hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in
|
|
- Phyllis Wood
- 6 years ago
- Views:
Transcription
1 SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in Fbn1 +/+ and Fbn1 C1039G/+ mice with and without valvular regurgitation at 4 and 12 months of age. EDD, end-diastolic diameter; ESD, end-systolic diameter; FS, fractional shortening; LVM, left ventricular mass. n>=14 per group. *p<5,, p<1, p<01, 2w ANOVA, Tukey s correction. B. Representative PV loop of a 12mo Fbn1 +/+ (blue line, blue fill) and Fbn1 C1039G/+ mouse (red line, red fill) without valvular regurgitation. Summary data obtained from PV loop analysis shown in bar graphs: Ees, end-systolic elastance and PRSW, preload recruitable stroke work, reflect load-independent indices of ventricular contractility. Tau, relaxation time constant reflects a load-independent index of ventricular stiffness; n=3-6 per group. C. dp/dtmax, peak rate of left ventricular pressure rise, an index of contractility; dp/dtmin, peak rate of left ventricular pressure decline, an index of lusitropy. Invasive blood pressure measurements taken from PV loop analysis of Fbn1 +/+ and Fbn1 C1039G/+ mice without valvular regurgitation at 4 and 12 months of age. n=3-6 per group. D. Gross morphometric analysis of post-natal Fbn1 +/+, Fbn1 C1039G/+, Fbn1 C1039G/C1039G mice at 8do, 6mo and 12mo age, in mice without valvular regurgitation. HW/BW, heart weight/body weight ratio; HW/TL, heart weight/tibial length ratio. n>=4 per group. Supplemental Figure 2. Fbn1 C1039G/+ hearts have normal TGFβ signaling in the absence of hemodynamic stress. A-C. Representative Western blot and summary quantification for phosphorylated/total (p/t), p/tsmad2, p/terk1/2, and GAPDH using left ventricular tissue lysates. n=4 per group. D. mrna expression normalized to 18S and then to Fbn1 +/+ data, assessed by real-time RT-PCR from left ventricular tissue of 3mo Fbn1 +/+ and 1
2 Fbn /C1039G/+ hearts without regurgitation. Ctgf, connective tissue growth factor. Serpine1, plasminogen activator inhibitor, type 1. n>=4 per group. Supplemental Figure 3. Fbn1 C1039G/+ hearts develop hypertrophy and fibrosis in response to pressure overload. A. Baseline echocardiographic quantification of cardiac dimensions in 5mo Fbn1 +/+ and Fbn1 C1039G/+ mice without valvular regurgitation. EDD, end-diastolic diameter; ESD, end-systolic diameter; IVST, interventricular septum thickness; PWT, posterior wall thickness. n=4-6 per group. B. Myocyte hypertrophy, as assessed by cross-sectional area (CSA) in hematoxylin-eosin staining. Summary quantification of averaged data, >20 cells per heart. n=4 per group. C. Fibrotic area, as assessed by Masson s Trichrome stain and quantified by total number of blue pixels normalized to whole tissue area and then to Fbn1 +/+ :SHAM data. n=4-6 per group. D. mrna expression of hypertrophy genes, normalized to Gapdh and then to Fbn1 +/+ :SHAM data, assessed by real-time RT-PCR. n=4-6 per group. Myh7, myosin heavy chain 7 (βmhc), Nppa, natriuretic peptide A (ANP), Nppb, natriuretic peptide B (BNP). p<1, p<01, 1w ANOVA, Tukey s correction. Supplemental Figure 4. Fibrillin-1 protein fails to deposit in myocardium in load-induced heart failure in Fbn1 C1039G/+ mice. Additional representative images of immunofluorescent fibrillin-1 staining (red) of heart sections from Fbn1 +/+ and Fbn1 C1039G/+ mice subjected to 4w. Red, fibrillin-1 (interstitial space); blue, DAPI (nuclei); Green, lipofuscin (myocytes). Top 4 panels, Scale bar: 20 µm. Bottom 4 panels, 2x zoom. White arrow head points to an example nonmyocyte cell in the interstitial space. Supplemental Figure 5. Smad2 and ERK1/2 activation are differentially increased in the myocyte and nonmyocyte compartments of failing Fbn1 C1039G/+ hearts. A. Representative serial sections of psmad2 (red, top panels) and perk1/2 (red, bottom panels) immunostaining in Fbn1 C1039G/+ 2
3 hearts subjected to 4w. Far left panels, scale bar: 50 µm. Middle and far right panels, zoom 2x. Blue, DAPI (nuclei); Green, lipofuscin (myocytes). White arrows, myocyte nuclei. Yellow arrows, nonmyocyte nuclei. B. Summary quantification of % of total psmad2 and perk1/2 immunofluorescence intensity localized to nonmyocyte (NM) and myocyte (M) cells per unit area. n=10-15 areas quantified. *p<5, p<1, Student s t-test. C. Representative myocyteenriched serial sections. Scale bar: 50 µm. D. Representative co-immunostaining of serial sections with vimentin (yellow) and psmad2 (left panel) and vimentin (yellow) and perk1/2 (right panel). Scale bar: 25 µm. Gray, lipofuscin (myocytes). Supplemental Figure 6. ERK1/2 activation, but not Smad2 activation, is significantly attenuated by MEK inhibition. Immunoblot for psmad2, perk1/2 and GAPDH using cultured neonatal rat cardiac fibroblasts with TGF-ß3 (10 ng/ml) stimulation for 15 minutes with and without treatment with, RDEA119 (100nM) or PD98059 (50μM). n=4 per group. p<1, p<01, 1w ANOVA, Tukey s correction. Supplemental Figure 7. Myocyte hypertrophy in Fbn1 C1039G/+ hearts is prevented with losartan and treatment. A. Representative hematoxylin-eosin staining of formalin-fixed heart sections. White dotted line delineates myocyte diameter. Scale bars: 50µm. B. Myocyte hypertrophy as assessed by wheat germ agglutinin (WGA) staining. Scale bars: 25µm. C. Summary quantification of average cross-sectional area (CSA) data, >1000 cells per heart. n=4-7 per group. D. mrna expression of hypertrophy genes, normalized to Gapdh and then to Fbn1 +/+ :SHAM data, assessed by real-time RT-PCR. Myh7, myosin heavy chain 7 (βmhc), Myh6, myosin heavy chain 6 (αmhc), Nppa, natriuretic peptide A (ANP), Nppb, natriuretic peptide B (BNP). n=4-7 per group. *p<5, p<1, p<01, 1w ANOVA, Tukey s correction. 3
4 Supplemental Figure 8. Smad2 and ERK1/2 activation are differentially increased in response to TGFβ and angiotensin II in cardiac fibroblasts. Immunoblot for psmad2, perk1/2 and GAPDH using cultured neonatal murine cardiac fibroblasts with TGFß1 (5 ng/ml) or AngII (5nM) stimulation for 24 hours. Lanes were run on the same gel but were noncontiguous. n>=3 per group. p<1, 1w ANOVA, Tukey s correction. Supplemental Figure 9. Inhibition of ERK1/2 activation suppresses Smad2 activation in both nonmyocyte and myocyte compartments. A-B. Labeling index (% positive cells) of psmad2 or perk1/2 immunofluorescence in the nonmyocyte and myocyte compartments. n>5 fields per group. C. Total number of nonmyocytes and myocytes normalized to Fbn1 +/+ :SHAM data. n=15-30 fields per group. *p<5, p<1, p<01, 1w ANOVA, Tukey s correction. Supplemental Figure 10. TGFβ3 is predominantly expressed in the nonmyocyte compartment. A- C. Representative in situ hybridization of Tgfb3. A. Fbn1 +/+ : vs Fbn1 C1039G/+ :, Tgfb3, red. Left panel, scale bar: 10µm. Right panel, zoom 2x inset. Dotted line demarcates myocyte compartment. Red arrows point to examples of in situ RNA hybridization (red dots) found throughout the nonmyocyte compartment. B. Myocyte- vs nonmyocyte-enriched areas. Scale bar: 10µm. C. Tgfb3 and Vim. Left panel, Tgfb3, red, left panel and Vim, red, right panel. Dottedline outlines the cardiac myocytes. Scale bar: 10µm. D. mrna expression of Tgfb3 and Vim normalized to Gapdh and then to myocyte data. n=4-6 per group. p<01, Student s t-test. Supplemental Figure 11. AngII-mediated ERK1/2 activation is differentially increased in Fbn1 C1039G/+ vs WT fibroblasts. Immunoblots for psmad2, perk1/2 and GAPDH using cultured neonatal murine cardiac fibroblasts from Fbn1 C1039G/+ and Fbn1 +/+ hearts with AngII (5nM) or TGFß3 (5 ng/ml) stimulation for 12 hours. Lanes were run on the same gel but were noncontiguous. n>=3 per group. p<01, 1w ANOVA, Tukey s correction. 4
5 Supplemental Figure 1 A * * * EDD (mm) ESD (mm) FS (%) LVM (mg) Fbn1 +/+ Fbn1 C1039G/+ without regurgitation Fbn1 C1039G/+ with regurgitation 4 mo 12 mo 4 mo 12 mo 4 mo 12 mo 4 mo 12 mo B 160 E es (mmhg/µl/g) PRSW (mmhg) Tau (ms) Pressure (mmhg) C Volume (ml) 4mo 12 mo Systolic Pressure (mmhg) 4mo 12 mo Diastolic Pressure (mmhg) 4mo 12 mo Pulse Pressure (mmhg) dp/dt max (mmhg/s) Thousands 4mo 12 mo 4mo 12 mo 4mo 12 mo 4mo 12 mo dp/dt min (mmhg/s) Thousands D HW/BW (mg/g) Post natal day 8 HW/BW (mg/g) 6mo HW/BW (mg/g) 12mo +/+ C1039G/+ C1039G/ C1039G +/+ C1039G/+ +/+ C1039G/+ Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in Fbn1 +/+ and Fbn1 C1039G/+ mice with and without valvular regurgitation at 4 and 12 months of age. EDD, end diastolic diameter; ESD, end systolic diameter; FS, fractional shortening; LVM, left ventricular mass. n>=14 per group. *p<5,, p<1, p<01, 2w ANOVA, Tukey s correction. B. Representative PV loop of a 12mo Fbn1 +/+ (blue line, blue fill) and Fbn1 C1039G/+ mouse (red line, red fill) without valvular regurgitation. Summary data obtained from PV loop analysis shown in bar graphs: E es, end systolic elastance and PRSW, preload recruitable stroke work, reflect load independent indices of ventricular contractility. Tau, relaxation time constant reflects a load independent index of ventricular stiffness; n=3 6 per group. C. dp/dt max, peak rate of left ventricular pressure rise, an index of contractility; dp/dt min, peak rate of left ventricular pressure decline, an index of lusitropy. Invasive blood pressure measurements taken from PV loop analysis of Fbn1 +/+ and Fbn1 C1039G/+ mice without valvular regurgitation at 4 and 12 months of age. n=3 6 per group. D. Gross morphometric analysis of post natal Fbn1 +/+, Fbn1 C1039G/+, Fbn1 C1039G/C1039G mice at 8do, 6mo and 12mo age, in mice without valvular regurgitation. HW/BW, heart weight/body weight ratio; HW/TL, heart weight/tibial length ratio. n>=4 per group.
6 Supplemental Figure 2 A Post natal day 8 +/+ C1039G/+ C1039G/ C1039G psmad2 tsmad2 perk1/2 terk1/2 psmad2/tsmad perk1/2/terk1/ B Fbn1 +/+ Fbn1 C1039G/+ GAPDH 1.6 +/+ C1039G/+ C1039G/ C1039G 1.6 +/+ C1039G/+ C1039G/ C1039G 3 mo psmad2 GAPDH perk1/2 psmad2/gapdh perk1/2/gapdh C Fbn1 +/+ Fbn1 C1039G/+ GAPDH 1.6 +/+ C1039G/ /+ C1039G/+ 12 mo psmad2 tsmad2 perk1/2 terk1/2 psmad2/tsmad perk1/2/terk1/ D 2.0 Ctgf 2.0 Serpine1 +/+ C1039G/+ +/+ C1039G/+ Relative expression Relative expression /+ C1039G/+ +/+ C1039G/+ Supplemental Figure 2. Fbn1 C1039G/+ hearts have normal TGFβ signaling in the absence of hemodynamic stress. A C. Representative Western blot and summary quantification for phosphorylated/total (p/t), p/tsmad2, p/terk1/2, and GAPDH using left ventricular tissue lysates. n=4 per group. D. mrna expression normalized to 18S and then to Fbn1 +/+ data, assessed by real time RT PCR from left ventricular tissue of 3mo Fbn1 +/+ and Fbn /C1039G/+ hearts without regurgitation. Ctgf, connective tissue growth factor. Serpine1, plasminogen activator inhibitor, type 1. n>=4 per group.
7 Supplemental Figure 3 A mm SHAM: Fbn1 +/+ : Fbn1 +/+ SHAM: Fbn1 C1039G/+ : Fbn1 C1039G/+ 1 B Normalized fibrotic area Fbn1 +/+ Fbn1 C1039G/+ EDD ESD IVST PWT C Normalized myocyte area SHAM SHAM 0 SHAM SHAM D Myh7/GAPDH * Nppa/GAPDH Nppb/GAPDH SHAM SHAM SHAM SHAM SHAM SHAM Supplemental Figure 3. Fbn1 C1039G/+ hearts develop hypertrophy and fibrosis in response to pressure overload. A. Baseline echocardiographic quantification of cardiac dimensions in 5mo Fbn1 +/+ and Fbn1 C1039G/+ mice without valvular regurgitation. EDD, end diastolic diameter; ESD, end systolic diameter; IVST, interventricular septum thickness; PWT, posterior wall thickness. n=4 6 per group. B. Myocyte hypertrophy, as assessed by cross sectional area (CSA) in hematoxylin eosin staining. Summary quantification of averaged data, >20 cells per heart. n=4 per group. C. Fibrotic area, as assessed by Masson s Trichrome stain and quantified by total number of blue pixels normalized to whole tissue area and then to Fbn1 +/+ :SHAM data. n=4 6 per group. D. mrna expression of hypertrophy genes, normalized to Gapdh and then to Fbn1 +/+ :SHAM data, assessed by real time RT PCR. n=4 6 per group. Myh7, myosin heavy chain 7 (βmhc), Nppa, natriuretic peptide A (ANP), Nppb, natriuretic peptide B (BNP). p<1, p<01, 1w ANOVA, Tukey s correction.
8 Supplemental Figure 4 Supplemental Figure 4. Fibrillin 1 protein fails to deposit in myocardium in load induced heart failure in Fbn1C1039G/+ mice. Additional representative images of immunofluorescent fibrillin 1 staining (red) of heart sections from Fbn1+/+ and Fbn1C1039G/+ mice subjected to 4w. Red, fibrillin 1 (interstitial space); blue, DAPI (nuclei); Green, lipofuscin (myocytes). Top 4 panels, Scale bar: 20 µm. Bottom 4 panels, 2x zoom. White arrow head points to an example nonmyocyte cell in the interstitial space.
9 Fbn1C1039G/+: Supplemental Figure 5 A B % of total intensity psmad2/3 Myocyte Nuclei D Myocyte Nuclei psmad2 perk1/2 * NM M perk1/2 % of total intensity C NM M Supplemental Figure 5. Smad2 and ERK1/2 activation are differentially increased in the myocyte and nonmyocyte compartments of failing Fbn1C1039G/+ hearts. A. Representative serial sections of psmad2 (red, top panels) and perk1/2 (red, bottom panels) immunostaining in Fbn1C1039G/+ hearts subjected to 4w. Far left panels, scale bar: 50 µm. Middle and far right panels, zoom 2x. Blue, DAPI (nuclei); Green, lipofuscin (myocytes). White arrows, myocyte nuclei. Yellow arrows, nonmyocyte nuclei. B. Summary quantification of % of total psmad2 and perk1/2 immunofluorescence intensity localized to nonmyocyte (NM) and myocyte (M) cells per unit area. n=10 15 areas quantified. *p<5, p<1, Student s t test. C. Representative myocyte enriched serial sections. Scale bar: 50 µm. D. Representative co immunostaining of serial sections with vimentin (yellow) and psmad2 (left panel) and vimentin (yellow) and perk1/2 (right panel). Scale bar: 25 µm. Gray, lipofuscin (myocytes).
10 Supplemental Figure 6 No stim TGFβ3 TGFβ3 + psmad2/gapdh perk1/2/gapdh TGFβ3 + _ + + TGFβ3 + _ + + Supplemental Figure 6. ERK1/2 activation, but not Smad2 activation, is significantly attenuated by MEK inhibition. Immunoblot for psmad2, perk1/2 and GAPDH using cultured neonatal rat cardiac fibroblasts with TGF ß3 (10 ng/ml) stimulation for 15 minutes with and without treatment with, RDEA119 (100nM) or PD98059 (50μM). n=4 per group. p<1, p<01, 1w ANOVA, Tukey s correction.
11 Supplemental Figure 7 A B C Nppb/GAPDH Myocyte Area (μm 3 ) Fbn1 +/+ Fbn1 C1039G/+ D Myh7/GAPDH p=0.10 SHAM SHAM Supplemental Figure 7. Myocyte hypertrophy in Fbn1 C1039G/+ hearts is prevented with losartan and treatment. A. Representative hematoxylin eosin staining of formalin fixed heart sections. White dotted line delineates myocyte diameter. Scale bars: 50µm. B. Myocyte hypertrophy as assessed by wheat germ agglutinin (WGA) staining. Scale bars: 25µm. C. Summary quantification of average cross sectional area (CSA) data, >1000 cells per heart. n=4 7 per group. D. mrna expression of hypertrophy genes, normalized to Gapdh and then to Fbn1 +/+ :SHAM data, assessed by real time RT PCR. Myh7, myosin heavy chain 7 (βmhc), Myh6, myosin heavy chain 6 (αmhc), Nppa, natriuretic peptide A (ANP), Nppb, natriuretic peptide B (BNP). n=4 7 per group. *p<5, p<1, p<01, 1w ANOVA, Tukey s correction. Nppa/GAPDH SHAM SHAM * SHAM SHAM * SHAM SHAM
12 Supplemental Figure 8 psmad2/gapdh Ctrl TGFβ1 AngII perk1/2/gapdh Ctrl TGFβ1 AngII Supplemental Figure 8. Smad2 and ERK1/2 activation are differentially increased in response to TGFβ and angiotensin II in cardiac fibroblasts. Immunoblot for psmad2, perk1/2 and GAPDH using cultured neonatal murine cardiac fibroblasts with TGFß1 (5 ng/ml) or AngII (5nM) stimulation for 24 hours. Lanes were run on the same gel but were noncontiguous. n>=3 per group. p<1, 1w ANOVA, Tukey s correction.
13 Supplemental Figure 9 A psmad2 (% positive) Fbn1 +/+ Fbn1 C1039G/+ Nonmyocytes psmad2 (% positive) Myocytes B perk1/2 (% positive) SHAM SHAM Nonmyocytes perk1/2 (% positive) SHAM SHAM Myocytes C SHAM SHAM Nonmyocytes: Fbn1 +/+ Nonmyocytes: Fbn1 C1039G/+ Myocytes: Fbn1 +/+ Myocytes: Fbn1 C1039G/+ Fold change # of nonmyocytes/mm 2 * * SHAM SHAM SHAM SHAM TGFβNAbLosartan Supplemental Figure 9. Inhibition of ERK1/2 activation suppresses Smad2 activation in both nonmyocyte and myocyte compartments. A B. Labeling index (% positive cells) of psmad2 or perk1/2 immunofluorescence in the nonmyocyte and myocyte compartments. n>5 fields per group. C. Total number of nonmyocytes and myocytes normalized to Fbn1 +/+ :SHAM data. n=15 30 fields per group. *p<5, p<1, p<01, 1w ANOVA, Tukey s correction.
14 Supplemental Figure 10 B Myocyte enriched DAPI D Myocyte Fold increase Vim Tgfb3/GAPDH Nonmyocyte enriched Tgfb3 Myocyte Fibroblast Fold increase Fbn1C1039G/+: C Vim/GAPDH A Myocyte Fibroblast Supplemental Figure 10. TGFβ3 is predominantly expressed in the nonmyocyte compartment. A C. Representative in situ hybridization of Tgfb3. A. Fbn1+/+: vs Fbn1C1039G/+:, Tgfb3, red. Left panel, scale bar: 10µm. Right panel, zoom 2x inset. Dotted line demarcates myocyte compartment. Red arrows point to examples of in situ RNA hybridization (red dots) found throughout the nonmyocyte compartment. B. Myocyte vs nonmyocyte enriched areas. Scale bar: 10µm. C. Tgfb3 and Vim. Left panel, Tgfb3, red, left panel and Vim, red, right panel. Dotted line outlines the cardiac myocytes. Scale bar: 10µm. D. mrna expression of Tgfb3 and Vim normalized to Gapdh and then to myocyte data. n=4 6 per group. p<01, Student s t test.
15 Supplemental Figure 11 psmad2/gapdh Fbn1 +/+ Fbn1 C1039G/+ psmad2/gapdh Ctrl AngII Ctrl AngII 0 Ctrl TGFβ3 Ctrl TGFβ3 3 2 perk1/2/gapdh 2 1 perk1/2/gapdh 1 0 Ctrl AngII Ctrl AngII 0 Ctrl TGFβ3 Ctrl TGFβ3 Supplemental Figure 11. AngII mediated ERK1/2 activation is differentially increased in Fbn1 C1039G/+ vs WT fibroblasts. Immunoblots for psmad2, perk1/2 and GAPDH using cultured neonatal murine cardiac fibroblasts from Fbn1 C1039G/+ and Fbn1 +/+ hearts with AngII (5nM) or TGFß3 (5 ng/ml) stimulation for 12 hours. Lanes were run on the same gel but were noncontiguous. n>=3 per group. p<01, 1w ANOVA, Tukey s correction.
Fetal gene upregulation by 1-wk TAC is significantly increased in mice lacking RGS2.
3562-RG-1 Supplementary Figure 1 Fetal gene upregulation by 1-wk is significantly increased in mice lacking RGS2. ANP(Nppa) /BNP(Nppb) A-type and B-type natriuretic peptide; β-mhc (Myh7) beta myosin heavy
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationGallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity
Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationBNP mrna expression in DR and DS rat left ventricles (n = 5). (C) Plasma norepinephrine
Kanazawa, et al. Supplementary figure legends Supplementary Figure 1 DS rats had congestive heart failure. (A) DR and DS rat hearts. (B) QRT-PCR analysis of BNP mrna expression in DR and DS rat left ventricles
More informationE10.5 E18.5 P2 10w 83w NF1 HF1. Sham ISO. Bmi1. H3K9me3. Lung weight (g)
Myociyte cross-sectional Relative mrna levels Relative levels Relative mrna levels Supplementary Figures and Legends a 8 6 4 2 Ezh2 E1.5 E18.5 P2 1w 83w b Ezh2 p16 amhc b-actin P2 43w kd 37 86 16 wt mouse
More informationIn vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell
Supplementary Methods BrdU incorporation in vivo In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell proliferation in the heart. Mice were subjected to LI-TAC, and 5 days later
More informationSUPPLEMENTARY INFORMATION
a c e doi:10.1038/nature10407 b d f Supplementary Figure 1. SERCA2a complex analysis. (a) Two-dimensional SDS-PAGE gels of SERCA2a complexes. A silver-stained SDSPAGE gel is shown, which reveals a 12 kda
More informationFigure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min
Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with
More informationSupplemental Figure I
Supplemental Figure I Kl ( mmol/l)-induced Force orta M (mn) 1 (mn) 1 Supplemental Figure I. Kl-induced contractions. and, Kl ( mmol/l)-induced contractions of the aorta () and those of mesenteric arteries
More informationTcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W
A Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 Tcf21 MCM ; R26 mtmg TAC 2W Tcf21 MCM ; R26 mtmg TAC 8W B Postn MCM ; R26 mtmg Sham GFP Col 1/3 Postn MCM ; R26 mtmg TAC 2W Postn MCM ; R26 mtmg TAC 8W Supplementary
More informationSupplementary Figures Supplementary Figure 1. Development of the camp biosensor targeted to the SERCA2a microdomain.
Supplementary Figures Supplementary Figure 1. Development of the camp biosensor targeted to the SERCA2a microdomain. A B C (A) Schematic representation of the new constructs designed for local camp imaging.
More informationSupplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationControl. csarnt -/- Cre, f/f
ody weight (g) A re,f/f re x f/f f/+ re, f/+ re,f/+ f/f x f/f f/+ cs -/- re, f/f re f/f re, f/f Normal chow Tamoxifen Tamoxifen Tamoxifen W 4W re f/f re, re/ff f/f re f/f re, re/ff f/f Normal chow Tamoxifen
More informationTitle: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events
Title: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events Pu Yang 1, 3, radley M. Schmit 1, Chunhua Fu 1, Kenneth DeSart 1, S. Paul
More informationSupplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin
Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin sections from sham-operated adult hearts (a and i) and
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationSupplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
More informationdoi: /nature14508 Rappsilber et al.
SUPPLEMENTARY INFORMATION doi:1.138/nature1458 Grosso et al. Barbosa et al. 74 72 45 33 47 7 51 Rappsilber et al. Supplementary Figure 1 a, Venn-Diagram of identified splice factors in the work of Barbossa
More informationSupplemental Table 1. Echocardiography Control (n=4)
Supplemental Table 1. Echocardiography (n=4) Mlc2v cre/+ ; DNMAML (n=4) LVIDd, mm 3.9±0.3 4.3±0.3 LVIDs, mm 2.6±0.4 2.9±0.2 d, mm 0.72±0.06 0.75±0.1 LVPWd, mm 0.72±0.06 0.77±0.11 FS, % 33±6 33±1 EF, %
More informationSupplement Material. chain (MLC2v) promoter to generate cardiac-specific MKK4 knockout mice (referred to
Supplement Material Materials and Methods Generation of MKK Mutant Mice The mkk-flox mice (referred to as ) were previously generated and characterised. mice were mated with mice expressing Cre under a
More information(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,
Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.
More informationSantulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function
ONLINE DATA SUPPLEMENTS Santulli G. et al. A microrna-based strategy to suppress restenosis while preserving endothelial function Supplementary Figures Figure S1 Effect of Ad-p27-126TS on the expression
More informationSupplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
More informationKidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI
a e Na V 1.5 Ad-LacZ Ad- 110KD b Scn5a/ (relative to Ad-LacZ) f 150 100 50 0 p = 0.65 Ad-LacZ Ad- c Heart Lung Kidney Spleen 110KD d fl/fl c -/- DAPI 20 µm Na v 1.5 250KD fl/fl Rabbit IgG DAPI fl/fl Mouse
More informationSupplementary Table 1 Clinicopathological characteristics of 35 patients with CRCs
Supplementary Table Clinicopathological characteristics of 35 patients with CRCs Characteristics Type-A CRC Type-B CRC P value Sex Male / Female 9 / / 8.5 Age (years) Median (range) 6. (9 86) 6.5 (9 76).95
More informationLV geometric and functional changes in VHD: How to assess? Mi-Seung Shin M.D., Ph.D. Gachon University Gil Hospital
LV geometric and functional changes in VHD: How to assess? Mi-Seung Shin M.D., Ph.D. Gachon University Gil Hospital LV inflow across MV LV LV outflow across AV LV LV geometric changes Pressure overload
More informationSupplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous
Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous LRP5 in intact adult mouse ventricular myocytes (AMVMs)
More informationMoore-Morris et al. Supplemental Table 1.
Moore-Morris et al. Supplemental Table. In vivo echocardiographic assessment of cardiac size and function following transaortic constriction (T) at 7d and 8d. SHM 7d N=6 T 7d N=5 SHM 8d N= T 8d N=6 W,
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationSupplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with
More informationNature Genetics: doi: /ng Supplementary Figure 1. Parameters and consequences of mononuclear cardiomyocyte frequency.
Supplementary Figure 1 Parameters and consequences of mononuclear cardiomyocyte frequency. (a) Correlation of the frequency of mononuclear cardiomyocytes to the frequency of cardiomyocytes with three or
More informationSupplementary Figure 1:
Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas
More informationMEK-ERK pathway modulation ameliorates disease phenotypes in a mouse model of Noonan syndrome associated with the Raf1 L613V mutation
Related Commentary, page 844 Research article MEK-ERK pathway modulation ameliorates disease phenotypes in a mouse model of Noonan syndrome associated with the Raf1 L613V mutation Xue Wu, 1,2 Jeremy Simpson,
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10188 Supplementary Figure 1. Embryonic epicardial genes are down-regulated from midgestation stages and barely detectable post-natally. Real time qrt-pcr revealed a significant down-regulation
More informationSUPPLEMENTARY INFORMATION
DOI: 1.138/ncb222 / b. WB anti- WB anti- ulin Mitotic index (%) 14 1 6 2 T (h) 32 48-1 1 2 3 4 6-1 4 16 22 28 3 33 e. 6 4 2 Time (min) 1-6- 11-1 > 1 % cells Figure S1 depletion leads to mitotic defects
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSUPPLEMENTARY LEGENDS...
TABLE OF CONTENTS SUPPLEMENTARY LEGENDS... 2 11 MOVIE S1... 2 FIGURE S1 LEGEND... 3 FIGURE S2 LEGEND... 4 FIGURE S3 LEGEND... 5 FIGURE S4 LEGEND... 6 FIGURE S5 LEGEND... 7 FIGURE S6 LEGEND... 8 FIGURE
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
More informationmarker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationNature Immunology: doi: /ni eee Supplementary Figure 1
eee Supplementary Figure 1 Hyphae induce NET release, but yeast do not. (a) NET release by human peripheral neutrophils stimulated with a hgc1 yeast-locked C. albicans mutant (yeast) or pre-formed WT C.
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/375/ra41/dc1 Supplementary Materials for Actin cytoskeletal remodeling with protrusion formation is essential for heart regeneration in Hippo-deficient mice
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationIn Vivo Animal Models of Heart Disease. Why Animal Models of Disease? Timothy A Hacker, PhD Department of Medicine University of Wisconsin-Madison
In Vivo Animal Models of Heart Disease Timothy A Hacker, PhD Department of Medicine University of Wisconsin-Madison Why Animal Models of Disease? Heart Failure (HF) Leading cause of morbidity and mortality
More informationSupplementary Material
Supplementary Material Induction of myocardial infarction Mice were anesthetized by intraperitoneal injection of pentobarbital (7 mg/kg). In the supine position, endotracheal intubation was performed.
More informationSupplemental Table S1
Supplemental Table S. Tumorigenicity and metastatic potential of 44SQ cell subpopulations a Tumorigenicity b Average tumor volume (mm ) c Lung metastasis d CD high /4 8. 8/ CD low /4 6./ a Mice were injected
More informationSupplemental Tables and Figures. The metalloproteinase-proteoglycans ADAMTS7 and ADAMTS12 provide an innate,
Supplemental Tables and Figures The metalloproteinase-proteoglycans ADAMTS7 and ADAMTS12 provide an innate, tendon-specific protective mechanism against heterotopic ossification Timothy Mead et al Supplemental
More informationCardiac hypertrophy is an early hallmark of the clinical
Regulator of G Protein Signaling Facilities Cardiac Hypertrophy by Activating Apoptosis Signal Regulating Kinase 1 P38/c-JUN N-Terminal Kinase 1/ Signaling Zhijun Huang, MD;* Jingxian Shu, MS;* Weihong
More informationANGPTL2 increases bone metastasis of breast cancer cells through. Tetsuro Masuda, Motoyoshi Endo, Yutaka Yamamoto, Haruki Odagiri, Tsuyoshi
Masuda et al. Supplementary information for ANGPTL2 increases bone metastasis of breast cancer cells through enhancing CXCR4 signaling Tetsuro Masuda, Motoyoshi Endo, Yutaka Yamamoto, Haruki Odagiri, Tsuyoshi
More informationSupporting Information
Supporting Information Kuroda et al. 10.1073/pnas.1002178107 SI Methods Monoclonal Antibodies Against Nox4. Generation of the anti-nox4 mouse monoclonal antibody (3D2), which detects Nox4 and does not
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2638 Figure S1 Morphological characteristics of fetal testes and ovaries from 6.5-20 developmental weeks. Representative images of Hematoxylin and Eosin staining of testes and ovaries over
More informationSupplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β
Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β
More informationSupplementary Table 1. List of primers used in this study
Supplementary Table 1. List of primers used in this study Gene Forward primer Reverse primer Rat Met 5 -aggtcgcttcatgcaggt-3 5 -tccggagacacaggatgg-3 Rat Runx1 5 -cctccttgaaccactccact-3 5 -ctggatctgcctggcatc-3
More informationSupplementary information. The proton-sensing G protein-coupled receptor T-cell death-associated gene 8
1 Supplementary information 2 3 The proton-sensing G protein-coupled receptor T-cell death-associated gene 8 4 (TDAG8) shows cardioprotective effects against myocardial infarction 5 Akiomi Nagasaka 1+,
More informationIntermittent pressure overload triggers hypertrophy-independent cardiac dysfunction and vascular rarefaction
Related Commentary, page 1467 Research article Intermittent pressure overload triggers hypertrophy-independent cardiac dysfunction and vascular rarefaction Cinzia Perrino, 1 Sathyamangla V. Naga Prasad,
More informationSupplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier curves for progression-free survival (PFS) and overall survival (OS) in a cohort of patients (N=52) with stage III primary ovarian
More information5 -GGTAAAGCAGGTCTAGGTGGCTGACAGTCT-3. Cre-transgene allele was detected. by PCR using the primers; 5 -ACATGTTCAGGGATCGCCAG-3 and
Supplemental Information Methods PCR primers for mice genotyping The Gab1 flox allele can be distinguished from the wild type Gab1 allele by PCR on genomic DNAs extracted from tails, using the primer pair
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/283/ra57/dc1 Supplementary Materials for JNK3 Couples the Neuronal Stress Response to Inhibition of Secretory Trafficking Guang Yang,* Xun Zhou, Jingyan Zhu,
More informationAssessment of LV systolic function
Tutorial 5 - Assessment of LV systolic function Assessment of LV systolic function A knowledge of the LV systolic function is crucial in the undertanding of and management of unstable hemodynamics or a
More informationSupplementary Figure 1
Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains
More informationPivotal role of cardiomyocyte TGF-β signaling in the murine pathological response to sustained pressure overload
Research article Pivotal role of cardiomyocyte TGF-β signaling in the murine pathological response to sustained pressure overload Norimichi Koitabashi, 1 Thomas Danner, 1 Ari L. Zaiman, 2 Yigal M. Pinto,
More informationMyocardial Remodeling Is Controlled by Myocyte-Targeted Gene Regulation of Phosphodiesterase Type 5
Journal of the American College of Cardiology Vol. 5, No., by the American College of Cardiology Foundation ISSN 75-97/$. Published by Elsevier Inc. doi:./j.jacc..8. PRE-CLINICAL RESEARCH Myocardial Remodeling
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationSUPPLEMENTARY FIGURE LEGENDS
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Hippocampal sections from new-born Pten+/+ and PtenFV/FV pups were stained with haematoxylin and eosin (H&E) and were imaged at (a) low and (b) high
More informationSupplementary Materials. for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis
Supplementary Materials for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis 1 Supplementary Figure Legends Supplementary Figure 1: Integrin expression
More informationQualifying Examination (Part I)
Department of Pharmacology Qualifying Examination (Part I) December 12 & 13, 2006 Please remember that this is a closed-book examination. You must be prepared to answer 4 of the 7 questions. Although not
More informationSupplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation
Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,
More informationAtrogin-1/muscle atrophy F-box inhibits calcineurin-dependent cardiac hypertrophy by participating in an SCF ubiquitin ligase complex
Research article Atrogin-1/muscle atrophy F-box inhibits calcineurin-dependent cardiac hypertrophy by participating in an SCF ubiquitin ligase complex Hui-Hua Li, 1 Vishram Kedar, 1 Chunlian Zhang, 1 Holly
More informationTarget Protein Antibody name Product number Manufacturer Species Epitope Dilution Aggrecan Anti-aggrecan AB1031 EMD Millipore Corp Rabbit
Family history Hypertension/ Maximum Degree of aortic Bicuspid Disease Age/Sex Diagnosed CTD of aortic disease Treated aortic insufficiency/stenosis aortic Aneurysm 63/M No Yes Yes/Yes diameter 59mm 1-2+/None
More informationSupplementary Information File
Supplementary Information File Supplementary Table 1. List of synthesized sirna sequences for target genes sirna Species Sequence Ctrl sirna mouse sense 5 -UUCUCCGAACGUGUCACGUTT-3 Antisense 5 -ACGUGACACGUUCGGAGAATT-3
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationFigure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from
Figure S1. (A) Schematic diagram of dnrar transgene allele. (B) X-Gal staining of testis from germ cell mutants (dnrar flox/flox, Stra8-Cre +, RARElacZ) (A ), controls (dnrar flox/flox, RARElacZ) (B ),
More informationSUPPLEMENTARY MATERIALS. IL-4 as a Repurposed Biological Drug for Myocardial Infarction through. Augmentation of Reparative Cardiac Macrophages:
1 SUPPLEMENTARY MATERIALS IL-4 as a Repurposed Biological Drug for Myocardial Infarction through Augmentation of Reparative Cardiac Macrophages: Proof-of-Concept Data in Mice Yusuke Shintani MD PhD, Tomoya
More informationSupporting Information
Supporting Information Muraski et al. 10.1073/pnas.0709135105 SI Text Generation of Transgenic Animals. Pim-WT and Pim-DN cdnas were subcloned NheI/SmaI from pegfp-c1 Pim-1 and pegfp-c1 Pim-DN plasmids
More informationSupplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence
Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β
More informationAP VP DLP H&E. p-akt DLP
A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationSupplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
More informationSupplementary. limb. bars
Figure 1. CD163 -/- mice exhibit a similar phenotype ass WT mice in the absence of ischemic injury. a, Laser Doppler analysiss with perfusion quantitation at baseline (n= =10 per group). b, Immunostaining
More informationGenetic ablation of Acp1 (Lmptp) in mice prevents heart failure
Genetic ablation of Acp1 (Lmptp) in mice prevents heart failure Coralie Poizat, Ph.D. Director, Cardiovascular Research Program KFSHRC-Riyadh Saudi Heart Failure Working Group Jeddah, 5 December 2015 Cardiovascular
More informationInactivation of focal adhesion kinase in cardiomyocytes promotes eccentric cardiac hypertrophy and fibrosis in mice
Research article Inactivation of focal adhesion kinase in cardiomyocytes promotes eccentric cardiac hypertrophy and fibrosis in mice Xu Peng, 1 Marc S. Kraus, 2 Huijun Wei, 1 Tang-Long Shen, 1 Romain Pariaut,
More informationSupporting Information. Calculation of the relative contributions of myocyte proliferation, stem cell. Supporting Information Fig 1 (page 9)
Supporting Information Table of contents Calculation of the relative contributions of myocyte proliferation, stem cell differentiation and cardioprotection (page 2) Supporting Information Fig 1 (page 9)
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Mutational analysis of the SA2-Scc1 interaction in vitro and in human cells. (a) Autoradiograph (top) and Coomassie stained gel (bottom) of 35 S-labeled Myc-SA2 proteins (input)
More information(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment
SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.
More informationJ Jpn Coll Angiol, 2009, 49:
Online publication October 6, 2009 48 2 20 J Jpn Coll Angiol, 2009, 49: 293 297 atrial natriuretic peptide, brain natriuretic peptide, guanylyl cyclase-a receptor, cardiac remodeling, cardiac hypertrophy
More informationDECLARATION OF CONFLICT OF INTEREST
DECLARATION OF CONFLICT OF INTEREST Disclosures: Research grants & clinical trials (Gilead), honoraria & clinical trials (Berlin-Chemie/Menarini) Ranolazine in Heart Failure with Preserved Ejection Fraction
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationJASON ANTHONY LUCAS SUZANNE OPARIL (MENTOR) SUSAN BELLIS J. EDWIN BLALOCK YIU-FAI CHEN GILBERT PERRY JOANNE MURPHY-ULLRICH A DISSERTATION
COUNTERREGULATORY ROLES OF TRANSFORMING GROWTH FACTOR (TGF)-β AND ATRIAL NATRIURETIC PEPTIDE (ANP) IN PRESSURE OVERLOAD-INDUCED CARDIAC REMODELING AND FIBROSIS by JASON ANTHONY LUCAS SUZANNE OPARIL (MENTOR)
More informationSupplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis (a) Immunohistochemical (IHC) analysis of tyrosine 705 phosphorylation status of STAT3 (P- STAT3) in tumors and stroma (all-time
More informationAlternatively Activated Macrophages Determine the Repair of the Infarcted
Alternatively Activated Macrophages Determine the Repair of the Infarcted Adult Murine Heart (Shiraishi et al.) List of Supplemental Materials Supplemental Methods Supplemental Figure 1. Cardiac CD206
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
More informationCYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt
Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More information