Number of Differences from Species 1

Size: px
Start display at page:

Download "Number of Differences from Species 1"

Transcription

1 Molecular Evidence for Evolution Name: Pre Lab Activity: Genes code for amino acids, amino acids code for proteins and proteins build body structures. Therefore, one way to observe the relatedness of species is to examine their genetic sequences. Generally, the more similarity that exists in these species, the more likely species are to be related to each other. The amino acids below are found in the protein beta hemoglobin. This protein is generally 146 amino acids in length. To conserve space, only the amino acids where differences exist have been provided to you. Amino Acid Species 1 Species 2 Species 3 Species 4 Species 5 Number 1 Valine Valine Threonine Valine Valine 2 Histidine Histidine Leucine Histidine Histidine 4 Threonine Threonine Serine Threonine Threonine 5 Proline Proline Alanine Proline Glycine 8 Lysine Lysine Aspartic Acid Lysine Lysine 9 Serine Asparagine Alanine Serine Serine 10 Alanine Alanine Histidine Alanine Alanine 12 Threonine Threonine Threonine Threonine Alanine 13 Alanine Threonine Serine Alanine Alanine 21 Aspartic Acid Aspartic Acid Glutamic Acid Aspartic Acid Aspartic Acid 22 Glutamic Acid Glutamic Acid Lysine Glutamic Acid Glutamic Acid 33 Valine Leucine Valine Valine Valine 50 Threonine Serine Serine Threonine Threonine 52 Aspartic Acid Aspartic Acid Serine Aspartic Acid Aspartic Acid 56 Glycine Glycine Serine Glycine Serine 69 Glycine Glycine Serine Glycine Glycine 73 Aspartic Acid Aspartic Acid Glutamic Acid Aspartic Acid Aspartic Acid 76 Alanine Asparagine Histidine Alanine Alanine 87 Threonine Glutamine Glutamine Threonine Glutamine 104 Argenine Lysine Lysine Lysine Argenine 111 Valine Valine Serine Valine Valine 112 Cysteine Cysteine Alanine Cysteine Cysteine 113 Valine Valine Glutamic Acid Valine Valine 114 Leucine Leucine Serine Leucine Leucine 115 Alanine Alanine Glutamic Acid Alanine Alanine 116 Histidine Histidine Leucine Histidine Histidine 120 Lysine Lysine Histidine Lysine Lysine 121 Glycine Glycine Aspartic Acid Glycine Glycine 122 Phenylalanine Phenylalanine Lysine Phenylalanine Phenylalanine 123 Threonine Threonine Serine Threonine Threonine 125 Proline Glutamine Alanine Proline Glutamine 126 Valine Valine Valine Valine Leucine 130 Tyrosine Tyrosine Phenylalanine Tyrosine Tyrosine The old way of doing things was to count the differences between amino acids by hand and develop a phylogenic tree. For fun, compare the differences between species 1 and the other species and record it on the chart! Use the provided highlighter to count the number of differences that exist between species 1 and the other species. Record this information in the chart below. Species 2 Species 3 Species 4 Species 5 Number of Differences from Species 1 This method, while accurate and effective, is rather time consuming. It also only allows us to compare organisms to each other one at a time. 1

2 Lab Activity: The new method of doing things is to utilize the vast amount of information available on the Internet. Both of the sites you will use today access information available on the National Center for Biotechnology Information website. National Center for Biotechnology Information ( The National Center for Biotechnology Information is a website sponsored by the federal government. The goal of the site is to advance science and health by providing access to biomedical and genomic information. Pre-Lab Questions: 1. In today s activity you will compare the gene sequences between whales and different mammals. Two of the mammal groups you will compare whales to are the orders known as artiodactyls and perissodactyls. In our analysis today, we will look at the protein known as cytochrome b. What is the function of cytochrome b? When comparing species such as whales and other mammals, why do you think we use a protein like cytochrome b? Go to Google or some other Internet search engine. Next to each term, identify the key characteristic of each group-artiodactyls and perissodactyls. Then, in the spaces below each group, identify two examples of artiodactyls and two examples of perissodactyls. Artiodactyls (define): Perissodactyls(define): Examples: Examples: Part I Finding Sequences 2

3 1. Open the Internet and type the NCBI homepage into your browser. ( RIGHT HERE! 2. The aim of our investigation today is to compare the cytochrome b sequences among different mammal groups. In the box next to Search, click on the dropdown menu and select the Protein Database. In the box next to for type the phrase cytb Mammalia and click on the Search button (cytb is one of the server s abbreviations for cytochrome b). 3. Clicking on this page takes you to the results page. Each result lists a hyperlink to the protein as well as the scientific, Latin name of the organism from which the protein was obtained. As you scroll through the results, you will notice that there are upwards of 2,000 pages of entries for this particular protein. Approximately how many amino acids make up a complete, mammalian cytochrome b protein? 4. As you click through the result pages, you may notice there are proteins that are fragments and are much smaller in size than the complete proteins. You want to be careful NOT to select these organisms in your investigation. All protein samples you investigate should be the full size and listed as CYTB proteins. 3

4 5. To access each individual organism, you must click on the hyperlink for the organism. The first organism to come up in this example is Herpestes javanicus. Clicking on the blue hyperlink tells us that this organism is commonly known as: 6. This organism page has a great deal of information. In addition to the organism s taxonomy, it provides links to research conducted on the protein, and, important for our investigation, a copy of the protein sequence for the organism is found at the bottom of the page. Top of page Bottom of page Taxonomic Information Protein Sequence 4

5 7. The mongoose, while an interesting subject for investigation, is not a species that we want to investigate in full detail today. The topic of our investigation, you may recall is to focus on the evolution of whales. Click Back in your browser to return to the mammal sequence page. Once on the page, you can narrow the search even further by searching the protein database for Cetacea, (the mammalian order to which whales belong). 8. The first hyperlink is for the whale, Balaenoptera musculus, commonly known as the blue whale. The information provided is organized in the exact same way as the page you viewed earlier. Our interest is in the amino acid sequence information. Although, as you saw earlier, the amino acid sequence is listed at the bottom of the page, this format will be difficult for us to deal with when we conduct our analysis. The easier format can be found by clicking on the FASTA link found at the top of the page. Click on this FASTA link 5

6 9. On the FASTA sequence page, use your mouse to select and copy the sequence. This is shown for you below. 10. After you select and copy the information, open a Microsoft Word document and paste this information into your Word document. 11. Save your Word Document and modify your sequences so that they can be interpreted. To do so, you must remove any blank spaces from the headings so that the computer does not mistake letters for amino acids. In other words.. The sequence given for the blue whale in FASTA format looks like this: >gi ref NP_ CYTB_10457 cytochrome b [Balaenoptera musculus] MTNIRKTHPLMKIINDAFIDLPTPSNISSWWNFGSLLGLCLIVQILTGLFLAMHYTPDTMTAFSSVTHIC RDVNYGWVIRYLHANGASMFFICLYAHMGRGLYYGSHAFRETWNIGVILLFTVMATAFVGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIMALAIVHLIFLHETGSNNPTG IPSDMDKIPFHPYYTIKDILGALLLILTLLMLTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILVLALIPMLHTSKQRSMMFRPFSQFLFWVLVADLLTLTWIGGQPVEHPYVIV GQLASILYFLLILVLMPVTSLIENKLMKW If you tried to enter this into a sequencing program, all the letters would be interpreted as amino acids, and you would not be able to accurately compare species. To avoid this problem, you must modify the information you obtained. Thus, the blue whale should be entered as: >Blue.whale MTNIRKTHPLMKIINDAFIDLPTPSNISSWWNFGSLLGLCLIVQILTGLFLAMHYTPDTMTAFSSVTHIC RDVNYGWVIRYLHANGASMFFICLYAHMGRGLYYGSHAFRETWNIGVILLFTVMATAFVGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIMALAIVHLIFLHETGSNNPTG IPSDMDKIPFHPYYTIKDILGALLLILTLLMLTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILVLALIPMLHTSKQRSMMFRPFSQFLFWVLVADLLTLTWIGGQPVEHPYVIV GQLASILYFLLILVLMPVTSLIENKLMKW The greater than (>) symbol indicates that what comes next is a name. This means for a two or more word named organism, you must put a period in between words in the species name. For example, if you sequence a Blue Whale, you must modify its name to read as: >Blue.Whale 6

7 If you fail to do so, the program will begin to read the w-h-a-l-e (in whale) as amino acids!!! 12. Try out the sequencing for yourself. Use the program to find cytochrome b sequences for the following whales, marine mammals and possible land relations of whales. Find each organism s sequence by searching the protein database using the abbreviation of the protein (cytb) and the scientific name of the organism in quotation marks. Enter: cytb and the Scientific Name of the organism in this box. Be sure to double check your spelling for each scientific name, and make sure that you select a full copy of the cytochrome b protein (it should be approximately 378 amino acids in length). Organism Common Name Scientific Name Order Relationship to Whales Whale 1 Blue Whale Balaenoptera musculus Cetacea - Whale 2 Humpback Whale Megaptera novaeangliae Cetacea - Whale 3 Sperm Whale Physeter catodon Cetacea - Whale 4 Killer Whale Orcinus orca Cetacea - Manatee/Dugong 1 Dugong Dugong dugon Sirenia Manatee/Dugong 2 Caribbean Manatee Trichechus manatus Sirenia Seal Harbor Seal Phoca vitulina Carnivora Sea Lion California Sea Lion Zalophus californianus Carnivora Walrus Walrus Odobenus rosmarus Carnivora Sea Otter Sea Otter Enhydra lutris Carnivora Bear Polar Bear Ursus maritimus Carnivora Land Carnivore 1 Eurasian Wolf Canis lupus lupus Carnivora Land Carnivore 2 Dog Canis lupus familiaris Carnivora Artiodactyl 1 Hippopotamus Hippopotamus amphibius Artiodactyla Artiodactyl 2 Cow Bos taurus Artiodactyla Perissodactyl 1 Horse Equus caballus Perissodactyla Perissodactyl 2 Indian Rhinoceros Rhinoceros unicornis Perissodactyla Elephant 1 Asian Elephant Elephas maximus Proboscidea Elephant 2 African Elephant Loxodonta africana Proboscidea Fill in the first column entitled, Relationship towhales, by assigning a number 1-13 for each species in terms of how closely you believe they are related to whales. (The species that you think is most closely related to whales gets a 1, the next closest relative gets a 2, the next a 3, etc.) After modifying all of your sequences, be sure to save your Word Document!!! 7

8 Part II Sequence Alignments 13. A feature of the NCBI webpage is the Constraint Based Multiple Alignment Tool (COBALT). COBALT serves to use the resources of NCBI to compare sequences and put them into a progressive multiple alignment. From there, a simple phylogenic tree can be constructed from this alignment. Paste your sequences into this box. 14. The COBALT page asks you to enter protein ascensions, gis, or FASTA sequences. We have already compiled this information in the first part of this exercise. Return to your Word document that contains your cytochrome sequences. Select all of your sequences, Copy them and Paste them into the box where it indicates you should paste sequences. 15. The alignment itself takes several moments to run (more so today because we are all on the site at the same time). Once it has completed, it will show you the analysis that it ran between all species. The information provided will include information on things like number of amino acids in the protein and information about the similarities and differences that occur in the sequences. You can get the program to construct a phylogenetic tree by clicking on the Phylogenetic Tree hyperlink in the top right hand corner of the page. A phylogenetic tree shows the evolutionary relationship among various species that are believed to have a common ancestor. These trees also take in evolutionary time into consideration through the distances between sequences (or the leaves of the tree). 16. In the space below, copy the phylogram you created in today s class. 8

9 Analysis: How close were your predictions to your phylogram? Did you discover anything surprising about the relationship between whales and the other groups of mammals? If so, explain. The sequences you analyzed today were amino acid sequences. Would you expect to get the same results if you compared the DNA of these organisms instead of amino acids? Explain your response. In three or more sentences, use what you learned today to explain how protein similarity between species can be used to determine their evolutionary relationship. Sequences 9

10 10 >Blue.Whale MTNIRKTHPLMKIINDAFIDLPTPSNISSWWNFGSLLGLCLIVQILTGLFLAMHYTPDTMTAFSSVTHIC RDVNYGWVIRYLHANGASMFFICLYAHMGRGLYYGSHAFRETWNIGVILLFTVMATAFVGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIMALAIVHLIFLHETGSNNPTG IPSDMDKIPFHPYYTIKDILGALLLILTLLMLTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILVLALIPMLHTSKQRSMMFRPFSQFLFWVLVADLLTLTWIGGQPVEHPYVIV GQLASILYFLLILVLMPVTSLIENKLMKW >Humpback.Whale MTNIRKTHPLMKIINDTFIDLPTPSNISSWWNFGSLLGLCLIMQILTGLFLAMHYTPDTTTAFSSVTHIC RDVNYGWIIRYLHANGASMFFICLYAHMGRGLYYGSYAFRETWNIGVILLFTVMATAFVGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAIVHLIFLHETGSNNPTG IPSNMDKIPFHPYYTIKDTLGALLLILTLLMLTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILILAFIPMLHTSKQRSMMFRPFSQFLFWMLVADLLTLTWIGGQPVEHPYMIV GQLASILYFLLILVLMPMTSLIENKLMKW >Sperm.Whale MTNIRKSHPLMKIINNAFIDLPTPSNISSWWNFGSLLGLCLIMQILTGLFLAMHYTPDTTTAFSSITHIC RDVNYGWTIRYLHANGASMFFICLYTHMGRGWYYGSYIFQETWNVGMMLLITVMATAFVGYVLPWGQMSF WAATVITNLLSAIPYIGTTLVEWVWGGFSVDKATLTRFFTLHFILPFITLTLTMVHLLFLHETGSNNPTG IPSNMDKIPFHPYHTIKDTMGALLLILSLLTLTLFAPDLLGDPDNYTPANPLNTPTHIKPEWYFLFAYAI LRSVPNKLGGVLALLLSILILVFIPMLHTAKQRSMMFRPFSQFLFWTLIMDLLTLTWIGGQPVEHPYVTV GQLASILYFLLILILMPTASLIENKLLKW >Killer.Whale MTNIRKTHPLMKILNNAFIDLPTPSNISSWWNFGSLLGLCLITQILTGLLLAMHYTPDTSTAFSSVAHIC RDVNYGWFIRYLHANGASMFFICLYAHIGRSLYYGSYMFQETWNVGVLLLLAVMATAFVGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALAAVHLLFLHETGSNNPTG IPSNMDMIPFHPYHTIKDTLGALLLILTLLALTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAI LRSVPNKLGGVLALLLSILILIFIPMLQTSKQRSMMFRPFSQLLFWTLIADLLTLTWIGGQPVEHPYIIV GQLASILYFLLILVLMPTISLIENKLLKW >Dugong MTNIRKSHPLIKILNNSFIDLPTPVNISSWWNFGSLLGACLIIQILTGLFLAMHYTSDTLTAFSSVTHIC RDVNYGWIIRYLHANGASMFFLCLYAHIGRGIYYGSYLYPETWNIGIVLLLTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTNLVEWVWGGFSVDKATLTRFFALHFILPFIVTALVMVHLLFLHETGSNNPTG LISDSDKIPFHPYYSVKDLLGLFLLILVLLLLTLFSPDMLGDPDNYTPANPLNTPPHIKPEWYFLFRYAI LRSIPNKLGGVLALVLSILILALLPLLHTSKQRSLSFRPLSQCLFWILVADLITLTWIGGQPVEHPYIII GQLASILYFSIILIFMPIAGLIENHLLKW >Caribbean.Manatee MTNIRKSHPLIKILNDSFIDLPTPTNISSWWNFGSLLGACLIIQILTGLFLAMHYTSDTLTAFSSVAHIC RDVNYGWIIRYLHANGASMFFLCLYAHIGRGIYYGSYLYSETWNIGIILLLTIMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTNLVEWVWGGFSVDKATLTRFFALHFTLPFVVTALVTVHLLFLHETGSNNPTG LISDSDKIPFHPYYSIKDLLGLFLLILILLLPTLFSPDMLGDPDNYTPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALVLSILILALLPLLHTSKQRSLLFRPLSQCLFWILVTDLITLTWIGGQPVEHPYIVI GQLASILYFSIILIFMPIAGLIENHLLKW >Harbor.Seal MTNIRKTHPLMKIINNSFIDLPTPSNISAWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC RDVNYGWIIRYLHANGASMFFICLYMHVGRGLYYGSYTFTETWNIGIILLFTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYVGTDLVQWIWGGFSVDKATLTRFFAFHFILPFVVLALDAVHLLFLHETGSNNPSG IMSDSDKIPFHPYYTIKDILGALLLILVLTLLVLFSPDLLGDPDNYIPPNPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALVLSILVLAIMPLLHTSKQRGMMFRPISQCLFWFLVADLLTLTWIGGQPVEHPYITV GQLASILYFTILLVLMPIASIIENNILKW >California.Sea.Lion MTNIRKVHPLAKIINSSLIDLPTPSNISAWWNFGSLLAACLALQILTGLFLAMHYTSDTTTAFSSVTHIC RDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTLTETWNIGIILLFTIMATAFMGYVLPWGQMSF WGATVITNLLSAVPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFMASALVMVHLLFLHETGSNNPSG ISSDSDKIPFHPYYTIKDILGTLLLILTLMLLVMFSPDLLGDPDNYIPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILILAIIPLLHTSKQRGMMFRPISQCLFWLLVADLLTLTWIGGQPVEHPFITI GQLASILYFTILLVFMPIAGIIENNILKW >Walrus MTNIRKTHPLAKIINNTFIDLPTPSNISAWWNFGSLLATCLILQILTGLFLAMHYTSDTTTAFSSITHIC RDVNYGWIIRYMHANGASMFFICLYAHMGRGIYYGSYTLAETWNIGIVLLLTIMATAFMGYVLPWGQMSF WGATVITNLLSAIPYVGTDLVEWVWGGFSVDKATLTRFLALHFVLPFMALALTAVHLLFLHETGSNNPSG ILSDSDKIPFHPYYTIKDILGLIILILILMLLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALLLSILVLAIVPSLHTSKQRSMMFRPISQCLFWLLVADLITLTWIGGQPVEHPFIII GQLASILYFMILLVFMPIAGMIENSILKW >Sea.Otter MTNIRKTHPLTKIINNSFIDLPAPSNISAWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVAHIC RDVNYGWIIRYMHANGASMFFICLFLHVGRGLYYGSYMFSETWNIGIVLLFTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIISALAMIHLLFLHETGSNNPSG

11 11 IPSNSDKIPFHPYYTIKDILGALSLVLALTTLVLFSPDLLGDPDNYIPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALILSILILAIIPLLHTSKQRSMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFVVI GQLASILYFMILLVLMPITSIIENNLLKW >Polar.Bear MTNIRKTHPLAKIINNSFIDLPTPSNISAWWNFGSLLGVCLILQILTGLFLAMHYTSDTTTAFSSVTHIC RDVHYGWVIRYVHANGASMFFICLFMHVGRGLYYGSYLFSETWNIGIILLFTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFIILALAAVHLLFLHETGSNNPSG IPSDSDKIPFHPYYTIKDILGALLLTLALATLVLFSPDLLGDPDNYIPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALIFSILILALIPLLHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFIII GQLASILYFTILLVLMPIAGIIENNLLKW >Eurasian.Wolf MTNIRKTHPLAKIVNNSFIDLPAPSNISAWWNFGSLLGVCLILQILTGLFLAMHYTSDTATAFSSVTHIC RDVNYGWIIRYMHANGASMFFICLFLHVGRGLYYGSYVFMETWNIGIVLLFATMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAMVHLLFLHETGSNNPSG ITSDSDKIPFHPYYTIKDILGALLLLLILMSLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALVFSILILAFIPLLHTSKQRSMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFIII GQVASMLYFTILLILMPTVSVIENNLLKW >Dog MTNIRKTHPLAKIVNNSFIDLPAPSNISAWWNFGSLLGVCLILQILTGLFLAMHYTSDTATAFSSVTHIC RDVNYGWIIRYMHANGASMFFICLFLHVGRGLYYGSYVFMETWNIGIVLLFATMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAMVHLLFLHETGSNNPSG ITSDSDKIPFHPYYTIKDILGALLLLLILMSLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALVFSILILAFIPLLHTSKQRSMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFIII GQVASILYFTILLILMPTVSVIENNLLKW >Hippopotamus MTNIRKSHPLMKIINDAFVDLPAPSNISSWWNFGSLLGVCLILQILTGLFLAMHYTPDTLTAFSSVTHIC RDVNYGWVIRYMHANGASIFFICLFTHVGRGLYYGSHTFLETWNIGVILLLTTMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLTRFFAFHFILPFVITALAIVHLLFLHETGSNNPTG IPSNADKIPFHPYYTIKDILGILLLMTTLLTLTLFAPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALALSILILALIPMLHTSKQRSLMFRPLSQCLFWALIADLLTLTWIGGQPVEHPFIII GQVASILYFLLILVLMPVAGIIENKLLKW >Cow MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC RDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTG ISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITI GQLASILYFLLILVLMPTAGTIENKLLKW >Horse MTNIRKSHPLIKIINHSFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHIC RDVNYGWIIRYLHANGASMFFICLFIHVGRGLYYGSYTFLETWNIGIILLFTVMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALVVVHLLFLHETGSNNPSG IPSDMDKIPFHPYYTIKDILGLLLLILLLLTLVLFSPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALILSILILALIPTLHMSKQRSMMFRPLSQCVFWLLVADLLTLTWIGGQPVEHPYVII GQLASILYFSLILIFMPLASTIENNLLKW >Rhinoceros MTNIRKSHPLVKIINHSFIDLPTPSNISSWWNFGSLLGICLILQILTGLFLAMHYTPDTTTAFSSVTHIC RDVNYGWMIRYLHANGASMFFICLFIHVGRGLYYGSYTFLETWNIGIILLFTLMATAFMGYVLPWGQMSF WGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIILALAITHLLFLHETGSNNPSG IPSNMDKIPFHPYYTIKDILGALLLILVLLILVLFFPDILGDPDNYTPANPLSTPPHIKPEWYFLFAYAI LRSIPNKLGGVLALAFSILILLLIPYLHTSKQRSMMFRPLSQCMFWLLVADLLTLTWIGGQPVEHPFIII GQLASILYFSLILVLMPLAGIIENNLLKW >Indian.Elephant MTHTRKSHPLFKIINKSFIDLPTPSNISTWWNFGSLLGACLITQILTGLFLAMHYTPDTMTAFSSMSHIC RDVNYGWIIRQLHSNGASIFFLCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSF WGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLG LTSNSDKIPFHPYYTIKDFLGLLILILLLLLLALLSPDMLGDPDNYMPADPLNTPLHIKPEWYFLFAYAI LRSVPNKLGGVLALFLSILILGLMPFLHTSKHRSMMLRPLSQVLFWTLTMDLLTLTWIGSQPVEYPYTII GQMASILYFSIILAFLPIAGMIENYLIK >African.Elephant MTHIRKSHPLLKIINKSFIDLPTPSNISTWWNFGSLLGACLITQILTGLFLAMHYTPDTMTAFSSMSHIC RDVNYGWIIRQLHSNGASIFFLCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSF WGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFALHFILPFTMIALAGVHLTFLHETGSNNPLG LTSDSDKIPFHPYYTIKDFLGLLILILLLLLLALLSPDMLGDPDNYMPADPLNTPLHIKPEWYFLFAYAI LRSVPNKLGGVLALLLSILILGLMPLLHTSKHRSMMLRPLSQVLFWTLTMDLLTLTWIGSQPVEYPYIII GQMASILYFSIILAFLPIAGVIENYLIK

LAB#23: Biochemical Evidence of Evolution Name: Period Date :

LAB#23: Biochemical Evidence of Evolution Name: Period Date : LAB#23: Biochemical Evidence of Name: Period Date : Laboratory Experience #23 Bridge Worth 80 Lab Minutes If two organisms have similar portions of DNA (genes), these organisms will probably make similar

More information

Feeding Time. WHOLESALE SEAFOOD COSTS food item price per pound

Feeding Time. WHOLESALE SEAFOOD COSTS food item price per pound SeaWorld Teacher s Guide Feeding Time OBJECTIVES Students make decisions about how to solve a complex real-life problem by breaking it down into simpler parts. MATERIALS paper and pencils calculators Ocean

More information

Bioinformatics Laboratory Exercise

Bioinformatics Laboratory Exercise Bioinformatics Laboratory Exercise Biology is in the midst of the genomics revolution, the application of robotic technology to generate huge amounts of molecular biology data. Genomics has led to an explosion

More information

Protein Investigator. Protein Investigator - 3

Protein Investigator. Protein Investigator - 3 Protein Investigator Objectives To learn more about the interactions that govern protein structure. To test hypotheses regarding protein structure and function. To design proteins with specific shapes.

More information

Cube Critters Teacher s Guide

Cube Critters Teacher s Guide Cube Critters Teacher s Guide Relevant Life Science Content Standards from the National Science Education Standards 5-8: Diversity and Adaptations of Organisms Hereditary information is contained in genes,

More information

1. Describe the relationship of dietary protein and the health of major body systems.

1. Describe the relationship of dietary protein and the health of major body systems. Food Explorations Lab I: The Building Blocks STUDENT LAB INVESTIGATIONS Name: Lab Overview In this investigation, you will be constructing animal and plant proteins using beads to represent the amino acids.

More information

Mutations and Disease Mutations in the Myosin Gene

Mutations and Disease Mutations in the Myosin Gene Biological Sciences Initiative HHMI Mutations and Disease Mutations in the Myosin Gene Goals Explore how mutations can lead to disease using the myosin gene as a model system. Explore how changes in the

More information

So where were we? But what does the order mean? OK, so what's a protein? 4/1/11

So where were we? But what does the order mean? OK, so what's a protein? 4/1/11 So where were we? We know that DNA is responsible for heredity Chromosomes are long pieces of DNA DNA turned out to be the transforming principle We know that DNA is shaped like a long double helix, with

More information

Lecture 3: 8/24. CHAPTER 3 Amino Acids

Lecture 3: 8/24. CHAPTER 3 Amino Acids Lecture 3: 8/24 CHAPTER 3 Amino Acids 1 Chapter 3 Outline 2 Amino Acid Are Biomolecules and their Atoms Can Be Visualized by Two Different Ways 1) Fischer projections: Two dimensional representation of

More information

Activities for the α-helix / β-sheet Construction Kit

Activities for the α-helix / β-sheet Construction Kit Activities for the α-helix / β-sheet Construction Kit The primary sequence of a protein, composed of amino acids, determines the organization of the sequence into the secondary structure. There are two

More information

Chapter 4: Information and Knowledge in the Protein Insulin

Chapter 4: Information and Knowledge in the Protein Insulin Chapter 4: Information and Knowledge in the Protein Insulin This chapter will calculate the information and molecular knowledge in a real protein. The techniques discussed in this chapter to calculate

More information

BIOLOGY 183 MARINE BIOLOGY PIMA COMMUNITY COLLEGE, DOWNTOWN CAMPUS WORKSHEETS FOR UNIT 7 UNIT 7 LEARNING OBJECTIVES UNIT 7 ACTIVITIES

BIOLOGY 183 MARINE BIOLOGY PIMA COMMUNITY COLLEGE, DOWNTOWN CAMPUS WORKSHEETS FOR UNIT 7 UNIT 7 LEARNING OBJECTIVES UNIT 7 ACTIVITIES BIOLOGY 183 MARINE BIOLOGY PIMA COMMUNITY COLLEGE, DOWNTOWN CAMPUS WORKSHEETS FOR UNIT 7 UNIT 7 LEARNING OBJECTIVES See the Biology 183 Unit 7 website. UNIT 7 ACTIVITIES Step 1: Read Chapter 9 in your

More information

Biochemistry - I. Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture 1 Amino Acids I

Biochemistry - I. Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture 1 Amino Acids I Biochemistry - I Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology, Kharagpur Lecture 1 Amino Acids I Hello, welcome to the course Biochemistry 1 conducted by me Dr. S Dasgupta,

More information

Proteins consist in whole or large part of amino acids. Simple proteins consist only of amino acids.

Proteins consist in whole or large part of amino acids. Simple proteins consist only of amino acids. Today we begin our discussion of the structure and properties of proteins. Proteins consist in whole or large part of amino acids. Simple proteins consist only of amino acids. Conjugated proteins contain

More information

Thin-Layer Chromatography of Amino Acids HASPI Medical Biology Lab 15b Background Macromolecules

Thin-Layer Chromatography of Amino Acids HASPI Medical Biology Lab 15b Background Macromolecules Thin-Layer Chromatography of s HASPI Medical Biology Lab 15b Background Macromolecules Name: Period: Date: There are four major types of biological macromolecules that make up the human body: nucleic acids

More information

Age-related reference ranges

Age-related reference ranges Authoriser: Peter Beresford Page 1 of 6 Age-related reference ranges Alkaline Phosphatase (ALP) IU/L Both less than 14 days 90 273 Both 14 days

More information

Protein Folding LARP

Protein Folding LARP Protein Folding LARP Version: 1.0 Release: April 2018 Amplyus 2018 minipcr TM Protein Folding LARP (Live Action Role Play) Summary Materials In this activity, students will role play to make a folded protein

More information

SMPD 287 Spring 2015 Bioinformatics in Medical Product Development. Final Examination

SMPD 287 Spring 2015 Bioinformatics in Medical Product Development. Final Examination Final Examination You have a choice between A, B, or C. Please email your solutions, as a pdf attachment, by May 13, 2015. In the subject of the email, please use the following format: firstname_lastname_x

More information

Amino acids. (Foundation Block) Dr. Essa Sabi

Amino acids. (Foundation Block) Dr. Essa Sabi Amino acids (Foundation Block) Dr. Essa Sabi Learning outcomes What are the amino acids? General structure. Classification of amino acids. Optical properties. Amino acid configuration. Non-standard amino

More information

Chapter 09 Marine Reptiles, Birds, and Mammals

Chapter 09 Marine Reptiles, Birds, and Mammals Chapter 09 Marine Reptiles, Birds, and Mammals Multiple Choice Questions 1. Marine amphibians: A. Do not exist at all B. Are gill-breathers C. Are fish-like D. Include only tropical species E. Are oviparous

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Spring 2016 Protein Structure February 7, 2016 Introduction to Protein Structure A protein is a linear chain of organic molecular building blocks called amino acids. Introduction to Protein Structure Amine

More information

The West Indian Manatee- A Study in Evolutionary Patterns

The West Indian Manatee- A Study in Evolutionary Patterns The West Indian Manatee- A Study in Evolutionary Patterns Purpose To study three animals as examples of convergent and divergent evolution Name Objective Identify similarities and differences between the

More information

Amino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3

Amino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3 Fundamentals While their name implies that amino acids are compounds that contain an 2 group and a 2 group, these groups are actually present as 3 and 2 respectively. They are classified as α, β, γ, etc..

More information

Towards a New Paradigm in Scientific Notation Patterns of Periodicity among Proteinogenic Amino Acids [Abridged Version]

Towards a New Paradigm in Scientific Notation Patterns of Periodicity among Proteinogenic Amino Acids [Abridged Version] Earth/matriX: SCIENCE TODAY Towards a New Paradigm in Scientific Notation Patterns of Periodicity among Proteinogenic Amino Acids [Abridged Version] By Charles William Johnson Earth/matriX Editions P.O.

More information

SIO 133 Marine Mammal Biology

SIO 133 Marine Mammal Biology SIO 133 Marine Mammal Biology Instructors: John Hildebrand (SIO) and Lisa Balance (SWFSC) Office Hours: Friday 10:30-11:30 Ritter Hall 200E Guest Lecturers: Simone Baumann-Pickering and Bob Pitman Teaching

More information

Low ds/dn Does Not Correlate With High Variation of Amino Acid Sequences Along the gp120 Protein Structure

Low ds/dn Does Not Correlate With High Variation of Amino Acid Sequences Along the gp120 Protein Structure Low ds/dn Does Not Correlate With High Variation of Amino Acid Sequences Along the gp120 Protein Structure Zach Goldstein & Jordan Detamore BIOL 368: Bioinformatics Laboratory Department of Biology Loyola

More information

Diversity in within species

Diversity in within species Taxonomy Name the animal: Diversity in within species What is taxonomy? The science of naming organisms and assigning them into groups called taxa (singular: taxon) What is the biosphere? The part of the

More information

Lecture 10 More about proteins

Lecture 10 More about proteins Lecture 10 More about proteins Today we're going to extend our discussion of protein structure. This may seem far-removed from gene cloning, but it is the path to understanding the genes that we are cloning.

More information

Protein sequence alignment using binary string

Protein sequence alignment using binary string Available online at www.scholarsresearchlibrary.com Scholars Research Library Der Pharmacia Lettre, 2015, 7 (5):220-225 (http://scholarsresearchlibrary.com/archive.html) ISSN 0975-5071 USA CODEN: DPLEB4

More information

Biochemistry Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture -02 Amino Acids II

Biochemistry Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture -02 Amino Acids II Biochemistry Prof. S. Dasgupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture -02 Amino Acids II Ok, we start off with the discussion on amino acids. (Refer Slide Time: 00:48)

More information

Fundamentals of Organic Chemistry CHEM 109 For Students of Health Colleges

Fundamentals of Organic Chemistry CHEM 109 For Students of Health Colleges Fundamentals of Organic Chemistry CHEM 109 For Students of Health Colleges Credit hrs.: (2+1) King Saud University College of Science, Chemistry Department CHEM 109 CHAPTER 9. AMINO ACIDS, PEPTIDES AND

More information

0010 Amino Acids 40 Profile - Plasma

0010 Amino Acids 40 Profile - Plasma Accession #: Order #: G1234567 Date Collected: Date Received: 01/22/2013 Reference #: Patient: Date of Birth: 02/05/1962 Date of Report: Telephone: 7704464583 Ordering Physician: 1234 Main St. Anywhere,

More information

Amino acids. Dr. Mamoun Ahram Summer semester,

Amino acids. Dr. Mamoun Ahram Summer semester, Amino acids Dr. Mamoun Ahram Summer semester, 2017-2018 Resources This lecture Campbell and Farrell s Biochemistry, Chapters 3 (pp.66-76) General structure (Chiral carbon) The amino acids that occur in

More information

CHEM-342 Introduction to Biochemistry Your Name Final Examination - Individual (Part I) Friday, 26 May :30 12:15 PM H. B. White - Instructor

CHEM-342 Introduction to Biochemistry Your Name Final Examination - Individual (Part I) Friday, 26 May :30 12:15 PM H. B. White - Instructor HEM-342 Introduction to Biochemistry Final Examination - Individual (Part I) Friday, 26 May 2006 10:30 12:15 PM H. B. White - Instructor Range 28-72(2) out of 85, Average 53.5 Important - Please read this

More information

Amino Acid Analyzer AAA400

Amino Acid Analyzer AAA400 Amino Acid Analyzer AAA400 Determination of amino acid of hydrolyzates (food and feed) Column: LG ANB OSTION 3.6x340 12μm Eluents: sodium-citrate buffers, 0.2 M NaOH Aspartic Acid, Threonine, Serine, Glutamic

More information

READ THIS FIRST. Your Name

READ THIS FIRST. Your Name Introduction to Biochemistry Final Examination - Individual (Part I) Monday, 24 May 2010 7:00 8:45 PM H. B. White Instructor 120 Points Your Name "Ability is what you're capable of doing. Motivation determines

More information

Amino acids-incorporated nanoflowers with an

Amino acids-incorporated nanoflowers with an Amino acids-incorporated nanoflowers with an intrinsic peroxidase-like activity Zhuo-Fu Wu 1,2,+, Zhi Wang 1,+, Ye Zhang 3, Ya-Li Ma 3, Cheng-Yan He 4, Heng Li 1, Lei Chen 1, Qi-Sheng Huo 3, Lei Wang 1,*

More information

cpb7csch04pg43_58.qxd 10/31/07 12:01 PM Page 43 CHAPTER Tree Thinking

cpb7csch04pg43_58.qxd 10/31/07 12:01 PM Page 43 CHAPTER Tree Thinking cpb7csch04pg43_58.qxd 10/31/07 12:01 PM Page 43 4 CHAPTER Tree Thinking 43 cpb7csch04pg43_58.qxd 10/31/07 12:01 PM Page 44 44 Tree Thinking Teruko and her friend Sean were jogging around a track after

More information

Topic 10: Origin of Cetaceans: A Macroevolutionary Case Study

Topic 10: Origin of Cetaceans: A Macroevolutionary Case Study Topic 10: Origin of Cetaceans: A Macroevolutionary Case Study All content and conclusions, except for photos, CR Hardy 1. Fully aquatic, mostly marine mammals Colloquially called dolphins, porpoises, &

More information

Annual Report ERNDIM-EQAS Quantitative Amino Acids 2004

Annual Report ERNDIM-EQAS Quantitative Amino Acids 2004 Annual Report ERNDIM-EQAS Quantitative Amino Acids 2004 1. Purpose The purpose of the ERNDIM External Quality Assurance Scheme for Quantitative Organic Acids is the monitoring of the analytical quality

More information

Chemistry 121 Winter 17

Chemistry 121 Winter 17 Chemistry 121 Winter 17 Introduction to Organic Chemistry and Biochemistry Instructor Dr. Upali Siriwardane (Ph.D. Ohio State) E-mail: upali@latech.edu Office: 311 Carson Taylor Hall ; Phone: 318-257-4941;

More information

Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A

Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A Biological systems interact, and these systems and their interactions possess complex properties. STOP at enduring understanding 4A Homework Watch the Bozeman video called, Biological Molecules Objective:

More information

Properties of amino acids in proteins

Properties of amino acids in proteins Properties of amino acids in proteins one of the primary roles of DNA (but far from the only one!!!) is to code for proteins A typical bacterium builds thousands types of proteins, all from ~20 amino acids

More information

Aipotu II: Biochemistry

Aipotu II: Biochemistry Aipotu II: Biochemistry Introduction: The Biological Phenomenon Under Study In this lab, you will continue to explore the biological mechanisms behind the expression of flower color in a hypothetical plant.

More information

Objective: You will be able to explain how the subcomponents of

Objective: You will be able to explain how the subcomponents of Objective: You will be able to explain how the subcomponents of nucleic acids determine the properties of that polymer. Do Now: Read the first two paragraphs from enduring understanding 4.A Essential knowledge:

More information

Cells N5 Homework book

Cells N5 Homework book 1 Cells N5 Homework book 2 Homework 1 3 4 5 Homework2 Cell Ultrastructure and Membrane 1. Name and give the function of the numbered organelles in the cell below: A E B D C 2. Name 3 structures you might

More information

Amino acids. Dr. Mamoun Ahram and Dr. Diala Abu-Hassan Summer semester,

Amino acids. Dr. Mamoun Ahram and Dr. Diala Abu-Hassan Summer semester, Amino acids Dr. Mamoun Ahram and Dr. Diala Abu-Hassan Summer semester, 2017-2018 dr.abuhassand@gmail.com Resources This lecture Campbell and Farrell s Biochemistry, Chapters 3 (pp.66-76) General structure

More information

Section 1 Proteins and Proteomics

Section 1 Proteins and Proteomics Section 1 Proteins and Proteomics Learning Objectives At the end of this assignment, you should be able to: 1. Draw the chemical structure of an amino acid and small peptide. 2. Describe the difference

More information

Student Handout Bioinformatics

Student Handout Bioinformatics Student Handout Bioinformatics Introduction HIV-1 mutates very rapidly. Because of its high mutation rate, the virus will continue to change (evolve) after a person is infected. Thus, within an infected

More information

PHAR3316 Pharmacy biochemistry Exam #2 Fall 2010 KEY

PHAR3316 Pharmacy biochemistry Exam #2 Fall 2010 KEY 1. How many protons is(are) lost when the amino acid Asparagine is titrated from its fully protonated state to a fully deprotonated state? A. 0 B. 1 * C. 2 D. 3 E. none Correct Answer: C (this question

More information

Marine Turtles, Mammals and Seabirds. Chapter 9

Marine Turtles, Mammals and Seabirds. Chapter 9 Marine Turtles, Mammals and Seabirds Chapter 9 Seabirds Seabirds, like mammals, are able to maintain a constant body temperature derived through metabolic means (homeotherms, endotherm) Seabirds The feathers

More information

بسم هللا الرحمن الرحيم

بسم هللا الرحمن الرحيم بسم هللا الرحمن الرحيم Biochemistry Lec #1 Dr. Nafith AbuTarboush- (30.6.2014) Amino Acids 1 Campbell and Farrell s Biochemistry, Chapter 3 (pp.66-76) Introduction: Biochemistry is two courses; one is

More information

M1 - Renal, Fall 2007

M1 - Renal, Fall 2007 University of Michigan Deep Blue deepblue.lib.umich.edu 2007-09 M1 - Renal, Fall 2007 Lyons, R.; Burney, R. Lyons, R., Burney, R. (2008, August 07). Renal. Retrieved from Open.Michigan - Educational Resources

More information

BODY CHEMISTRY TEST. Sample Report

BODY CHEMISTRY TEST. Sample Report BODY CHEMISTRY TEST * Sample Report Ver. 1.0, Date created: Nov 5, 2017 Disclaimer: VitaminLab is for informational purposes only. lease discuss your results or concerns with your health care professional

More information

Green Segment Contents

Green Segment Contents Green Segment Contents Parts Reference Guide Green Segment 1 8 2 6 3 4 5 7 1. Amino Acid Side Chain Chart shows the properties and atomic structure of side chains. 2. Amino Acid Side Chains affect protein

More information

Hands-On Ten The BRCA1 Gene and Protein

Hands-On Ten The BRCA1 Gene and Protein Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such

More information

PROTEIN. By: Shamsul Azahari Zainal Badari Department of Resource Management and Consumer Studies Faculty of Human Ecology UPM

PROTEIN. By: Shamsul Azahari Zainal Badari Department of Resource Management and Consumer Studies Faculty of Human Ecology UPM PROTEIN By: Shamsul Azahari Zainal Badari Department of Resource Management and Consumer Studies Faculty of Human Ecology UPM OBJECTIVES OF THE LECTURE By the end of this lecture, student can: Define

More information

Page 8/6: The cell. Where to start: Proteins (control a cell) (start/end products)

Page 8/6: The cell. Where to start: Proteins (control a cell) (start/end products) Page 8/6: The cell Where to start: Proteins (control a cell) (start/end products) Page 11/10: Structural hierarchy Proteins Phenotype of organism 3 Dimensional structure Function by interaction THE PROTEIN

More information

Case Study. Malaria and the human genome STUDENT S GUIDE. Steve Cross, Bronwyn Terrill and colleagues. Version 1.1

Case Study. Malaria and the human genome STUDENT S GUIDE. Steve Cross, Bronwyn Terrill and colleagues. Version 1.1 STUDENT S GUIDE Case Study Malaria and the human genome Version 1.1 Steve Cross, Bronwyn Terrill and colleagues Wellcome Trust Sanger Institute Hinxton Malaria and the human genome Each year, the malaria

More information

Lesson Plan Whales: Measuring Whales and Graphing Results

Lesson Plan Whales: Measuring Whales and Graphing Results Lesson Plan Whales: Measuring Whales and Graphing Results Summary This lesson introduces students to a number of whales in the order Cetacea. Students can learn basic facts about the biology and behavior

More information

If you like us, please share us on social media. The latest UCD Hyperlibrary newsletter is now complete, check it out.

If you like us, please share us on social media. The latest UCD Hyperlibrary newsletter is now complete, check it out. Sign In Forgot Password Register username username password password Sign In If you like us, please share us on social media. The latest UCD Hyperlibrary newsletter is now complete, check it out. ChemWiki

More information

Annual Report ERNDIM-EQAS Quantitative Amino Acids 2002

Annual Report ERNDIM-EQAS Quantitative Amino Acids 2002 Annual Report ERNDIM-EQAS Quantitative Amino Acids 2002 1. Purpose The purpose of the ERNDIM External Quality Assurance Scheme for Quantitative Organic Acids is the monitoring of the analytical quality

More information

A Brief Summary of Important Online Bioinformatics Databases and Genomic Application Algorithms

A Brief Summary of Important Online Bioinformatics Databases and Genomic Application Algorithms A Brief Summary of Important Online Bioinformatics Databases and Genomic Application Algorithms Compiled 2005, James F. Lynn Abstract: This is, by no means, a complete compendium of all the databases and

More information

0010 Amino Acid Analysis - 40 Plasma

0010 Amino Acid Analysis - 40 Plasma 770.446.5483 770.441.2237 This report contains reference range adjustments from routine revalidation procedures. It also contains the following three upgrades: 1) The amino acids have been reorganized

More information

Analysis of Cancer Proteins: Pattern Identification on Escherichia coli Species

Analysis of Cancer Proteins: Pattern Identification on Escherichia coli Species Research Article imedpub Journals http://www.imedpub.com Colorectal Cancer: Open Access DOI: 10.21767/2471-9943.100005 Abstract Analysis of Cancer Proteins: Pattern Identification on Escherichia coli Species

More information

Methionine (Met or M)

Methionine (Met or M) Fig. 5-17 Nonpolar Fig. 5-17a Nonpolar Glycine (Gly or G) Alanine (Ala or A) Valine (Val or V) Leucine (Leu or L) Isoleucine (Ile or I) Methionine (Met or M) Phenylalanine (Phe or F) Polar Trypotphan (Trp

More information

AMINO ACIDS NON-ESSENTIAL ESSENTIAL

AMINO ACIDS NON-ESSENTIAL ESSENTIAL Edith Frederika Introduction A major component of food is PROTEIN The protein ingested as part of our diet are not the same protein required by the body Only 40 to 50 gr of protein is required by a normal

More information

MARINE SCIENCE. Monday 14 May 2018

MARINE SCIENCE. Monday 14 May 2018 MARINE SCIENCE Monday 14 May 2018 Entry Task Grab a ChromeBook from the cart. Be sure to grab the number that corresponds to the number on your desk. Log in & go to the following link @ www.kahoot.it Wait

More information

The Structure and Function of Large Biological Molecules Part 4: Proteins Chapter 5

The Structure and Function of Large Biological Molecules Part 4: Proteins Chapter 5 Key Concepts: The Structure and Function of Large Biological Molecules Part 4: Proteins Chapter 5 Proteins include a diversity of structures, resulting in a wide range of functions Proteins Enzymatic s

More information

Proteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000).

Proteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000). Lecture 2: Principles of Protein Structure: Amino Acids Why study proteins? Proteins underpin every aspect of biological activity and therefore are targets for drug design and medicinal therapy, and in

More information

Amino Acids. Review I: Protein Structure. Amino Acids: Structures. Amino Acids (contd.) Rajan Munshi

Amino Acids. Review I: Protein Structure. Amino Acids: Structures. Amino Acids (contd.) Rajan Munshi Review I: Protein Structure Rajan Munshi BBSI @ Pitt 2005 Department of Computational Biology University of Pittsburgh School of Medicine May 24, 2005 Amino Acids Building blocks of proteins 20 amino acids

More information

Chemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins

Chemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins Chemical Nature of the Amino Acids All peptides and polypeptides are polymers of alpha-amino acids. There are 20 a- amino acids that are relevant to the make-up of mammalian proteins (see below). Several

More information

Phylogenetics, systematics and conservation. Darwin s revolution

Phylogenetics, systematics and conservation. Darwin s revolution Phylogenetics, systematics and conservation Matthew D. Herron Darwin s revolution probably all the organic beings which have ever lived on this earth have descended from some one primordial form, into

More information

www.lessonplansinc.com Topic: Protein Synthesis - Sentence Activity Summary: Students will simulate transcription and translation by building a sentence/polypeptide from words/amino acids. Goals & Objectives:

More information

Amino acids. You are required to know and identify the 20 amino acids : their names, 3 letter abbreviations and their structures.

Amino acids. You are required to know and identify the 20 amino acids : their names, 3 letter abbreviations and their structures. Amino acids You are required to know and identify the 20 amino acids : their names, 3 letter abbreviations and their structures. If you wanna make any classification in the world, you have to find what

More information

Midterm 1 Last, First

Midterm 1 Last, First Midterm 1 BIS 105 Prof. T. Murphy April 23, 2014 There should be 6 pages in this exam. Exam instructions (1) Please write your name on the top of every page of the exam (2) Show all work for full credit

More information

SIO 133 Marine Mammal Popula4on Dynamics. John Hildebrand, Scripps Inst. Oceanography, UCSD

SIO 133 Marine Mammal Popula4on Dynamics. John Hildebrand, Scripps Inst. Oceanography, UCSD SIO 133 Marine Mammal Popula4on Dynamics John Hildebrand, Scripps Inst. Oceanography, UCSD Popula4on Dynamics Study fundamental life history characteris4cs such as birth and death rates Age Distribu4on

More information

BENEFITS OF COLLAGEN

BENEFITS OF COLLAGEN ATHLETIC PERFORMANCE/TENDON/MUSCLE Alanine: Alanine is an important source of energy for muscle tissue. Helps to convert sugar into glucose for energy. Asparagine: Asparagine may increase endurance and

More information

Biomolecules: amino acids

Biomolecules: amino acids Biomolecules: amino acids Amino acids Amino acids are the building blocks of proteins They are also part of hormones, neurotransmitters and metabolic intermediates There are 20 different amino acids in

More information

MARINE SCIENCE. Monday 21 May 2018

MARINE SCIENCE. Monday 21 May 2018 MARINE SCIENCE Monday 21 May 2018 Entry Task What was one of the major types of sea mammals named in the video? Pinnipeds When was the Marine Mammal Protection Act established? 1972 Agenda Housekeeping

More information

Part I: 2-d simulation with the Protein Investigator

Part I: 2-d simulation with the Protein Investigator Protein Structure verview In this lab session, you will explore protein structure using two different approaches: 2-dimensional simulation: you will use the Protein Investigator to construct proteins and

More information

Different types of proteins. The structure and properties of amino acids. Formation of peptide bonds.

Different types of proteins. The structure and properties of amino acids. Formation of peptide bonds. Introduction to proteins and amino acids Different types of proteins. The structure and properties of amino acids. Formation of peptide bonds. Introduction We tend to think of protein as a mass noun: a

More information

9/6/2011. Amino Acids. C α. Nonpolar, aliphatic R groups

9/6/2011. Amino Acids. C α. Nonpolar, aliphatic R groups Amino Acids Side chains (R groups) vary in: size shape charge hydrogen-bonding capacity hydrophobic character chemical reactivity C α Nonpolar, aliphatic R groups Glycine (Gly, G) Alanine (Ala, A) Valine

More information

Foundation for the course:

Foundation for the course: Start thinking about term paper topics Foundation for the course: Taxonomy: who are they? Evolution: how did they get here? 1 Important Points Most important Kingdom: Animalia Phylum: Chordata Class: Mammalia

More information

Using a Dichotomous Key to Identify Mammal Skulls

Using a Dichotomous Key to Identify Mammal Skulls Objectives Using a Dichotomous Key to Identify Mammal Skulls 1. To learn how a dichotomous key works, and to appreciate its utility and necessity. 2. To learn how to use skull and dentition characteristics

More information

2 Which of these statements best explains the process of energy conversion that takes place in the mitochondria?

2 Which of these statements best explains the process of energy conversion that takes place in the mitochondria? irst Semester Biology inal: 1. The technique known as chromosome painting is the result of scientific research. Scientists use chromosome painting to mark the locations of genes on human chromosomes with

More information

Living Environment. 1. Some of the concepts included in Darwin's theory of natural selection are represented in the diagram below.

Living Environment. 1. Some of the concepts included in Darwin's theory of natural selection are represented in the diagram below. Mr. Burger Name Living Environment 1. Some of the concepts included in Darwin's theory of natural selection are represented in the diagram below. Which concept would be correctly placed in box X? 1) use

More information

April 28 ii. Outline/References. May 19 iii. Draft (Submission OPTIONAL) May 18 iv. Final Paper Due. June 2

April 28 ii. Outline/References. May 19 iii. Draft (Submission OPTIONAL) May 18 iv. Final Paper Due. June 2 1. Cetacean Systematics & Evolution 2. Pinniped and Sirenian Taxonomy and Classification 3. Pinniped Systematics and Evolution -------------------------------------------------------------------------------

More information

1.4. Lipids - Advanced

1.4. Lipids - Advanced 1.4. Lipids - Advanced www.ck12.org In humans, triglycerides are a mechanism for storing unused calories, and their high concentration in blood correlates with the consumption of excess starches and other

More information

Introduction to Protein Structure Collection

Introduction to Protein Structure Collection Introduction to Protein Structure Collection Teaching Points This collection is designed to introduce students to the concepts of protein structure and biochemistry. Different activities guide students

More information

Copyright 2008 Pearson Education, Inc., publishing as Pearson Benjamin Cummings

Copyright 2008 Pearson Education, Inc., publishing as Pearson Benjamin Cummings Concept 5.4: Proteins have many structures, resulting in a wide range of functions Proteins account for more than 50% of the dry mass of most cells Protein functions include structural support, storage,

More information

Molecular Biology. general transfer: occurs normally in cells. special transfer: occurs only in the laboratory in specific conditions.

Molecular Biology. general transfer: occurs normally in cells. special transfer: occurs only in the laboratory in specific conditions. Chapter 9: Proteins Molecular Biology replication general transfer: occurs normally in cells transcription special transfer: occurs only in the laboratory in specific conditions translation unknown transfer:

More information

Biomolecular Mass Spectrometry

Biomolecular Mass Spectrometry Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic

More information

Phylogeny of Marine Mammals

Phylogeny of Marine Mammals Marine Mammals Phylogeny of Marine Mammals Four groups of marine mammals are separate evolutionary lines each entering the marine environment independently Whales share a common ancestor with even-toed

More information

Lipids: diverse group of hydrophobic molecules

Lipids: diverse group of hydrophobic molecules Lipids: diverse group of hydrophobic molecules Lipids only macromolecules that do not form polymers li3le or no affinity for water hydrophobic consist mostly of hydrocarbons nonpolar covalent bonds fats

More information

Whales Dolphins And Seals A Field Guide To The Marine Mammals Of The World

Whales Dolphins And Seals A Field Guide To The Marine Mammals Of The World Whales Dolphins And Seals A Field Guide To The Marine Mammals Of The World We have made it easy for you to find a PDF Ebooks without any digging. And by having access to our ebooks online or by storing

More information

Mammalogy 4764 Final Fall 2008 Name: Page 1 of 6

Mammalogy 4764 Final Fall 2008 Name: Page 1 of 6 Mammalogy 4764 Final Fall 2008 Name: Page 1 of 6 This is a closed book test you may not use notes, books, other people, or references to answer these questions. You must turn in the exam at the end of

More information

Convention on the Conservation of Migratory Species of Wild Animals Secretariat provided by the United Nations Environment Programme

Convention on the Conservation of Migratory Species of Wild Animals Secretariat provided by the United Nations Environment Programme Convention on the Conservation of Migratory Species of Wild Animals Secretariat provided by the United Nations Environment Programme 14 th MEETING OF THE CMS SCIENTIFIC COUNCIL Bonn, Germany, 14-17 March

More information