BRIEF COMMUNICATION www.jasn.org Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal Transition Elisabeth M. Zeisberg,* Scott E. Potenta,* Hikaru Sugimoto,* Michael Zeisberg,* and Raghu

More information

MOLECULAR MEDICINE REPORTS 10: 39-44, 2014

MOLECULAR MEDICINE REPORTS 10: 39-44, 2014 MOLECULAR MEDICINE REPORTS 10: 39-44, 2014 Epithelial mesenchymal transition and apoptosis of renal tubular epithelial cells are associated with disease progression in patients with IgA nephropathy JUNXIA

More information

Relationship between renal injury and the antagonistic roles of angiotensin-converting enzyme (ACE) and ACE2

Relationship between renal injury and the antagonistic roles of angiotensin-converting enzyme (ACE) and ACE2 Relationship between renal injury and the antagonistic roles of angiotensin-converting enzyme (ACE) and ACE2 C. Ma, H. Xin, X.-Y. Jiang, Y.-X. Wang and Y.-S. Zhang Key Laboratory of Animal Physiology and

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null

More information

Uncovering the mechanisms of wound healing and fibrosis

Uncovering the mechanisms of wound healing and fibrosis Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:

More information

Supplementary Figure 1:

Supplementary Figure 1: Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas

More information

Supporting Information

Supporting Information Supporting Information Desnues et al. 10.1073/pnas.1314121111 SI Materials and Methods Mice. Toll-like receptor (TLR)8 / and TLR9 / mice were generated as described previously (1, 2). TLR9 / mice were

More information

Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury

Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to

More information

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress

Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress 3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative

More information

Cardiovascular Protection and the RAS

Cardiovascular Protection and the RAS Cardiovascular Protection and the RAS Katalin Kauser, MD, PhD, DSc Senior Associate Director, Boehringer Ingelheim Pharmaceutical Inc. Micardis Product Pipeline Scientific Support Ridgefield, CT, USA Cardiovascular

More information

Supporting Information

Supporting Information Supporting Information Stegbauer et al. 10.1073/pnas.0903602106 SI Methods Analysis of Plasma Renin Activity (PRA) and ACE Activity. PRA and serum ACE activity levels were determined by RIA (RENCTK, DiaSorin;

More information

Renin-angiotensin system activation and interstitial inflammation in human diabetic nephropathy

Renin-angiotensin system activation and interstitial inflammation in human diabetic nephropathy Kidney International, Vol. 64, Supplement 86 (2003), pp. S64 S70 Renin-angiotensin system activation and interstitial inflammation in human diabetic nephropathy SERGIO MEZZANO, ALEJANDRA DROGUETT, M. EUGENIA

More information

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1

European Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1 PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:

More information

HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy

HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy Scott R. Manson, Joseph B. Song, Keith A. Hruska and Paul F. Austin* From the Division

More information

Novel therapeutic approach for kidney fibrosis

Novel therapeutic approach for kidney fibrosis University of Sydney Novel therapeutic approach for kidney fibrosis DAVID HARRIS 30/09/17 Westmead Hospital Cadnapaphornchai CJASN 2014;9:889 Liraglutide: Renal Outcomes Mann JFE et al. N Engl J Med 2017;377:839-848

More information

Supplementary Materials:

Supplementary Materials: Supplementary Materials: Supplemental Figure 1: Profibrotic markers in wt/wt or ex/ex mouse kidneys 42 days post IRI. The levels of fibronectin and αsma were examined by immunostaining in ADAM17 wt/wt

More information

Expression of P311, a transforming growth factor beta latency-associated protein-binding protein, in human kidneys with IgA nephropathy

Expression of P311, a transforming growth factor beta latency-associated protein-binding protein, in human kidneys with IgA nephropathy Int Urol Nephrol (2010) 42:811 819 DOI 10.1007/s11255-009-9681-3 NEPHROLOGY - ORIGINAL PAPER Expression of P311, a transforming growth factor beta latency-associated protein-binding protein, in human kidneys

More information

Ανάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο

Ανάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο Ανάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο ΔΗΜΗΤΡΙΟΣ Σ. ΓΟΥΜΕΝΟΣ Νεφρολογικό και Μεταμοσχευτικό Κέντρο Πανεπιστημιακό Νοσοκομείο Πατρών Causes of chronic

More information

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Xiaoxu Zhou,* Xiujuan Zang,* Murugavel Ponnusamy,* Monica V. Masucci,*

More information

Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy

Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy 638 Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy PING HE, DETIN LI and EIRU ZHNG Department of Nephrology, Shengjing Hospital of

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the

As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the 3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate

More information

BioScience Trends. 2017; 11(1):

BioScience Trends. 2017; 11(1): Original Article BioScience Trends. 2017; 11(1):77-84. 77 DOI: 10.5582/bst.2016.01224 Knocking down TCF8 inhibits high glucose- and angiotensin IIinduced epithelial to mesenchymal transition in podocytes

More information

Supplemental Table 1. Primer sequences for transcript analysis

Supplemental Table 1. Primer sequences for transcript analysis Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC

More information

Honokiol ameliorates renal fibrosis by inhibiting extracellular matrix and pro-inflammatory factors in vivo and in vitro

Honokiol ameliorates renal fibrosis by inhibiting extracellular matrix and pro-inflammatory factors in vivo and in vitro 586..597 British Journal of Pharmacology DOI:10.1111/j.1476-5381.2011.01242.x www.brjpharmacol.org RESEARCH PAPERbph_1242 Honokiol ameliorates renal fibrosis by inhibiting extracellular matrix and pro-inflammatory

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

Reason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma

Reason for Dissection. Pleomorphic adenoma. Tongue base adenocarcinoma Supplementary Table S1 Human Patients Patient Sample No. Gender Age Additional Medication Treatment 1 Reason for Dissection Total Irradiation Dose Estimated Irradiation Dose to SG Gland Time of Resection

More information

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment

Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:

More information

Feinberg School of Medicine Chicago IL Division of Nephrology and Hypertension

Feinberg School of Medicine Chicago IL Division of Nephrology and Hypertension Feinberg School of Medicine Chicago IL Division of Nephrology and Hypertension Daniel Batlle MD Earle, del Greco Levin Professor of Medicine Division of Nephrology and Hypertension Northwestern University

More information

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Matthew R. Weir, MD Professor and Director Division of Nephrology University of Maryland School of Medicine Overview Introduction Mechanisms

More information

RENAL HISTOPATHOLOGY

RENAL HISTOPATHOLOGY RENAL HISTOPATHOLOGY Peter McCue, M.D. Department of Pathology, Anatomy & Cell Biology Sidney Kimmel Medical College There are no conflicts of interest. 1 Goals and Objectives! Goals Provide introduction

More information

Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients

Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients Analysis of regulatory T cell subsets in the peripheral blood of immunoglobulin A nephropathy (IgAN) patients S. Yang, B. Chen, J. Shi, F. Chen, J. Zhang and Z. Sun Department of Nephrology, Huaihe Hospital

More information

Klotho: renal and extra-renal effects

Klotho: renal and extra-renal effects Klotho: renal and extra-renal effects Juan F. Navarro-González, MD, PhD, FASN Nephrology Service and Research Division University Hospital Nuestra Señora de Candalaria Santa Cruz de Tenerife. Spain Klotho:

More information

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1.

Prof. Sandrine Florquin Department of Pathology Academic Medical Center University of Amsterdam Amsterdam, The Netherlands. Slide 1. Interleukin 17 in renal biopsies as risk factor for progression Sandrine Florquin, Amsterdam, The Netherlands Chairs: Mohamed R. Daha, Leiden, The Netherlands Pierre Ronco, Paris, France Prof. Sandrine

More information

Proceedings of the 34th World Small Animal Veterinary Congress WSAVA 2009

Proceedings of the 34th World Small Animal Veterinary Congress WSAVA 2009 www.ivis.org Proceedings of the 34th World Small Animal Veterinary Congress WSAVA 2009 São Paulo, Brazil - 2009 Next WSAVA Congress : Reprinted in IVIS with the permission of the Congress Organizers PROTEINURIA

More information

Cell-cell communication and diabetes. Professor Paul Squires University of Lincoln

Cell-cell communication and diabetes. Professor Paul Squires University of Lincoln Cell-cell communication and diabetes Professor Paul Squires University of Lincoln Dr Claire Hills University of Lincoln Dr Claire Hills University of Lincoln Joseph Banks Laboratories Lincoln Connexin

More information

Effect of Yishen Huayu Fang on kidney tissue E-cadherin expression in unilateral ureter ligation in rats

Effect of Yishen Huayu Fang on kidney tissue E-cadherin expression in unilateral ureter ligation in rats Online Submissions: http://www.journaltcm.com J Tradit Chin Med 2012 June 15; 32(2): 273-277 info@journaltcm.com ISSN 0255-2922 2012 JTCM. All rights reserved. Basic Investigation Effect of Yishen Huayu

More information

Sonic Hedgehog Signaling Mediates Epithelial Mesenchymal Communication and Promotes Renal Fibrosis

Sonic Hedgehog Signaling Mediates Epithelial Mesenchymal Communication and Promotes Renal Fibrosis Sonic Hedgehog Signaling Mediates Epithelial Mesenchymal Communication and Promotes Renal Fibrosis Hong Ding,* Dong Zhou,* Sha Hao,* Lili Zhou,* Weichun He,* Jing Nie, Fan Fan Hou, and Youhua Liu* *Department

More information

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells

The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells 1 SUPPLEMENTARY INFORMATION The toll-like receptor 4 ligands Mrp8 and Mrp14 play a critical role in the development of autoreactive CD8 + T cells Karin Loser 1,2,6, Thomas Vogl 2,3, Maik Voskort 1, Aloys

More information

A clinical syndrome, composed mainly of:

A clinical syndrome, composed mainly of: Nephritic syndrome We will discuss: 1)Nephritic syndrome: -Acute postinfectious (poststreptococcal) GN -IgA nephropathy -Hereditary nephritis 2)Rapidly progressive GN (RPGN) A clinical syndrome, composed

More information

Matrix Metalloproteinase-7 Is a Urinary Biomarker and Pathogenic Mediator of Kidney Fibrosis

Matrix Metalloproteinase-7 Is a Urinary Biomarker and Pathogenic Mediator of Kidney Fibrosis BASIC RESEARCH Matrix Metalloproteinase-7 Is a Urinary Biomarker and Pathogenic Mediator of Kidney Fibrosis Dong Zhou,* Yuan Tian, Ling Sun, Lili Zhou, Liangxiang Xiao, Roderick J. Tan, Jianwei Tian, Haiyan

More information

Down-regulation of mir-23a inhibits high glucose-induced EMT and renal fibrogenesis by up-regulation of SnoN

Down-regulation of mir-23a inhibits high glucose-induced EMT and renal fibrogenesis by up-regulation of SnoN Human Cell (2018) 31:22 32 https://doi.org/10.1007/s13577-017-0180-z RESEARCH ARTICLE Down-regulation of mir-23a inhibits high glucose-induced EMT and renal fibrogenesis by up-regulation of SnoN Haiping

More information

Hepatocyte growth factor (HGF) has recently emerged

Hepatocyte growth factor (HGF) has recently emerged A Novel Mechanism by which Hepatocyte Growth Factor Blocks Tubular Epithelial to Mesenchymal Transition Junwei Yang,* Chunsun Dai,* and Youhua Liu* *Division of Cellular and Molecular Pathology, Department

More information

Supplementary Figure 1 (Related with Figure 4). Molecular consequences of Eed deletion. (a) ChIP analysis identifies 3925 genes that are associated

Supplementary Figure 1 (Related with Figure 4). Molecular consequences of Eed deletion. (a) ChIP analysis identifies 3925 genes that are associated Supplementary Figure 1 (Related with Figure 4). Molecular consequences of Eed deletion. (a) ChIP analysis identifies 3925 genes that are associated with the H3K27me3 mark in chondrocytes (see Table S1,

More information

Angiotensin II (Ang II), the main peptide of the renin-angiotensin

Angiotensin II (Ang II), the main peptide of the renin-angiotensin Connective Tissue Growth Factor Is a Mediator of Angiotensin II Induced Fibrosis Mónica Rupérez, BSc; Óscar Lorenzo, PhD; Luis Miguel Blanco-Colio, PhD; Vanesa Esteban, BSc; Jesús Egido, MD; Marta Ruiz-Ortega,

More information

Renal injury due to renin angiotensin aldosterone system activation of the transforming growth factor-b pathway

Renal injury due to renin angiotensin aldosterone system activation of the transforming growth factor-b pathway review http://www.kidney-international.org & 2006 International Society of Nephrology Renal injury due to renin angiotensin aldosterone system activation of the transforming growth factor-b pathway G Wolf

More information

An epithelial-to-mesenchymal transition-inducing potential of. granulocyte macrophage colony-stimulating factor in colon. cancer

An epithelial-to-mesenchymal transition-inducing potential of. granulocyte macrophage colony-stimulating factor in colon. cancer An epithelial-to-mesenchymal transition-inducing potential of granulocyte macrophage colony-stimulating factor in colon cancer Yaqiong Chen, Zhi Zhao, Yu Chen, Zhonglin Lv, Xin Ding, Renxi Wang, He Xiao,

More information

Case # 2 3/27/2017. Disclosure of Relevant Financial Relationships. Clinical history. Clinical history. Laboratory findings

Case # 2 3/27/2017. Disclosure of Relevant Financial Relationships. Clinical history. Clinical history. Laboratory findings Case # 2 Christopher Larsen, MD Arkana Laboratories Disclosure of Relevant Financial Relationships USCAP requires that all planners (Education Committee) in a position to influence or control the content

More information

AP VP DLP H&E. p-akt DLP

AP VP DLP H&E. p-akt DLP A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy

More information

cells ISSN

cells ISSN Cells 2015, 4, 631-652; doi:10.3390/cells4040631 Review OPEN ACCESS cells ISSN 2073-4409 www.mdpi.com/journal/cells Epithelial-to-Mesenchymal Transition in Diabetic Nephropathy: Fact or Fiction? Ivonne

More information

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)

Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained

More information

Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition.

Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. Manuscript EMBO-2012-82682 Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. David Balli, Vladimir Ustiyan, Yufang Zhang, I-Ching Wang, Alex J. Masino,

More information

SLOWING PROGRESSION OF KIDNEY DISEASE. Mark Rosenberg MD University of Minnesota

SLOWING PROGRESSION OF KIDNEY DISEASE. Mark Rosenberg MD University of Minnesota SLOWING PROGRESSION OF KIDNEY DISEASE Mark Rosenberg MD University of Minnesota OUTLINE 1. Epidemiology of progression 2. Therapy to slow progression a. Blood Pressure control b. Renin-angiotensin-aldosterone

More information

Ordering Physician. Collected REVISED REPORT. Performed. IgG IF, Renal MCR. Lambda IF, Renal MCR. C1q IF, Renal. MCR Albumin IF, Renal MCR

Ordering Physician. Collected REVISED REPORT. Performed. IgG IF, Renal MCR. Lambda IF, Renal MCR. C1q IF, Renal. MCR Albumin IF, Renal MCR RenalPath Level IV Wet Ts IgA I Renal IgM I Renal Kappa I Renal Renal Bx Electron Microscopy IgG I Renal Lambda I Renal C1q I Renal C3 I Renal Albumin I Renal ibrinogen I Renal Mayo Clinic Dept. of Lab

More information

Department of Pharmaceutical Sciences, School of Pharmacy, Northeastern University, Boston, MA 02115, USA 2

Department of Pharmaceutical Sciences, School of Pharmacy, Northeastern University, Boston, MA 02115, USA 2 Pancreatic Cancer Cell Exosome-Mediated Macrophage Reprogramming and the Role of MicroRNAs 155 and 125b2 Transfection using Nanoparticle Delivery Systems Mei-Ju Su 1, Hibah Aldawsari 2, and Mansoor Amiji

More information

Vitamin D: Is it a superhero??

Vitamin D: Is it a superhero?? Vitamin D: Is it a superhero?? Dr. Ashraf Abdel Basset Bakr Prof. of Pediatrics 1 2 History of vitamin D discovery Sources of vitamin D and its metabolism 13 Actions of vitamin D 4 Vitamin D deficiency

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin

More information

Abstract: I. A ims Aim 1:

Abstract: I. A ims Aim 1: Abstract: Previous work from our laboratory demonstrated that obese mice have alterations in antiviral cytokine gene expression when infected with the influenza virus. Since these cytokines play a major

More information

B-cell. Astrocyte SCI SCI. T-cell

B-cell. Astrocyte SCI SCI. T-cell RF #2015 P-01 PI: Azizul Haque, PhD Grant Title: Targeting Enolase in Spinal Cord Injury 12-month Technical Progress Report Progress Report (First Six Months): Enolase is one of the most abundantly expressed

More information

Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction

Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction Author's response to reviews Title: Intermedin attenuates renal fibrosis by induction of heme oxygenase-1 in rats with unilateral ureteral obstruction Authors: Xi Qiao (qiaoxi7347@126.com) Lihua Wang (lihuawang236@126.com)

More information

Wnt/ -Catenin Signaling Promotes Renal Interstitial Fibrosis

Wnt/ -Catenin Signaling Promotes Renal Interstitial Fibrosis Wnt/ -Catenin Signaling Promotes Renal Interstitial Fibrosis Weichun He,* Chunsun Dai,* Yingjian Li,* Gang Zeng,* Satdarshan P. Monga,* and Youhua Liu* *Department of Pathology, University of Pittsburgh

More information

Transforming growth factor beta and progression of renal disease.

Transforming growth factor beta and progression of renal disease. Kidney International, Vol. 64, Supplement 87 (2003), pp. S99 S104 Transforming growth factor beta and progression of renal disease PHYLLIS AUGUST and MANIKKAM SUTHANTHIRAN Weill Medical College of Cornell

More information

Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced

Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced Astragaloside IV ameliorates 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced colitis implicating regulation of energy metabolism Xu-Guang Jiang 1,2,, Kai Sun 1,3,4,5,, Yu-Ying Liu 1,4,5, Li Yan 1,4,5,

More information

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Online Data Supplement Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Yi Lin and Zhongjie Sun Department of physiology, college of

More information

Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model

Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model Averi Leahy, Andrea Foote, Tomoya Uchimura, Li Zeng, PhD. Tufts University, Boston, MA, USA. Disclosures: A. Leahy: None.

More information

RENOPROTECTIVE EFFECTS OF COMBINED ALISKIREN AND VALSARTAN IN PROGRESSIVE DIABETIC NEPHROPATHY IN RATS

RENOPROTECTIVE EFFECTS OF COMBINED ALISKIREN AND VALSARTAN IN PROGRESSIVE DIABETIC NEPHROPATHY IN RATS Research Article RENOPROTECTIVE EFFECTS OF COMBINED ALISKIREN AND VALSARTAN IN PROGRESSIVE DIABETIC NEPHROPATHY IN RATS Hemanth Kumar. Nyathani, Prashanth. Srirangam*, Vidya Sagar Jinugu Vaagdevi College

More information

IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung

IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung Se-Ran Yang, Samantha Valvo, Hongwei Yao, Aruna Kode, Saravanan Rajendrasozhan, Indika Edirisinghe, Samuel

More information

The use of pathology surrogate markers in Fabry Disease. Beth L. Thurberg MD PhD Vice President of Pathology Genzyme

The use of pathology surrogate markers in Fabry Disease. Beth L. Thurberg MD PhD Vice President of Pathology Genzyme Disclaimer: Presentation slides from the Rare Disease Workshop Series are posted by the EveryLife Foundation for Rare Diseases for educational purposes only. They are for use by drug development professionals

More information

Connective Tissue Response in IBD

Connective Tissue Response in IBD Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control

More information

Molecular signaling cascade of mirnas in causing Diabetes Nephropathy

Molecular signaling cascade of mirnas in causing Diabetes Nephropathy www.bioinformation.net Hypothesis Volume 9(8) Molecular signaling cascade of mirnas in causing Diabetes Nephropathy Dyave Gowda Padmashree & Narayanaswamy Ramachra Swamy* Department of Biochemistry, Central

More information

Pair-fed % inkt cells 0.5. EtOH 0.0

Pair-fed % inkt cells 0.5. EtOH 0.0 MATERIALS AND METHODS Histopathological analysis Liver tissue was collected 9 h post-gavage, and the tissue samples were fixed in 1% formalin and paraffin-embedded following a standard procedure. The embedded

More information