c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.

Size: px
Start display at page:

Download "c Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p."

Transcription

1 a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8 w) e 5 mg/kg i.p. weekly for 4 weeks 4 w Sacrifice Echocardiography at 4 and 8 w after reperfusion Echocardiography and sacrifice Supplementary Figure 1 Nature Medicine: doi:1.138/nm.417

2 a Collagen I/18S 1 5 b Collagen III/18S 6 3 Sham I/R 8 w Sham I/R 8 w c d e LDH concentration (U/ml) EF (%) FS (%) IVSs (mm) LVPWs (mm) Supplementary Figure 2 Nature Medicine: doi:1.138/nm.417

3 a b RIP3 mrna ( M) ( M).1 1. c d RIP3 mrna H/R Control H/R RIP3 RIP3 GAPDH GAPDH e RIP3 protein ( M) f RIP3 protein Control H/R Normal area Ischemic area Supplementary Figure 3 Nature Medicine: doi:1.138/nm.417

4 a RIP1/GAPDH RIP1 sirna1 RIP1 sirna2 b Cell viability 1..5 Nec1 NS c Cell viability 1..5 Control Nec1 H/R d MLKL/GAPDH MLKL sirna1 MLKL sirna Supplementary Figure 4 Nature Medicine: doi:1.138/nm.417

5 a Ischemia (3 min) Reperfusion (4 h) b 2 mg/kg i.p. Daily KN-93 i.p. Sacrifice KN-93 i.p. 15 min before ischemia 1 w Echocardiography and sacrifice c Cell viability 1..5 Control KN-93 H/R d Cell viability 1..5 KN-93 e Cell viability 1..5 KN-93 Supplementary Figure 5 Nature Medicine: doi:1.138/nm.417

6 a Control H/R DAPI HA DAPI HA Ad-HA-RIP3 Ad-myc-CaMKII myc Merged myc Merged b DAPI RIP3 c DAPI RIP3 Sham CaMKII DAPI Merged RIP3 CaMKII DAPI Merged RIP3 I/R CaMKII Merged CaMKII Merged CaMKII RIP3 Supplementary Figure 6 Nature Medicine: doi:1.138/nm.417

7 a p-camkii t-camkii GAPDH p-camkii/t-camkii * K51A b c Cell viability LDH release K51A Supplementary Figure 7 Nature Medicine: doi:1.138/nm.417

8 a b f CypD -tubulin CypD/ -tubulin c CypD sirna1 CypD sirna1 CypD sirna2 * * CypD sirna2 Cell viability LDH release CypD sirna1 CypD sirna2 CypD sirna1 CypD sirna2 g JC-1 fluorescence (%) JC-1 fluorescence (%) * I/R d TMRM fluorescence (%) 1 5 CypD sirna1 CypD sirna2 e TMRM positive area/ Total cell area (%) CypD sirna1 CypD sirna2 Supplementary Figure 8 Nature Medicine: doi:1.138/nm.417

9 a K51A b TMRM fluorescence (%) 1 5 K51A c TMRM positive area/ Total cell area (%) 6 3 K51A d Ad-CaMKII-DN e f TMRM fluorescence (%) TMRM positive area/ Total cell area (%) Ad-CaMKII-DN Ad-CaMKII-DN Supplementary Figure 9 Nature Medicine: doi:1.138/nm.417

10 a Nox2 GAPDH Nox2/GAPDH 2 1 Nox2 sirna1 * Nox2 sirna2 b Cell viability 1..5 Nox2 sirna1 Nox2 sirna2 c Cell viability 1..5 Tiron d e ox-camkii t-camkii h KN-93 DHE intensity 9 45 ox-camkii/t-camkii (fold of wt vehicle) 2 1 DCF intensity 4 2 KN-93 f PYGL GAPDH GLUD1 GAPDH GLUL GAPDH sirna g sirna PYGL GLUL GLUD1 DCF intensity 2 1 PYGL sirna GLUD1 sirna GLUL sirna Supplementary Figure 1 Nature Medicine: doi:1.138/nm.417

11 DAPI I/R 8 w TUNEL Merged TUNEL positive cells (%) 8 4 Supplementary Figure 11 Nature Medicine: doi:1.138/nm.417

12 a 2 mg/kg DAPI TUNEL Merged TUNEL positive cells (%) 8 4 b 5 mg/kg X 4 DAPI TUNEL Merged TUNEL positive cells (%) 8 4 Supplementary Figure 12 Nature Medicine: doi:1.138/nm.417

13 a b c d e IL-6/18S 8 4 TNF- /18S 4 2 IL-6/18S 4 2 Sham I/R TNF- /18S 6 3 Sham I/R CD3 + cell number/mm f Sham I/R CD3 + cell number/mm Sham I/R Supplementary Figure 13 Nature Medicine: doi:1.138/nm.417

14 a IL-6/18S Nec1 NS b TNF- /18S Nec1 NS c IL-6/18S RIP1 sirna1 RIP1 sirna2 NS NS d TNF-a/18S RIP1 sirna1 RIP1 sirna2 NS NS e IL-6/18S Ad-CaMKII-DN f TNF- /18S Ad-CaMKII-DN Supplementary Figure 14 Nature Medicine: doi:1.138/nm.417

15 Supplementary Table 1. Heart physiological data HR (bpm) LVIDd (mm) LVPWd (mm) LVIDs (mm) LVPWs (mm) EF (%) FS (%) HW/BW (mg/g) 44.8± ±.18.82±3 2.53± ± ± ± ± ± ±7.85±2 2.57±8 1.18±5 68.4± ± ±.37 p value Values are mean s.e.m.; n = 1, Student s t test. HR, heart rate; LVID, left ventricle internal diameter; LVPW, left ventricle posterior wall thickness; EF, ejection fraction; FS, fraction shortening; HW/BW, heart weight/body weight; d, diastolic. s, systolic.. Nature Medicine: doi:1.138/nm.417

16 Supplemental Figure Legends Supplementary Figure 1. Genotyping of mice and experimental protocols for in vivo studies. (a) PCR genotyping of, Ripk3 +/, and mice. (b,c) Acute (b) and chronic (c) in vivo I/R in mouse hearts (3-min ischemia followed by 4-h or 8-week reperfusion, respectively). (d,e) Acute (2 mg/kg, i.p.) (d) and chronic treatment (5 mg/kg, i.p. weekly for 4 weeks) of mice (e). Supplementary Figure 2. Chronic I/R- and -induced cardiac fibrosis and remodeling are reduced in mice. (a,b) Averaged mrna levels of collagen I (a) and III (b) assessed by real-time PCR in the hearts of and mice with sham surgery or 3-min cardiac ischemia followed by 8-week reperfusion (n = 1). (c) Serum LDH concentrations in and mice 4 weeks after the final or vehicle injection (n = 11). (d) Representative photomicrographs of Masson's trichrome-stained sections from the hearts of and mice with or without treatment (5 mg/kg, i.p. weekly for 4 weeks) (scale bar, 1 µm). (e) Cardiac contractile function (EF, ejection fraction; FS, fractional shortening) and geometry (LVPWs, systolic left ventricular posterior wall thickness; IVSs, systolic interventricular septum thickness) assayed by echocardiography in and mice 4 weeks after the final or vehicle injection (n = 19 for vehicle, n = 11 for, n = 15 for vehicle, n = 11 for ). Data are mean s.e.m., p <1, one-way ANOVA. Nature Medicine: doi:1.138/nm.417

17 Supplementary Figure 3. Upregulation of RIP3 induced by and I/R (or H/R) in cultured cardiomyocytes and in vivo. (a) Averaged RIP3 mrna levels assayed by real-time PCR in cultured cardiomyocytes treated with at different concentrations for 24 h (n = 12). (b) Typical western blots and averaged RIP3 protein levels in cardiomyocytes treated with at different concentrations for 24 h (n = 3). (c) Averaged RIP3 mrna levels assayed by real-time PCR in NRVMs subjected to hypoxia/reoxygenation (H/R) (n = 8 for control, n = 9 for H/R). (d) Typical western blots and averaged RIP3 protein levels in NRVMs with and without H/R (n = 7). (e) Representative immunostaining for RIP3 in mouse hearts 3 days after a single treatment (2 mg/kg, i.p.) or vehicle. (f) Representative photomicrographs of immunostaining for RIP3 in normal and ischemic areas from rat hearts subjected to I/R injury (45-min ischemia followed by 24-h reperfusion). Scale bar, 1 µm. Data are mean s.e.m., p <1 vs control group. In a,b, one-way ANOVA; in c,d, Student s t test. Supplementary Figure 4. RIP3-mediated cardiomyocyte necroptosis is independent of RIP1 or MLKL. (a) Averaged data showing the expression of RIP1 in cells transfected with scrambled or RIP1 sirnas (n = 3). Representative examples are shown in Fig. 3c. (b) Cell viability indexed by cellular ATP content in NRVMs infected with Ad-β-gal or with or without Nec1 treatment (3 μm) (n = 16 for vehicle, n = 19 for Nec1). (c) Cell viability indexed by cellular ATP content in Nature Medicine: doi:1.138/nm.417

18 cardiomyocytes subjected to H/R with or without Nec1 pretreatment (3 μm) (n = 22). (d) Averaged data showing the expression of MLKL in cells infected with scrambled or MLKL sirnas (n = 3). Representative examples are shown in Fig. 3e. Data are mean s.e.m., p <1, one-way ANOVA. NS, not significant. Supplementary Figure 5. Inhibition of CaMKII with KN-93 alleviates I/R- and -induced cardiomyocyte necrosis. (a,b) The experimental protocol for KN-93 treatment of cardiac injury induced by I/R (a) or treatment (b). (c) Viability of cells treated with vehicle or KN-93 (5 μm) in the presence or absence of H/R (n = 12 for vehicle, n = 18 for KN-93). (d) Viability of cells treated with vehicle or KN-93 (5 μm) in response to treatment (1 μm) (n = 9 for vehicle, n = 7 for ). (e) Viability of cells treated with vehicle or KN-93 (5 μm) and infected with Ad-β-gal or (n = 12 for vehicle, n = 15 for KN-93). Data are mean s.e.m., p <1, one-way ANOVA. Supplementary Figure 6. Co-localization of RIP3 and CaMKII in the hearts. (a) Representative immunofluorescent confocal microscopic images of HA-tagged RIP3 and myc-tagged CaMKII in cultured cardiomyocytes co-infected with and Ad-CaMKII with or without H/R challenge. Scale bars, 1 m. Note that H/R markedly enhanced the co-localization of RIP3 and CaMKII. (b) Representative immunofluorescent confocal microscopic images of RIP3 and CaMKII in mouse hearts subjected to sham or I/R surgery (3-min cardiac ischemia followed by 4-h Nature Medicine: doi:1.138/nm.417

19 reperfusion). The heart from a mouse (bottom) served as a negative control. Scale bar is 2 m. (c) Representative immunofluorescent confocal microscopic images of RIP3 and CaMKII in mouse hearts with or without treatment (2 mg/kg, i.p.). Scale bar is 2 m. Note that both I/R and treatment increased the co-localization of RIP3 and CaMKII in myocardium in vivo. Supplementary Figure 7. Kinase activity is required for RIP3-induced CaMKII activation and cardiomyocyte necroptosis. (a) Typical western blots and averaged data showing the phosphorylation of CaMKII (Thr287) in cultured NRVMs infected with Ad-β-gal,, or -K51A (a kinase-defective mutant of RIP3) (n = 4). (b,c) Cell viability indexed by cellular ATP content (b) and LDH concentration in the culture medium (c) of NRVMs infected with Ad-β-gal,, or K51A (MOI 2; n = 2). Data are mean s.e.m., *p <5, p <1, one-way ANOVA. Supplementary Figure 8. mptp plays an essential role in RIP3-mediated cardiomyocyte necroptosis. (a) Typical western blots and averaged data to show the expression of CypD, a key modulator of mptp, in NRVMs transfected with scrambled or CypD sirnas (n = 3). (b) Cell viability indexed by cellular ATP content and LDH concentration in the culture medium of NRVMs infected with or in the presence or absence of CypD sirnas (n = 2). (c e) Representative photomicrographs (c), average fluorescence intensity (d) and percentage of Nature Medicine: doi:1.138/nm.417

20 TMRM-positive area to total cell area (e) of NRVMs subjected to TMRM staining with or infection for 48 h (the data were from 5 independent experiments; for panels d and e, the averaged data were obtained from more than 5 cells for each group). (f,g) Relative fluorescence intensity of JC-1 staining of isolated myocardial mitochondria from perfused and mouse hearts subjected to I/R (3-min cardiac ischemia followed by 1-h reperfusion) (f) or from and mice 1 week after administration of (2 mg/kg, i.p.) (g) (n = 1). Scale bar, 1 m. Data are mean ± s.e.m., * p <5, p <1, in f,g, Student s t test; in the other panels, one-way ANOVA. Supplementary Figure 9. CaMKII is required for RIP3-induced depolarization of the mitochondrial membrane potential ( m ) in cardiomyocytes. (a c) Representative photomicrographs of TMRM staining (a), average fluorescence intensity (b), and percentage of TMRM-positive area to total cell area (c) of NRVMs infected by, or -K51A (n = 4). (d f) Representative micrographs of TMRM staining (d), averaged fluorescence intensity (e), and percentage of TMRM-positive area to total cell area (f) of NRVMs infected with or in the presence or absence of CaMKII inhibition by Ad-CaMKII-DN (n = 5). Scale bar, 1 m. Data are mean ± s.e.m., p <1, one-way ANOVA. Supplementary Figure 1. ROS are required for RIP3-induced cardiomyocyte Nature Medicine: doi:1.138/nm.417

21 necroptosis. (a) Typical western blots and averaged data showing the expression of Nox2 in cultured cardiomyocytes transfected with scrambled or Nox2 sirnas (n = 3). (b) Cell viability indexed by cellular ATP content in cells infected with Ad-β-gal or with or without Nox2 knockdown (n = 15). (c) Cell viability indexed by cellular ATP content in cells infected with Ad-β-gal or in the presence or absence of Tiron (1 mm) (n = 24 for, n = 16 for ). (d) Representative photomicrographs and averaged data of ROS production indexed by DHE (dihydroethidium) staining in heart sections from and mice treated once with (2 mg/kg i.p.; scale bar,.3 mm) (n = 4). (e) Typical western blots and averaged data showing the oxidation of CaMKII in and mouse hearts treated once with (2 mg/kg i.p.) (n = 4). (f) Typical western blots showing the expression of PYGL, GLUD1 and GLUL in cultured cardiomyocytes transfected with scrambled, PYGL, GLUD1 or GLUL sirnas (n = 3). (g) Representative photomicrographs and averaged data of ROS production assayed by DCF (CM-H2DCFDA) fluorescence intensity in cultured NRVMs infected with or (MOI 2) for 48 h in the presence or absence of gene silencing by PYGL, GLUD1 or GLUL sirnas (n = 12). (h) Representative photomicrographs and averaged data of ROS production assayed by DCF fluorescence intensity in cultured NRVMs infected with or (MOI 2) for 48 h with or without CaMKII inhibition by Ad-CaMKII-DN (n = 15). Scale bar, 1 m. Data are mean s.e.m., *p <5, p <1 vs other groups (d,e), vs scrambled group (g), or as indicated (other panels), one-way ANOVA. Nature Medicine: doi:1.138/nm.417

22 Supplementary Figure 11. RIP3 deficiency abolishes chronic I/R-induced cardiomyocyte apoptosis. Representative photomicrographs and averaged data of TUNEL staining in cardiac sections from and mice subjected to long-term I/R injury (3-min cardiac ischemia followed by 8 weeks of reperfusion) (n = 1). Data are mean s.e.m.. p <1, Student s t test. Scale bar, 2 m. Supplementary Figure 12. RIP3 deficiency protects cardiomyocytes against -induced apoptosis. (a,b) Representative photomicrographs and averaged data of TUNEL staining in cardiac sections from and mice subjected to acute treatment (2 mg/kg, i.p.) (a) or chronic treatment (5 mg/kg, i.p. weekly for 4 weeks) (b) (n = 1 for each group). Data are mean s.e.m.. p <1, Student s t test. Scale bar, 2 m. Supplementary Figure 13. RIP3 is required for - and I/R-induced myocardial inflammation. (a d) Averaged interleukin-6 (IL-6) and TNF- mrna levels assayed by real-time PCR in the hearts of and mice subjected to treatment (2 mg/kg for 1 week) (a,b) or I/R injury (3-min cardiac ischemia followed by 24 h of reperfusion) (c,d) (n = 1 for sham and vehicle groups, n = 12 for I/R and groups). (e,f) Representative photomicrographs and averaged numbers of the CD3-positive cells in the hearts of and mice subjected to treatment (2 mg/kg for 1 week) (e) or I/R (3-min cardiac ischemia followed by 24 h of reperfusion) (f) (n = 1 for sham and vehicle groups, n = 12 for I/R and groups). Nature Medicine: doi:1.138/nm.417

23 The arrows indicated CD-3 positive cells. Data are mean ± s.e.m., p <1, one-way ANOVA. Supplementary Figure 14. RIP3-induced expression of inflammatory factors in the cardiomyocytes is mediated by activation of CaMKII independently of RIP1. (a,b) Averaged IL-6 (a) and TNF- (b) mrna levels assayed by real-time PCR in cardiomyocytes infected with or (MOI 2) for 48 h with or without Nec1 treatment (3 μm) (n = 1). (c,d) Averaged IL-6 (c) and TNF- (d) mrna levels in cardiomyocytes infected with or (MOI 2) for 48 h in the presence or absence of RIP1 sirnas (n = 8). (e,f) Averaged IL-6 (e) and TNF- (f) mrna levels assayed by real-time PCR in the cardiomyocytes infected with or (MOI 2) for 48 h with or without CaMKII inhibition by Ad-CaMKII-DN (n = 15). Data are mean s.e.m.. p <1, one-way ANOVA. NS, not significant. Nature Medicine: doi:1.138/nm.417

Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained

Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with

More information

Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W

Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W A Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 Tcf21 MCM ; R26 mtmg TAC 2W Tcf21 MCM ; R26 mtmg TAC 8W B Postn MCM ; R26 mtmg Sham GFP Col 1/3 Postn MCM ; R26 mtmg TAC 2W Postn MCM ; R26 mtmg TAC 8W Supplementary

More information

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated

Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate

More information

Control. csarnt -/- Cre, f/f

Control. csarnt -/- Cre, f/f ody weight (g) A re,f/f re x f/f f/+ re, f/+ re,f/+ f/f x f/f f/+ cs -/- re, f/f re f/f re, f/f Normal chow Tamoxifen Tamoxifen Tamoxifen W 4W re f/f re, re/ff f/f re f/f re, re/ff f/f Normal chow Tamoxifen

More information

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC

Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3

More information

Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous

Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous Supplementary Figure 1. Spatial distribution of LRP5 and β-catenin in intact cardiomyocytes. (a) and (b) Immunofluorescence staining of endogenous LRP5 in intact adult mouse ventricular myocytes (AMVMs)

More information

E10.5 E18.5 P2 10w 83w NF1 HF1. Sham ISO. Bmi1. H3K9me3. Lung weight (g)

E10.5 E18.5 P2 10w 83w NF1 HF1. Sham ISO. Bmi1. H3K9me3. Lung weight (g) Myociyte cross-sectional Relative mrna levels Relative levels Relative mrna levels Supplementary Figures and Legends a 8 6 4 2 Ezh2 E1.5 E18.5 P2 1w 83w b Ezh2 p16 amhc b-actin P2 43w kd 37 86 16 wt mouse

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION a c e doi:10.1038/nature10407 b d f Supplementary Figure 1. SERCA2a complex analysis. (a) Two-dimensional SDS-PAGE gels of SERCA2a complexes. A silver-stained SDSPAGE gel is shown, which reveals a 12 kda

More information

BNP mrna expression in DR and DS rat left ventricles (n = 5). (C) Plasma norepinephrine

BNP mrna expression in DR and DS rat left ventricles (n = 5). (C) Plasma norepinephrine Kanazawa, et al. Supplementary figure legends Supplementary Figure 1 DS rats had congestive heart failure. (A) DR and DS rat hearts. (B) QRT-PCR analysis of BNP mrna expression in DR and DS rat left ventricles

More information

Supplemental Table 1. Echocardiography Control (n=4)

Supplemental Table 1. Echocardiography Control (n=4) Supplemental Table 1. Echocardiography (n=4) Mlc2v cre/+ ; DNMAML (n=4) LVIDd, mm 3.9±0.3 4.3±0.3 LVIDs, mm 2.6±0.4 2.9±0.2 d, mm 0.72±0.06 0.75±0.1 LVPWd, mm 0.72±0.06 0.77±0.11 FS, % 33±6 33±1 EF, %

More information

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null

More information

Supplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times.

Supplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times. Supplemental Figure 1. (A) Western blot for the expression of RIPK1 in HK-2 cells treated with or without LPS (1 µg/ml) for indicated times. Western blots shown are representative results from 3 independent

More information

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae

More information

Serum cytokine levels in control and tumor-bearing male and female mice at day 15.

Serum cytokine levels in control and tumor-bearing male and female mice at day 15. Supplementary Table 1. Serum cytokine levels in control and tumor-bearing male and female mice at day 15. Male Female Cytokine Control C-26 Control C-26 IL-1β 2.0 ± 0.8 9.6 ± 1.5* 1.8 ± 0.2 6.8 ± 1.4*

More information

Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice.

Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Supplementary Figures: Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice. Male apoe -/- mice were fed a high-fat diet for 8 weeks, and given PBS (model group) or

More information

Probe. Hind III Q,!&#12?R'!! /0!!!!D1"?R'! vector. Homologous recombination

Probe. Hind III Q,!&#12?R'!! /0!!!!D1?R'! vector. Homologous recombination Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!&#1?R'!!

More information

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian

More information

Fetal gene upregulation by 1-wk TAC is significantly increased in mice lacking RGS2.

Fetal gene upregulation by 1-wk TAC is significantly increased in mice lacking RGS2. 3562-RG-1 Supplementary Figure 1 Fetal gene upregulation by 1-wk is significantly increased in mice lacking RGS2. ANP(Nppa) /BNP(Nppb) A-type and B-type natriuretic peptide; β-mhc (Myh7) beta myosin heavy

More information

Kidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI

Kidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI a e Na V 1.5 Ad-LacZ Ad- 110KD b Scn5a/ (relative to Ad-LacZ) f 150 100 50 0 p = 0.65 Ad-LacZ Ad- c Heart Lung Kidney Spleen 110KD d fl/fl c -/- DAPI 20 µm Na v 1.5 250KD fl/fl Rabbit IgG DAPI fl/fl Mouse

More information

Hearts were fixed in 4% paraformaldehyde (ph 7.4) overnight, embedded in paraffin, and

Hearts were fixed in 4% paraformaldehyde (ph 7.4) overnight, embedded in paraffin, and SUPPLEMENTAL MATERIAL Supplemental Methods: Histology of Heart Hearts were fixed in 4% paraformaldehyde (ph 7.4) overnight, embedded in paraffin, and serially sectioned into 5-µm slices. Standard hematoxylin

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

Supplementary Figures Supplementary Figure 1. Development of the camp biosensor targeted to the SERCA2a microdomain.

Supplementary Figures Supplementary Figure 1. Development of the camp biosensor targeted to the SERCA2a microdomain. Supplementary Figures Supplementary Figure 1. Development of the camp biosensor targeted to the SERCA2a microdomain. A B C (A) Schematic representation of the new constructs designed for local camp imaging.

More information

Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration

Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration The Harvard community has made this article openly available. Please

More information

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage

More information

Supplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.

Supplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model. A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth

More information

Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells

Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of

More information

SUPPLEMENTARY RESULTS

SUPPLEMENTARY RESULTS SUPPLEMENTARY RESULTS Supplementary Table 1. hfpr1- Flpln-CHO hfpr2-flpln-cho pec 50 E max (%) Log( /K A) Log( /K A) N pec 50 E max (%) Log( /K A) Log( /K A) n ERK1/2 phosphorylation fmlp 9.0±0.6 80±7

More information

Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin

Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin Supplementary Figure 1. Baf60c and baf180 are induced during cardiac regeneration in zebrafish. RNA in situ hybridization was performed on paraffin sections from sham-operated adult hearts (a and i) and

More information

SUPPLEMENTARY LEGENDS...

SUPPLEMENTARY LEGENDS... TABLE OF CONTENTS SUPPLEMENTARY LEGENDS... 2 11 MOVIE S1... 2 FIGURE S1 LEGEND... 3 FIGURE S2 LEGEND... 4 FIGURE S3 LEGEND... 5 FIGURE S4 LEGEND... 6 FIGURE S5 LEGEND... 7 FIGURE S6 LEGEND... 8 FIGURE

More information

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β

Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1 Treatment with both Sema6D and Plexin-A1 sirnas induces the phenotype essentially identical to that induced by treatment with Sema6D sirna alone or Plexin-A1 sirna alone. (a,b) The cardiac tube

More information

Supplemental Figure I

Supplemental Figure I Supplemental Figure I Kl ( mmol/l)-induced Force orta M (mn) 1 (mn) 1 Supplemental Figure I. Kl-induced contractions. and, Kl ( mmol/l)-induced contractions of the aorta () and those of mesenteric arteries

More information

Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus

Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-

More information

Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS

Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS nucleotide sequences (a, b) or amino acid sequences (c) from

More information

Supplementary Material

Supplementary Material Supplementary Material Induction of myocardial infarction Mice were anesthetized by intraperitoneal injection of pentobarbital (7 mg/kg). In the supine position, endotracheal intubation was performed.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Supplementary Figure 1. Long-term protection studies. 45 minutes of ischemia was induced in wild type (S1pr2 +/+ ) and S1pr2 -/- by MCAO. A) 5 days later brains were harvested

More information

A Long-Term and Slow-Releasing Hydrogen Sulfide Donor Protects against Myocardial. Ischemia/Reperfusion Injury

A Long-Term and Slow-Releasing Hydrogen Sulfide Donor Protects against Myocardial. Ischemia/Reperfusion Injury Supporting Information A Long-Term and Slow-Releasing Hydrogen Sulfide Donor Protects against Myocardial Ischemia/Reperfusion Injury Xiaotian Sun 1 *, Wenshuo Wang 2, Jing Dai 3, Sheng Jin 4, Jiechun Huang

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nature11429 S1a 6 7 8 9 Nlrc4 allele S1b Nlrc4 +/+ Nlrc4 +/F Nlrc4 F/F 9 Targeting construct 422 bp 273 bp FRT-neo-gb-PGK-FRT 3x.STOP S1c Nlrc4 +/+ Nlrc4 F/F casp1

More information

In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell

In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell Supplementary Methods BrdU incorporation in vivo In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell proliferation in the heart. Mice were subjected to LI-TAC, and 5 days later

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis

More information

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript.

Additional methods appearing in the supplement are described in the Experimental Procedures section of the manuscript. Supplemental Materials: I. Supplemental Methods II. Supplemental Figure Legends III. Supplemental Figures Supplemental Methods Cell Culture and Transfections for Wild Type and JNK1-/-,JNK2-/- MEFs: The

More information

Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al

Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Material Rescue of mutant rhodopsin traffic by metformin-induced AMPK activation accelerates photoreceptor degeneration Athanasiou et al Supplementary Figure 1. AICAR improves P23H rod opsin

More information

Genetic ablation of Acp1 (Lmptp) in mice prevents heart failure

Genetic ablation of Acp1 (Lmptp) in mice prevents heart failure Genetic ablation of Acp1 (Lmptp) in mice prevents heart failure Coralie Poizat, Ph.D. Director, Cardiovascular Research Program KFSHRC-Riyadh Saudi Heart Failure Working Group Jeddah, 5 December 2015 Cardiovascular

More information

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was

Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin

More information

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a

(A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and a Supplementary figure legends Supplementary Figure 1. Expression of Shh signaling components in a panel of gastric cancer. (A) RT-PCR for components of the Shh/Gli pathway in normal fetus cell (MRC-5) and

More information

Expanded View Figures

Expanded View Figures Shao-Ming Shen et al Role of I in MT of cancers MO reports xpanded View igures igure V1. nalysis of the expression of I isoforms in cancer cells and their interaction with PTN. RT PR detection of Ish and

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Figure S1 Induction of non-apoptotic death of SV40-transformed and primary DKO MEFs, and DKO thymocytes. (A-F) STS-induced non-apoptotic death of DKO MEF. (A, B) Reduced viability of DKO MEFs after exposure

More information

Nature Immunology doi: /ni.3268

Nature Immunology doi: /ni.3268 Supplementary Figure 1 Loss of Mst1 and Mst2 increases susceptibility to bacterial sepsis. (a) H&E staining of colon and kidney sections from wild type and Mst1 -/- Mst2 fl/fl Vav-Cre mice. Scale bar,

More information

Supplementary Information File

Supplementary Information File Supplementary Information File Supplementary Table 1. List of synthesized sirna sequences for target genes sirna Species Sequence Ctrl sirna mouse sense 5 -UUCUCCGAACGUGUCACGUTT-3 Antisense 5 -ACGUGACACGUUCGGAGAATT-3

More information

Supplementary Fig. 1. The Brown Norway rat has higher coronary flow compared to other rat strains. Publically available data for coronary flow

Supplementary Fig. 1. The Brown Norway rat has higher coronary flow compared to other rat strains. Publically available data for coronary flow Supplementary Fig. 1. The Brown Norway rat has higher coronary flow compared to other rat strains. Publically available data for coronary flow measured ex vivo on Langendorff apparatus under intrinsic

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10188 Supplementary Figure 1. Embryonic epicardial genes are down-regulated from midgestation stages and barely detectable post-natally. Real time qrt-pcr revealed a significant down-regulation

More information

Plasma exposure levels from individual mice 4 hours post IP administration at the

Plasma exposure levels from individual mice 4 hours post IP administration at the Supplemental Figure Legends Figure S1. Plasma exposure levels of MKC-3946 in mice. Plasma exposure levels from individual mice 4 hours post IP administration at the indicated dose mg/kg. Data represent

More information

Sean Davidson. The Hatter Cardiovascular Institute University College London, UK

Sean Davidson. The Hatter Cardiovascular Institute University College London, UK Key pathways to ischemia-reperfusion injury Sean Davidson The Hatter Cardiovascular Institute University College London, UK Outline What is ischaemia-reperfusion injury? What causes ischaemia-reperfusion

More information

Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at

Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).

More information

Supporting Information. FADD regulates NF-кB activation and promotes ubiquitination of cflip L to induce. apoptosis

Supporting Information. FADD regulates NF-кB activation and promotes ubiquitination of cflip L to induce. apoptosis 1 2 Supporting Information 3 4 5 FADD regulates NF-кB activation and promotes ubiquitination of cflip L to induce apoptosis 6 7 Kishu Ranjan and Chandramani Pathak* 8 9 Department of Cell Biology, School

More information

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada

More information

Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk

Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk -/- mice were stained for expression of CD4 and CD8.

More information

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces

More information

Nature Genetics: doi: /ng Supplementary Figure 1. Parameters and consequences of mononuclear cardiomyocyte frequency.

Nature Genetics: doi: /ng Supplementary Figure 1. Parameters and consequences of mononuclear cardiomyocyte frequency. Supplementary Figure 1 Parameters and consequences of mononuclear cardiomyocyte frequency. (a) Correlation of the frequency of mononuclear cardiomyocytes to the frequency of cardiomyocytes with three or

More information

Supplementary Figure 1:

Supplementary Figure 1: Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering

More information

Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with

Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).

More information

Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections

Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast

More information

Supplementary Figure 1: Fn14 is upregulated in the epidermis and dermis of mice

Supplementary Figure 1: Fn14 is upregulated in the epidermis and dermis of mice Supplementary Figure 1: Fn14 is upregulated in the epidermis and dermis of mice undergoing AD- and psoriasis-like disease. Immunofluorescence staining for Fn14 (green) and DAPI (blue) in skin of naïve

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM.

Nature Biotechnology: doi: /nbt Supplementary Figure 1. Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM. Supplementary Figure 1 Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM. (a-c) Heterozygous c.216ga mice displayed normal hair bundle morphology at P18. (d-i) Disorganized hair bundles

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 10.1038/nature06994 A phosphatase cascade by which rewarding stimuli control nucleosomal response A. Stipanovich*, E. Valjent*, M. Matamales*, A. Nishi, J.H. Ahn, M. Maroteaux, J. Bertran-Gonzalez,

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein

More information

(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment

(Stratagene, La Jolla, CA) (Supplemental Fig. 1A). A 5.4-kb EcoRI fragment SUPPLEMENTAL INFORMATION Supplemental Methods Generation of RyR2-S2808D Mice Murine genomic RyR2 clones were isolated from a 129/SvEvTacfBR λ-phage library (Stratagene, La Jolla, CA) (Supplemental Fig.

More information

Page 39 of 44. 8h LTA & AT h PepG & AT h LTA

Page 39 of 44. 8h LTA & AT h PepG & AT h LTA Page 39 of 44 Fig. S1 A: B: C: D: 8h LTA 8h LTA & AT7519 E: F: 8h PepG G: 8h PepG & AT7519 Fig. S1. AT7519 overrides the survival effects of lipoteichoic acid (LTA) and peptidoglycan (PepG). (A) Human

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI:.38/ncb2822 a MTC02 FAO cells EEA1 b +/+ MEFs /DAPI -/- MEFs /DAPI -/- MEFs //DAPI c HEK 293 cells WCE N M C P AKT TBC1D7 Lamin A/C EEA1 VDAC d HeLa cells WCE N M C P AKT Lamin A/C EEA1 VDAC Figure

More information

Supplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation

Supplementary information. The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic. Spindle Orientation Supplementary information The Light Intermediate Chain 2 Subpopulation of Dynein Regulates Mitotic Spindle Orientation Running title: Dynein LICs distribute mitotic functions. Sagar Mahale a, d, *, Megha

More information

Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were

Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were Supplementary Figure 1. Validation of astrocytes. Primary astrocytes were separated from the glial cultures using a mild trypsinization protocol. Anti-glial fibrillary acidic protein (GFAP) immunofluorescent

More information

Supplemental Figures:

Supplemental Figures: Supplemental Figures: Figure 1: Intracellular distribution of VWF by electron microscopy in human endothelial cells. a) Immunogold labeling of LC3 demonstrating an LC3-positive autophagosome (white arrow)

More information

A. Generation and characterization of Ras-expressing autophagycompetent

A. Generation and characterization of Ras-expressing autophagycompetent Supplemental Material Supplemental Figure Legends Fig. S1 A. Generation and characterization of Ras-expressing autophagycompetent and -deficient cell lines. HA-tagged H-ras V12 was stably expressed in

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figure 1. Behavioural effects of ketamine in non-stressed and stressed mice. Naive C57BL/6 adult male mice (n=10/group) were given a single dose of saline vehicle or ketamine (3.0 mg/kg,

More information

Supplementary Figure 1. DJ-1 modulates ROS concentration in mouse skeletal muscle.

Supplementary Figure 1. DJ-1 modulates ROS concentration in mouse skeletal muscle. Supplementary Figure 1. DJ-1 modulates ROS concentration in mouse skeletal muscle. (a) mrna levels of Dj1 measured by quantitative RT-PCR in soleus, gastrocnemius (Gastroc.) and extensor digitorum longus

More information

Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC

Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA

More information

293T cells were transfected with indicated expression vectors and the whole-cell extracts were subjected

293T cells were transfected with indicated expression vectors and the whole-cell extracts were subjected SUPPLEMENTARY INFORMATION Supplementary Figure 1. Formation of a complex between Slo1 and CRL4A CRBN E3 ligase. (a) HEK 293T cells were transfected with indicated expression vectors and the whole-cell

More information

Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells

Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Supplementary Figure S1: Defective heterochromatin repair in HGPS progeroid cells Immunofluorescence staining of H3K9me3 and 53BP1 in PH and HGADFN003 (HG003) cells at 24 h after γ-irradiation. Scale bar,

More information

microrna-200b and microrna-200c promote colorectal cancer cell proliferation via

microrna-200b and microrna-200c promote colorectal cancer cell proliferation via Supplementary Materials microrna-200b and microrna-200c promote colorectal cancer cell proliferation via targeting the reversion-inducing cysteine-rich protein with Kazal motifs Supplementary Table 1.

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Figure 1 DOT1L regulates the expression of epithelial and mesenchymal markers. (a) The expression levels and cellular localizations of EMT markers were confirmed by

More information

SUPPLEMENTARY FIGURES AND TABLE

SUPPLEMENTARY FIGURES AND TABLE SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).

More information

Supporting Information

Supporting Information Supporting Information Kuroda et al. 10.1073/pnas.1002178107 SI Methods Monoclonal Antibodies Against Nox4. Generation of the anti-nox4 mouse monoclonal antibody (3D2), which detects Nox4 and does not

More information

Supplementary Figure 1.

Supplementary Figure 1. Supplementary Figure 1. Visualization of endoplasmic reticulum-mitochondria interaction by in situ proximity ligation assay. A) Illustration of targeted proteins in mitochondria (M), endoplasmic reticulum

More information

Supplementary Figure 1

Supplementary Figure 1 A B D Relative TAp73 mrna p73 Supplementary Figure 1 25 2 15 1 5 p63 _-tub. MDA-468 HCC1143 HCC38 SUM149 MDA-468 HCC1143 HCC38 SUM149 HCC-1937 MDA-MB-468 ΔNp63_ TAp73_ TAp73β E C Relative ΔNp63 mrna TAp73

More information

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence IL-1α Forward primer 5 -CAAGATGGCCAAAGTTCGTGAC-3' Reverse primer 5 -GTCTCATGAAGTGAGCCATAGC-3 IL-1β

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:1.138/nature9814 a A SHARPIN FL B SHARPIN ΔNZF C SHARPIN T38L, F39V b His-SHARPIN FL -1xUb -2xUb -4xUb α-his c Linear 4xUb -SHARPIN FL -SHARPIN TF_LV -SHARPINΔNZF -SHARPIN

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/9/439/ra78/dc1 Supplementary Materials for Small heterodimer partner mediates liver X receptor (LXR) dependent suppression of inflammatory signaling by promoting

More information

Supplementary Figure 1

Supplementary Figure 1 Combination index (CI) Supplementary Figure 1 2. 1.5 1. Ishikawa AN3CA Nou-1 Hec-18.5...2.4.6.8 1. Fraction affected (Fa) Supplementary Figure 1. The synergistic effect of PARP inhibitor and PI3K inhibitor

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/8/375/ra41/dc1 Supplementary Materials for Actin cytoskeletal remodeling with protrusion formation is essential for heart regeneration in Hippo-deficient mice

More information

Supplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation

Supplemental Information. Menin Deficiency Leads to Depressive-like. Behaviors in Mice by Modulating. Astrocyte-Mediated Neuroinflammation Neuron, Volume 100 Supplemental Information Menin Deficiency Leads to Depressive-like Behaviors in Mice by Modulating Astrocyte-Mediated Neuroinflammation Lige Leng, Kai Zhuang, Zeyue Liu, Changquan Huang,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2988 Supplementary Figure 1 Kif7 L130P encodes a stable protein that does not localize to cilia tips. (a) Immunoblot with KIF7 antibody in cell lysates of wild-type, Kif7 L130P and Kif7

More information

Angiotensin type 1a receptor-deficient mice develop diabetes-induced cardiac dysfunction, which is prevented by renin-angiotensin system inhibitors

Angiotensin type 1a receptor-deficient mice develop diabetes-induced cardiac dysfunction, which is prevented by renin-angiotensin system inhibitors Yong et al. Cardiovascular Diabetology 2013, 12:169 CARDIO VASCULAR DIABETOLOGY ORIGINAL INVESTIGATION Open Access Angiotensin type 1a receptor-deficient mice develop diabetes-induced cardiac dysfunction,

More information

Appendix Table of Contents. 1. Appendix Figure legends S1-S13 and Appendix Table S1 and S2. 2. Appendix Figures S1-S13

Appendix Table of Contents. 1. Appendix Figure legends S1-S13 and Appendix Table S1 and S2. 2. Appendix Figures S1-S13 Appendix Table of Contents. Appendix Figure legends S-S3 and Appendix Table S and S. Appendix Figures S-S3 . Appendix Figure legends S-S3 and Appendix Table S and S Appendix Figure S. Western blot analysis

More information

Activation of Nrf2 by the dengue virus causes an increase in CLEC5A, which enhances TNF-α production by mononuclear phagocytes

Activation of Nrf2 by the dengue virus causes an increase in CLEC5A, which enhances TNF-α production by mononuclear phagocytes Nrf2 mediates induced CLEC5A and TNFα Activation of Nrf2 by the dengue virus causes an increase in CLEC5A, which enhances TNFα production by mononuclear phagocytes YiLin Cheng 1,2, YeeShin Lin 1,2,3, ChiaLing

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information