Liposome Mediated Delivery of sirna to Hepatic Stellate Cells Alfica Sehgal, Mohammad Zafari, Boris Klebanov, Greg Hinkle, Satya Kuchimanchi, Sarfraz
|
|
- Louisa Mathews
- 6 years ago
- Views:
Transcription
1 Liposome Mediated Delivery of sirn to Hepatic Stellate ells lfica Sehgal, Mohammad Zafari, oris Klebanov, Greg Hinkle, Satya Kuchimanchi, Sarfraz Shaikh, Martin Maier, Jonathan O Shea, Lauren Speciner, kin kinc, Daniel nderson,* Robert Langer,* Tatiana Novobrantseva, Victor Kotelianski, David umcrot* lnylam Pharmaceuticals, ambridge, M 242; *Koch Institute for Integrative ancer Research at MIT, ambridge, M
2 bstract pproximately 28, mericans die every year from chronic liver diseases (LD) including chronic hepatitis, alcoholism and non-alcoholic fatty liver. While all LDs can lead to hepatic fibrosis, therapeutic interventions generally target the etiological agent of the disease and do not directly address the underlying fibrosis. Hepatic stellate cells (HSs) play a key role in the cause and progression of liver fibrosis. n insult/injury to the liver activates the quiescent stellate cells which then synthesize extracellular matrix (EM) as part of a wound healing response. However, repeated liver injury leads to further proliferation of stellate cells, increased matrix deposition, and ultimately, liver fibrosis or cirrhosis. Therefore, reducing the production of EM by stellate cells would be predicted to inhibit the progression of fibrotic disease. Here we describe lipid nanoparticle (LNP) mediated sirn delivery to quiescent and activated stellate cells in three mouse models of liver injury: induction by carbon tetrachloride, thioacetamide or bile-duct ligation. sirns formulated in LNPs comprising the cationic lipid, 2-2 (PNS, 2: 7(5)-864) were administered via intravenous injection. Silencing of the HS-specific targets, collagena (cola) or rhon demonstrated effective sirn delivery to stellate cells. We achieved durable target knock-down in a dose dependent manner with an I 5 of approximately. mg/kg for cola and.-.3 mg/kg for rhon. Delivery to activated HSs was further confirmed using sirns directed against a second HS target, smooth muscle actin (cta2). We propose that sirn-mediated inhibition of cola, or other EM components, warrants further exploration as a novel therapeutic approach for liver fibrosis. Figure. Stellate cells Stellate cells play key role in liver fibrosis dapted from J. linical Investigation 25 (5:2-29)
3 Stellate cells play key role in liver fibrosis dapted and modified from lin Sci (27) 2:265; lin Liver Dis. (28) 2: 939 Hepatic stellate cells (HS): Ito cells, fat storing cells, interstitial cells, lipocytes Described by Kupffer (876) as liver sternzellen (star shaped) Present in Space of Disse 5-% of total resident liver cells Major storage sites for retinoids (vit ) in normal livers Injury to liver induces a wound healing response hemokine signaling ctivation of stellate cells ctivated HSs become highly proliferative Synthesize fibrotic matrix rich in Type I ollagen Scarring of tissue hronic insult leads to fibrosis and eventually cirrhosis Targeting stellate cells Stellate cells are the major players in fibrosis hence targeting them can open different avenues for treatment ollagen (ol) is the principal collagen in fibrotic liver and is expressed by stellate cells in the liver Decrease in ollagena (ola) after treatment with sirn indicates delivery to activated stellate cells ola is a heterotrimer: 2 chains of pro-a(i) & chain of pro-a2(i) ola forms homotrimers in absence of ola2 ola2 degrades intra-cellularly in absence of ola Decrease in ollagen should Destabilize the fibrillar architecture Provide negative feedback to the HSs and lead to HS apoptosis/clearing Promote recovery of normal liver function
4 Figure 2. Silencing of quiescent stellate cells.4.4 Relative RhoN mrn/gpdh Relative Levels of RhoN/GPDH PS.3..3 Day 2 Day Day 2 Day 7 Day 4 Day 2 Day 2 RhoN Luc Luc RhoN Luc Figure 2. Silencing of quiescent stellate cells.. Dose dependent silencing of RhoN mediated by LNP-RhoN sirn. nimals (n=5) were IV dosed with,.3,.,.3 mpk LNP-RhoN or mpk LNP-Luc or PS and sacrificed 48 hours after the dose.. nimals (n=5) were dosed with.5 mg/kg LNP-RhoN or LNP-Luc and sacrificed on the indicated Day. RhoN is a small GTPase, and its expression in normal liver is limited to stellate cells. Silencing of RhoN in whole livers signifies delivery to quiescent stellate cells. Figure 3. l 4 induced liver injury Liver damage 24 hours after single I 4 dose MO l4 Induction of ola message by I 4 Serum Levels 2, n=5 LT 2,4 62 n=5 ST Relative ola mrn/gpdh MO 37.2 n=5 l 4 Mineral oil treated animals I 4 treated animals Figure 3. l 4 induced liver injury. Two doses of l 4 were administered 7 days apart, and animals were sacrificed 24 (in ) or 48 hours (, ) after the treatment.. Levels of LT and ST measured in serum of treated mice (n=5). verage of ola mrn measured in livers after treatment (n=5).. Representative liver sections stained with Sirius red.
5 Figure 4. Knockdown in activated stellate cells Day: 9 2 l 4 gavage (solvent mineral oil) IV dose Sacrifice Relative ola mrn/gpdh Relative SM mrn Levels/GPDH PS PS LNP-ola (mg/kg) LNP-Luc 3 3 PS PS LNP-SM LNP-Luc Figure 4. Target knockdown in activated stellate cells.. Dose dependent ola mrn knockdown with LNP formulated sirn in acute injury model. The mrn levels were measured using Taqman-QPR in total livers. The graph represents normalized signal for ola mrn, using GPDH as internal control. Luc: Luciferase, sirn control (n= per l 4 group). a- SM mrn knock-down with LNP-SM.
6 Figure 5. Delivery to stellate cells in different injury models Relative ola mrn/gpdh Ola/GPDH mrn (relative to control) PS LNP-ola LNP-Luc PS T Saline PS PS LNP-ola LNP-Luc Normal D Ligation Percent Survival Luc ola PS Days after DL Figure 5. Delivery to activated stellate cells in different injury models.. LNP mediated delivery to stellate cells in mice treated with thioacetamide (T), an acute injury agent. Mice were given 3 weekly doses of T and cola expression was measured in livers 2 days after sirn dose. (n=). LNP mediated delivery in severe acute injury model of bileduct ligation (DL). D ligation was done on Day. nimals were dosed with sirn on days 4 and 7 and sacrificed on day 8 (n=5).. DL mice were IV dosed on days 5, 7 and with PS, LNP- ola or LNP-Luc (n=5). The number of surviving animals were counted each day and all remaining animals were sacrificed on Day 2. nimals treated with LNP-ola could sustain the injury longer than other two groups. Figure 6. LNP delivery to stellate cells in chronic injury model Day: l 4 or MO IV dose.5 mg/kg x Sacrifice 8 7 ola/gpdh mrn (relative to control) PS LNP-siLuc LNP-siola PS LNP-siLuc LNP-siola
7 ollagen protein measured by western blot MO l4 -ola l4 -Luc Pro-olI 3 Relative Signal Intensity ola l4-luc Robust delivery to stellate cells under conditions of chronic liver injury Multi-insult, multi-dose model ~5-fold induction of ola mrn by l 4 ~95% knock-down of ola mrn ~9% reduction in collagen I protein Figure 6. LNP mediated delivery to stellate cells in a chronic injury model.. The experimental plan is depicted in the line diagram. ola mrn knockdown with LNP- sirn in multi-insult, multi-dose model. The mrn levels were measured using Taqman-QPR in total livers. The graph represents normalized signal for ola mrn, using GPDH as internal control. Luc: Luciferase, sirn control (n=). ollagen protein measured by western blot (top). Quantification of ol normalized to b-actin is shown in the graph below. The western blot was scanned using Lior Odyssey.
8 Figure 7. ola knockdown is mediated by RNi RN sample Ligate adaptor Day: 9 I 4 or MO gavage IV dose LNP-ola Sacrifice cdn synthesis Gene specific primer I 4 - ola I 4 st rd PR Nested PR nticipated band size TOPO cloning Sanger sequencing lones with 5 RE cleavage product I 4 - LNP-ola I 4 8% (8/) % (/) Figure 7. ola knockdown is mediated by RNi. animals were given l 4 by oral gavage.. Scheme for 5 RE assay. Total liver mrn was processed using Generacer kit (Invitrogen) for cdn synthesis and 5 RE to analyze the cleaved cola. The PR products were cloned into T vectors and sequenced.. nimals were injected with LNP-ola and sacrificed after 24 hours.. garose gel showing DN bands for nested PR. 8% of the clones from LNP-ola group showed expected cleavage product.
9 Figure 8. Delivery to hepatocytes under conditions of liver injury IFN-α TNF-α TGF-β TGF-β R SMD7 P SMD 2/3 SMD 4 SMD-independent pathways p38 JNK -bl P3K TK SMD4 p3 P SMD2/3 EMT and other profibrotic responses ollagen gene expression Figure 8. artoon depiction of TGF-b SMD signaling pathway in liver fibrosis. Different signaling pathways lead to production of extracellular matrix components including ollagen. Relative SMD2 mrn Levels/GPDH sirn SMD2/3 Luc ola/gpdh mrn (relative to control) sirn PS ola SMD2/3 Luc l 4 D Relative FVII mrn/gpdh LNP-FVII LNP-Luc LNP-FVII LNP-Luc SMD2/3 sirn decreases SMD2 mrn levels by ~8% after l 4 injury ola mrn reduced by ~4%, likely downstream effect of SMD2 mrn reduction FVII knock-down demonstrates LNP-siRN delivery under conditions of liver injury Figure 8. Delivery to hepatocytes under conditions of liver injury. set of sirn targeting both SMD2 and SMD3 were screened in NIH 3T3 cells. The lead candidate was formulated for in vivo experiment. Liver injury was induced using l 4. nimals were injected with sirn against SMD2/3, cola or Luc and samples processed for Taqman-QPR.. SMD2/3 mrn levels normalized to GPDH.. ola mrn levels after treating the animals with sirn against ola, SMD2/3 or Luc are shown, normalized to GPDH.. Delivery to hepatocytes was assessed by measuring knock-down of FVII after l 4 treatment. Similar levels of knock-down were observed in animals treated with l 4 or the vehicle, mineral oil. (Luc: sirn against luciferase: as a control, FVII: sirn against Factor VII, a protein specifically synthesized by hepatocytes in the liver.) Summary Potent and reproducible LNP mediated delivery to quiescent and activated stellate cells Tested LNP-siRN delivery to activated stellate cells under different models of liver injury cute and chronic injury model for pericentral injury: l 4 ile-duct ligation injury model for portal fibrosis Thioacetamide induced injury in pericentral and periportal areas Delivery confirmed with silencing of multiple markers Robust knockdown of ola in activated stellate cells Maximum knockdown ~9%, ED 5 around. mg/kg Delivery to hepatocytes in chronically injured liver Supports further development of ola targeting as a therapeutic approach
Molecular mechanisms of Fibrosis: Targets of Therapy. John P Iredale University of Edinburgh, UK
Molecular mechanisms of Fibrosis: Targets of Therapy John P Iredale University of Edinburgh, UK Take home messages: The wound healing MFBs of the liver and the hepatic macrophages are key players in progressive
More informationUnderstanding Root Cause: Pathogenesis of Hepatic Fibrosis
10/1/12 Understanding Root Cause: Pathogenesis of Hepatic Fibrosis Hepatitis C Virus Mild inflammation Inflammation Fibrosis Cirrhosis 1 10/1/12 Non-alcoholic Fatty Liver Disease Steatosis Steatohepatitis
More informationPCSK9 RNAi Therapeutics. Kevin FitzGerald
PCSK9 RNAi Therapeutics Kevin FitzGerald Presenter Disclosure Information PSCK9 RNAi Therapeutics The following relationships exist related to this presentation:» Kevin Fitzgerald and Alnylam team members:
More informationMechanisms of hepatic fibrogenesis in chronic liver disease
Mechanisms of hepatic fibrogenesis in chronic liver disease JPEMS 2014, Physiopathology Module Corentin Bessy (Nantes) _ Gabrielle Cepella (Amsterdam) _ Charly Gaisne (Angers) _ Gwladys Guilloineau (Angers)
More informationSupplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β
Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β
More informationNottingham Patterns of liver fibrosis and their clinical significance
Nottingham 2006 Patterns of liver fibrosis and their clinical significance Alastair D Burt Professor of Pathology and Dean of Clinical Medicine University of Newcastle upon Tyne Collapse of reticulin
More informationExpanded View Figures
MO reports PR3 dephosphorylates TZ Xian-o Lv et al xpanded View igures igure V1. PR3 dephosphorylates and inactivates YP/TZ., Overexpression of tight junction proteins Pals1 () or LIN7 () has no effect
More informationThe Enhancement of Toxin-Induced Liver Fibrosis in Fatty Liver Disease. Ekihiro Seki, M.D.,Ph.D. University of California San Diego
The Enhancement of Toxin-Induced Liver Fibrosis in Fatty Liver Disease Ekihiro Seki, M.D.,Ph.D. University of California San Diego - A manufactured chemical. - Does not exist naturally. Carbon tetrachloride
More informationDigestive Disease Week RNAi Therapeutics Ameliorate Liver Disease Associated with Alpha-1 Antitrypsin Deficiency. May 6, 2014 Alfica Sehgal
Digestive Disease Week RNAi Therapeutics Ameliorate Liver Disease Associated with Alpha-1 Antitrypsin Deficiency May 6, 2014 Alfica Sehgal Alpha-1 Antitrypsin (AAT) AAT is a serine proteinase inhibitor
More informationLaura Smart 9/22/2011
Laura Smart 9/22/2011 Fibrosis is a wound healing response in which damaged regions are encapsulated by an extracellular matrix or scar. Fibrosis develops in almost all patients with chronic liver injury
More informationAsiaTIDES 2012: Formulation and Delivery of Peptides and Oligonucleotides Strategies for Delivery of RNAi Therapeutics. March 1, 2012 Akin Akinc, PhD
AsiaTIDES 2012: Formulation and Delivery of Peptides and Oligonucleotides Strategies for Delivery of RNAi Therapeutics March 1, 2012 Akin Akinc, PhD Lead Selection Alnylam RNAi Product Platform Turning
More informationP2X7 blockade attenuates mouse liver fibrosis
MOLEULR MEDIINE REPORTS 9: 57-62, 2014 P2X7 blockade attenuates mouse liver fibrosis HNGSHN HUNG, WEI YU, HONG UI, YUNJIN WNG, LING ZHNG, FENG HN and TO HUNG Department of Hepatobiliary Surgery, Henan
More informationTitle: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events
Title: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events Pu Yang 1, 3, radley M. Schmit 1, Chunhua Fu 1, Kenneth DeSart 1, S. Paul
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationSupplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
More informationRegulator of G-protein signaling 5 is expressed in hepatic stellate cells. and moderates the fibrotic response to injury. Arya J.
Regulator of G-protein signaling 5 is expressed in hepatic stellate cells and moderates the fibrotic response to injury Arya J. Bahrami A dissertation submitted in partial fulfillment of the requirements
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary Figure 1: Lgr5 expression in liver was induced by CCL4 and decreased after liver recovery. Mice were treated with single dose of CCL4
Supplementary Figure 1: Lgr5 expression in liver was induced by CCL4 and decreased after liver recovery. Mice were treated with single dose of CCL4 or control oil, the livers were collected at various
More informationBile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response. Supplementary Results
Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response Shi-Ying Cai 1, Xinshou Ouyang 1, Yonglin Chen 1, Carol J. Soroka 1, Juxian Wang 2, Albert Mennone 1,
More informationTopically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals
Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Stem cells move to injured area, differentiate into neighboring cells, and replace the damaged cells Cell Eons Stem cells
More informationNiki Prakoura. Calreticulin upregulation in renal fibrosis
Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,
More informationBile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool
Bile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool Peter Fickert, Andrea Fuchsbichler, Tarek Moustafa, Gernot Zollner, Emina Halilbasic, Ulrike Stöger, Cord Langner, Helmut Denk, and Michael
More informationHISTOPL4THOLOG1CAL STUDY OF LIVER
HISTOPL4THOLOG1CAL STUDY OF LIVER 6.1 Inti-oduction The structural and functional organization of the liver has been described by hepatic lobule and hepatic acinus models, respectively (Jarvelainen, 2000).
More informationExpanded View Figures
Sarah Kit Leng Lui et al USP26 stabilizes SM7 MO reports xpanded View igures igure V1. USP26 enhances SM2 phosphorylation and T-b-mediated transcription. raph representing relative luciferase values obtained
More informationFigure 1. Dnmt3b expression in murine and human knee joint cartilage. (A) Representative images
Figure Legends Figure. expression in murine and human knee joint cartilage. () Representative images showing that Dnmta is not expressed in chondrocytes from mo W articular cartilage [Dnmta expression
More informationcontributes to reversal of biliary fibrosis by Popov et al.
Supplementary data to MS Macrophage-mediated phagocytosis of apoptotic cholangiocytes contributes to reversal of biliary fibrosis by Popov et al. Supplementary table 1. Primers and probes used in quantitative
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationUnderstanding the mechanisms of asbestos related diseases
University of Hawai i Cancer Center Understanding the mechanisms of asbestos related diseases Haining Yang, PhD Professor University of Hawai i Cancer Center Marker of exposure: Bilateral pleural plaques
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): The manuscript by Wu et al describes critical role of RNA binding protein CUGBP1 in the development of TGF-beta-mediated liver fibrosis. The activation
More informationExploring a Link Between Spy1 and Hepatocellular Carcinoma Progression
University of Windsor Scholarship at UWindsor UWill Discover Undergraduate Conference UWill Discover 2016 Mar 29th, 4:00 PM - 5:00 PM Exploring a Link Between Spy1 and Hepatocellular Carcinoma Progression
More informationPortal Fibroblasts in Biliary Fibrosis
Curr Pathobiol Rep (2014) 2:185 190 DOI 10.1007/s40139-014-0054-y MYOFIBROBLAST (TATIANA KISSELEVA, SECTION EDITOR) Portal Fibroblasts in Biliary Fibrosis Rebecca G. Wells Published online: 14 September
More informationLiver Disease NASH/Fibrosis Model
Liver Disease NASH/Fibrosis Model Please contact: Dipti Deshpande PhD ddeshpande@woodlandpharma.com or Carol Gebert PhD cgebert@woodlandbiosciences.com 617-513-5280 Liver Diseases Comprise a Growing Market
More informationUniversity of Groningen
University of Groningen Broad-spectrum matrix metalloproteinase inhibition curbs inflammation and liver injury but aggravates experimental liver fibrosis in mice de Meijer, Vincent E.; Sverdlov, Deanna
More informationZL ZDF ZDF + E2 *** Visceral (g) ZDF
Body Weight (g) 4 3 2 1 ** * ZL ZDF 6 8 1 12 14 16 Age (weeks) B * Sub-cutaneous (g) 16 12 8 4 ZL ZDF Visceral (g) 25 2 15 1 5 ZL ZDF Total fat pad weight (g) 4 3 2 1 ZDF ZL Supplemental Figure 1: Effect
More informationModels of liver fibrosis: exploring the dynamic nature of inflammation and repair in a solid organ
Review series Models of liver fibrosis: exploring the dynamic nature of inflammation and repair in a solid organ John P. Iredale Medical Research Council/University of Edinburgh Centre for Inflammation
More informationForward-looking Statements
NASDAQ:CNAT Forward-looking Statements This presentation contains forward-looking statements. All statements other than statements of historical facts contained in this presentation, including statements
More informationLysophosphatidic acid (LPA) signaling through LPA1 in organ fibrosis: A pathway with pleiotropic pro-fibrotic effects. and Andrew M.
78 Special Issue: Cellular and Molecular Bases for Fibrotic Diseases Review Article Lysophosphatidic acid (LPA) signaling through LPA1 in organ fibrosis: A pathway with pleiotropic pro-fibrotic effects
More informationProtection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein
Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian
More informationPhase 1 Trial of ALN-VSP in Cancers Involving the Liver. Annual Meeting of the Controlled Release Society August 2, 2011
Phase 1 Trial of ALN-VSP in Cancers Involving the Liver Annual Meeting of the Controlled Release Society August 2, 2011 Agenda ALN-VSP: Background Phase 1 Trial Study Design Safety Data Tumor Response
More informationCells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2)
Supplemental Methods Cells and reagents. Synaptopodin knockdown (1) and dynamin knockdown (2) podocytes were cultured as described previously. Staurosporine, angiotensin II and actinomycin D were all obtained
More informationSupplementary Information: Figures 1-6 and Table 1 RNAi-Mediated Gene Silencing in Non-Human Primate Zimmermann, T.S. et al.
Supplementary Information: Figures 1-6 and Table 1 RNAi-Mediated Gene Silencing in Non-Human Primate Zimmermann, T.S. et al. a. 12 14 Relative apob mrna (%) 8 6 4 2 Relative apob mrna (%) 12 8 6 4 2 5
More informationStimulating healthy tissue regeneration by targeting the 5-HT 2B receptor in chronic liver disease.
Stimulating healthy tissue regeneration by targeting the 5-HT 2B receptor in chronic liver disease. Mohammad R Ebrahimkhani, Fiona Oakley, Lindsay B Murphy, Jelena Mann, Anna Moles, Maria J Perugorria,
More informationBRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information)
BRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information) David Dankort, David P. Curley, Robert A. Cartlidge, Betsy Nelson, Anthony N. Karnezis,
More informationSupplementary Figure 1
Supplementary Figure 1 6 HE-50 HE-116 E-1 HE-108 Supplementary Figure 1. Targeted drug response curves of endometrial cancer cells. Endometrial cancer cell lines were incubated with serial dilutions of
More informationResearch article. Department of Pharmacology and Toxicology, Medical College of Georgia, Georgia Health Sciences University, Augusta, Georgia, USA.
Research article Calpain mediates pulmonary vascular remodeling in rodent models of pulmonary hypertension, and its inhibition attenuates pathologic features of disease Wanli Ma, 1 Weihong Han, 1 Peter
More informationFigure S1. IRF5 mrna expression is not expressed modulated by steatosis grade in
9-INS-RG-TR- SUPPLEMENTRY MTERILS B IRF mrn expression 1 Control Fatty liver NSH HCV αsm IRF 1 ERG IRF < -33 33- Steatosis (%) < Figure S1. IRF mrn expression is not expressed modulated by steatosis grade
More informationSupplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections
Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast
More informationElectron micrograph of phosphotungstanic acid-stained exosomes derived from murine
1 SUPPLEMENTARY INFORMATION SUPPLEMENTARY FIGURES Supplementary Figure 1. Physical properties of murine DC-derived exosomes. a, Electron micrograph of phosphotungstanic acid-stained exosomes derived from
More informationSupplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO
Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO Mice. WT mice and KHK-A/C KO mice were provided drinking water containing 10% glucose or tap water with normal chow ad
More informationStudy of Zinc in Cirrhosis of Liver
74 Clinical Study Study of Zinc in Cirrhosis of Liver Kaushik Kar, Assistant Professor, Gorachand Bhattyacharya, Professor Department of Biochemistry, Calcutta National Medical College, Kolkata. Jayanta
More informationType of file: PDF Title of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Table.
Type of file: PDF Title of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Tale. Type of file: VI Title of file for HTML: Supplementary Movie 1 Description:
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationSmall Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment
Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:
More informationliver disease Collagen synthesis Collagen synthesis may readily be studied in mouse
Ann. rheum. Dis. (1977), 36, Supplement p. 29 Collagen deposition in liver disease J. O'D. McGEE From the Department ofpathology, Radcliffe Infirmary, Oxford Collagen forms a small component of the total
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Correlation between LKB1 and YAP expression in human lung cancer samples. (a) Representative photos showing LKB1 and YAP immunohistochemical staining in human
More informationPlasma exposure levels from individual mice 4 hours post IP administration at the
Supplemental Figure Legends Figure S1. Plasma exposure levels of MKC-3946 in mice. Plasma exposure levels from individual mice 4 hours post IP administration at the indicated dose mg/kg. Data represent
More informationTissue repair. (3&4 of 4)
Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid
More informationSerum cytokine levels in control and tumor-bearing male and female mice at day 15.
Supplementary Table 1. Serum cytokine levels in control and tumor-bearing male and female mice at day 15. Male Female Cytokine Control C-26 Control C-26 IL-1β 2.0 ± 0.8 9.6 ± 1.5* 1.8 ± 0.2 6.8 ± 1.4*
More informationStacey Melquist #AHA16
Targeting apolipoprotein(a) with a novel RNAi delivery platform as a prophylactic treatment to reduce risk of cardiovascular events in individuals with elevated lipoprotein(a) Monday, November 14, 2016
More informationDisclosures. Outline. Extracellular Vesicles in Fatty Liver Disease. From Contributors to disease pathogenesis to novel biomarkers
Extracellular Vesicles in Fatty Liver Disease From Contributors to disease pathogenesis to novel biomarkers Ariel Feldstein, M.D. Professor of Pediatrics Chief, Division of Pediatric Gastroenterology Hepatology
More informationSupplementary Figure 1
Supplementary Figure 1 A B mir-141, human cell lines mir-2c, human cell lines mir-141, hepatocytes mir-2c, hepatocytes Relative RNA.1.8.6.4.2 Relative RNA.3.2.1 Relative RNA 1.5 1..5 Relative RNA 2. 1.5
More informationImproving the Lives of Patients with Liver Diseases
Improving the Lives of Patients with Liver Diseases Corporate Presentation March 2019 Safe Harbor Statement This presentation contains "forward-looking" statements that involve risks, uncertainties and
More informationHepaRG LX2. HepaRG HepaRG LX2 LX2
C Supporting Figure 1. Experimental design of s between and cells. (A) -hepatocytes were isolated from a 30 days of -progenitors. Differentiation into mature hepatocytes was achieved following a 2-weeks
More informationSupplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated
Supplementary fig. 1. Crystals induce necroptosis does not involve caspases, TNF receptor or NLRP3. A. Mouse tubular epithelial cells were pretreated with zvad-fmk (10µM) and exposed to calcium oxalate
More informationTissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science
Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration
More informationRegenerative Medicine for Sclerotic Disorders
Regenerative Medicine Regenerative Medicine for Sclerotic Disorders JMAJ 7(7): 3 37, Toshikazu NAKAMURA rofessor, Division of Molecular Regenerative Medicine, Course of Advanced Medicine, Osaka University
More informationSupplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation
Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).
More informationFigure 1. Effects of FGF21 on adipose tissue. (A) Representative histological. findings of epididymal adipose tissue (B) mrna expression of
SUPPLEMENTAL MATERIAL EN-12-2276 Figure 1. Effects of FGF21 on adipose tissue. (A) Representative histological findings of epididymal adipose tissue (B) mrna expression of adipocytokines in adipose tissue.
More informationThe antiparasitic drug ivermectin is a novel FXR ligand that regulates metabolism
Supplementary Information The antiparasitic drug ivermectin is a novel FXR ligand that regulates metabolism Address correspondence to Yong Li (yongli@xmu.edu.cn, Tel: 86-592-218151) GW464 CDCA Supplementary
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationDigestive system L 4. Lecturer Dr. Firdous M. Jaafar Department of Anatomy/Histology section
Digestive system L 4 Lecturer Dr. Firdous M. Jaafar Department of Anatomy/Histology section objectives 1-Describe the structure of liver. 2-Define liver lobule, and identify its zones. 3-Define portal
More informationExamining Pathological Effects of Hepatic Inflammation after Traumatic Spinal Cord Injury. Research Thesis
Examining Pathological Effects of Hepatic Inflammation after Traumatic Spinal Cord Injury Research Thesis Presented in Partial Fulfillment of the Requirements for Graduation with Research Distinction in
More informationSupplemental Figure 1
Supplemental Figure 1 1a 1c PD-1 MFI fold change 6 5 4 3 2 1 IL-1α IL-2 IL-4 IL-6 IL-1 IL-12 IL-13 IL-15 IL-17 IL-18 IL-21 IL-23 IFN-α Mut Human PD-1 promoter SBE-D 5 -GTCTG- -1.2kb SBE-P -CAGAC- -1.kb
More informationGallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity
Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae
More informationExpanded View Figures
Shao-Ming Shen et al Role of I in MT of cancers MO reports xpanded View igures igure V1. nalysis of the expression of I isoforms in cancer cells and their interaction with PTN. RT PR detection of Ish and
More informationNature Medicine: doi: /nm.4324
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Supplementary Figure 1. Kinetics of SnCs development in surgically-induced OA and effect of GCV-induced SnC clearance on OA disease progression
More informationWHAT THE EXPERIMENTAL MODELS CAN TEACH US IN NAFLD/NASH? Claudio Tiribelli, MD PhD Scientific Director FIF
WHAT THE EXPERIMENTAL MODELS CAN TEACH US IN NAFLD/NASH? Claudio Tiribelli, MD PhD Scientific Director FIF ctliver@fegato.it Worldwide estimated prevalence of NAFLD distribution of PNPLA3 genotypes 2017-Younussi
More informationKD025 in IPF: Topline Results
KD025 in IPF: Topline Results Webcast Presentation February 13, 2018 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs
More informationNon alcoholic fatty liver and Non alcoholic Steatohepatitis. By Dr. Seham Seif
Non alcoholic fatty liver and Non alcoholic Steatohepatitis By Dr. Seham Seif Definition NAFL describe a common clinicopathological conditions characterized by significant lipid deposition in the hepatocytes
More informationISOGENIC CELL LINES. ATCC No. Designation Mutation Parental Cell Line Disease Cancer Model
THE ESSENTILS OF LIFE SCIENCE RESERCH GLOLLY DELIVERED ISOGENIC CELL LINES TCC CRISPR/CS9 GENE-EDITED ISOGENIC CELL LINES Clinically relevant cell models are critical for studies of molecular and cellular
More informationRNA interference (RNAi)
RN interference (RNi) Natasha aplen ene Silencing Section Office of Science and Technology Partnerships Office of the Director enter for ancer Research National ancer Institute ncaplen@mail.nih.gov Plants
More informationSupplementary Figure 1
Supplementary Figure 1 AAV-GFP injection in the MEC of the mouse brain C57Bl/6 mice at 4 months of age were injected with AAV-GFP into the MEC and sacrificed at 7 days post injection (dpi). (a) Brains
More informationLymphatic transport of drugs. By P Govardhan M.Pharm II Sem UCPSC
Lymphatic transport of drugs By P Govardhan M.Pharm II Sem UCPSC CONTENTS Introduction Physiology of lymphatic system Intestinal lymphatic drug transport Promotion of intestinal lymphatic drug transport
More information2.5. AMPK activity
Supplement Fig. A 3 B phos-ampk 2.5 * Control AICAR AMPK AMPK activity (Absorbance at 45 nm) 2.5.5 Control AICAR Supplement Fig. Effects of AICAR on AMPK activation in macrophages. J774. macrophages were
More informationLeptin deficiency suppresses progression of atherosclerosis in apoe-deficient mice
Leptin deficiency suppresses progression of atherosclerosis in apoe-deficient mice Atherosclerosis, 2007 Chiba T, Shinozaki S, Nakazawa T, et al. Present by Sudaporn Pummoung Apolipoprotein E (apoe( apoe)
More informationSupplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier curves for progression-free survival (PFS) and overall survival (OS) in a cohort of patients (N=52) with stage III primary ovarian
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES
More informationSupplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the
Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student
More informationCYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt
Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,
More informationGrowth factors in experimental liver fibrogenesis
Falk Symposium 162: Leberzirrhose: Von der Pathophysiologie zur Klinik 13. Oktober 2007 Ralf Weiskirchen Institute of linical hemistry and Pathobiochemistry, UKA Growth factors in experimental liver fibrogenesis
More informationEuropean Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1
PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:
More informationDevelopment of Nutrient Delivery Systems: Ingredients & Challenges
Development of Nutrient Delivery Systems David Julian McClements and Hang Xiao Department of Food Science University of Massachusetts Development of Nutrient Delivery Systems: Ingredients & Challenges
More informationSupplementary Information File
Supplementary Information File Supplementary Table 1. List of synthesized sirna sequences for target genes sirna Species Sequence Ctrl sirna mouse sense 5 -UUCUCCGAACGUGUCACGUTT-3 Antisense 5 -ACGUGACACGUUCGGAGAATT-3
More informationSupporting Information Table of content
Supporting Information Table of content Supporting Information Fig. S1 Supporting Information Fig. S2 Supporting Information Fig. S3 Supporting Information Fig. S4 Supporting Information Fig. S5 Supporting
More informationAs outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the
3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing
More informationBMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice
SUPPLEMENTARY MATERIALS BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice Elena Corradini, Paul J. Schmidt, Delphine Meynard, Cinzia Garuti, Giuliana
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3461 In the format provided by the authors and unedited. Supplementary Figure 1 (associated to Figure 1). Cpeb4 gene-targeted mice develop liver steatosis. a, Immunoblot displaying CPEB4
More informationFoxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition.
Manuscript EMBO-2012-82682 Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. David Balli, Vladimir Ustiyan, Yufang Zhang, I-Ching Wang, Alex J. Masino,
More informationHealing & Repair. Tissue Regeneration
Healing & Repair Dr. Srikumar Chakravarthi Repair & Healing: Are they same? Repair :Regeneration of injured cells by cells of same type, as with regeneration of skin/oral mucosa (requires basement membrane)
More information