Molecular mechanisms of Fibrosis: Targets of Therapy. John P Iredale University of Edinburgh, UK
|
|
- Darrell Golden
- 5 years ago
- Views:
Transcription
1 Molecular mechanisms of Fibrosis: Targets of Therapy John P Iredale University of Edinburgh, UK
2 Take home messages: The wound healing MFBs of the liver and the hepatic macrophages are key players in progressive and resolving fibrosis. The fibrotic liver retains a significant capacity for matrix degradation which is held in check. Resolution of fibrosis is characterised by apoptosis of the HSC/MFBs and matrix degradation associated with diminished hepatic TIMP levels. Strategies based on harnessing the matrix degrading capacity of the liver and using HSCs and MSCs as delivery vehicles remain attractive.
3 Iredale, J. P. J. Clin. Invest. 2007;117: Copyright 2007 American Society for Clinical Investigation
4 Can we demonstrate the influence of macrophages on the fibrotic response in a mechanistic experimental system? 6wks 8wks 12wks CCl 4 Macrophages populate hepatic scars during injury
5 Using the DTr mouse MØ can be effectively and specifically deleted in progressive CCl 4 induced fibrosis Duffield.Iredale JCI 2005
6 Fibrosis: Effect of experimental Macrophage depletion 12 weeks CCl 4 + Macrophages - Macrophages Duffield.Iredale JCI 2005
7 Galectin-3 β-galactoside binding lectin Found in all 3 cellular compartments One of a family of 14 currently identified galectins Galectins highly conserved through evolution
8 Galectin-3 regulates liver fibrosis WT Galectin-3 -/- Collagen Henderson Iredale et al, PNAS 2006
9 Myofibroblast activation is defective in vivo WT Galectin-3 -/- α-sma Henderson Iredale et al, PNAS 2006
10 Macrophage-derived Galectin-3 drives myofibroblast activation in the kidney following UUO α-sma WT møs Gal-3 -/- møs % α-sma * WT Gal-3 -/- collagen % collagen * WT Gal-3 -/- Procollagen gene expression * WT Gal-3 -/- Henderson et al Am J Path 2008
11 Iredale, J. P. J. Clin. Invest. 2007;117: Copyright 2007 American Society for Clinical Investigation
12 Matrix degrading metalloproteinase (MMP) TIMP MMP activity inhibite No matrix degradatio occurs GELATIN SEPHAROSE CHROMATOGRAPHY OF HSC CONDITIONED MEDIA Gelatinase activity in culture media following TIMP-1 removal µg Gelatin degraded/18 hr Initial Media Post C graph Media Add back of TIMP-1 containing fraction % inhibition of gelatinase activity Post C graph Media + 10% Buffer Iredale et al JCI 1992 Post C graph Media + 10% TIMP-1 eluate Activated HSC/MFB Collagen I-rich scar matrix HSC and Other NPCs/ICs express MMPs Latent capacity for degradation of fibrillar matrix is held in check
13 REVERSIBILITY OF CCl 4 MODEL Iredale JCI weeks 4 weeks + 10 days recovery
14 Collagenase activity during recovery OHP TIMP Col'nase TIMP is reduced Matrix degradation occurs 0 PFO 4d 7d 28d Iredale JCI 1998
15 REVERSIBILITY MODEL: NUMBERS OF ACTIVATED STELLATE CELLS Fibrosis days after bile duct ligation Days of recovery days after bile duct anastomosis α SMA positive cells per high power field sham
16 Fibrosis PROGRESSION RESOLUTION QUIESCENT HSC ACTIVATED HSC APOPTOTIC HSC Products of damaged cells HEPATOCYTE KUPFFER CELL INFLAMMATORY CELL Number HSC TIMPs Collagen Collagenase Gal 3 TGF B1 PDGF etc TIMP Number HSC TIMPs Collagen Collagenase
17 RESPONSE TO LAMIVUDINE IN HEPATITIS B Wanless 1999
18 Collagen Cross-linking may limit recovery from fibrosis 12 Week CCl 4 Days of Recovery 0Days 84Days 366Days Elastin ttg 0Days X-link 0Day X-link 0Days ttg 366Days X-link 366Days X-link Issa et al Gastroenterol 2004
19 Stylised diagrammatic summary of resolution in micronodular cirrhosis X-Linked Elastin rich HV HV HV HV PT HV HV 12 Weeks CCl 4 MICRONODULAR CIRRHOSIS 12 Weeks CCl d 366d MACRONODULAR CIRRHOSIS
20 Evidence for limited matrix degradation in human explant material Wanless 2000
21 Assessing the role of collagen-i in mediating HSC survival Wild Type collagen I MMP Mutant collagen I MMP Complete Degradation Persistence Day 0 Day 28 αsma S Red αsma S Red Issa et al FASEB J 2002
22 Apoptosis in Cell Populations in WT and r/r mice During Recovery from Fibrosis Determined by TUNEL Mean TUNEL positive cells in the fibrotic band /HP * WT rr WT rr WT rr WT rr * PF0 PF4 PF7 PF28 Activated HSC
23 Fibrosis PROGRESSION RESOLUTION QUIESCENT HSC ACTIVATED HSC APOPTOTIC HSC HEPATOCYTE KUPFFER CELL INFLAMMATORY CELL Number HSC TIMPs Collagen MMPase Factors favouring survival: Cytokines/soluble factors Matrix stabilisation Cell-cell receptor stabilisation Number HSC TIMPs Collagen MMPase Factors favouring apoptosis: Death receptor activation Withdrawal of survival factors: Matrix degradation Cell receptor degradation
24 Fibrosis PROGRESSION RESOLUTION QUIESCENT HSC ACTIVATED HSC APOPTOTIC HSC Number HSC TIMPs Collagen MMPase Number HSC TIMPs Collagen MMPase KUPFFER CELL MACROPHAGE What is the source of the Collagenase and other key MMPs? Is there a role for M phages/ inflamm cells in recovery?
25 In the long term, persistent scars are hypocellular: 0.04 ** C α-sma Sirius red cells/cm PF0 PF 366 recovery time a-sma A in mature scar 366d recovery Relative paucity of (partic) inflammatory cells
26 HSC/MFBs express abundant TIMP-1 mrna, Macrophages express MMPs 12 and 13: in situ TIMP-1 MMP-12 MMP-13 MMP-13 N 4W 6W 8W 12W
27 Depletion of scar associated macrophages attenuates resolution of liver fibrosis Peak fibrosis 7d resolution: control 7d resolution: depletion x 100 x 100 x 100 Duffield JS et al, J Clin Invest 2005
28 Effect of conditional macrophage depletion on MMP-13 mrna: in situ hybridisation *p< Cells per 10 high power fields CCl CCl 4 CCl 4 + depletion control CCl CCl4 + depletion control Fallowfield et al JI 2007 Treatment CCl 4 + depletion
29 Fibrosis PROGRESSION RESOLUTION QUIESCENT HSC ACTIVATED HSC APOPTOTIC HSC TIMP-1 Number HSC TIMPs Collagen MMPase HEPATOCYTE KUPFFER CELL INFLAMMATORY CELL
30 Summary Progressive Fibrosis Proliferative response to hepatocyte damage Resolution of Fibrosis and Parench Renewal Proliferative response to hepatocyte damage Hepatocytes Intact Collagen-I Degraded Collagen-I Activated MFB MFBSurvival Collagen-I TIMP/MMP Balance MFB apoptosis Collagen-I Cell Renewal Block/vehicle Mø as regulator and?vehicle
31 Acknowledgements N.Henderson T.Sethi S.Hartland R.Aucott A.Pellicoro C.Benyon T.Gordon-Walker T.Kendall J.Fallowfield R. Issa F. Murphy S.Forbes J.Duffield S. Clay J.Savill J.Hughes R.Lang S.Krane I. Wanless MRC UK WMT BLT CLDF Bayer Ferring
Understanding Root Cause: Pathogenesis of Hepatic Fibrosis
10/1/12 Understanding Root Cause: Pathogenesis of Hepatic Fibrosis Hepatitis C Virus Mild inflammation Inflammation Fibrosis Cirrhosis 1 10/1/12 Non-alcoholic Fatty Liver Disease Steatosis Steatohepatitis
More informationcontributes to reversal of biliary fibrosis by Popov et al.
Supplementary data to MS Macrophage-mediated phagocytosis of apoptotic cholangiocytes contributes to reversal of biliary fibrosis by Popov et al. Supplementary table 1. Primers and probes used in quantitative
More informationSpontaneous Recovery From Micronodular Cirrhosis: Evidence for Incomplete Resolution Associated With Matrix Cross-Linking
GASTROENTEROLOGY 2004;126:1795 1808 Spontaneous Recovery From Micronodular Cirrhosis: Evidence for Incomplete Resolution Associated With Matrix Cross-Linking RAZAO ISSA,* XIAOYING ZHOU,* CHRISTOTHEA M.
More informationTissue repair. (3&4 of 4)
Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid
More informationSupplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β
Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β
More informationBile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool
Bile Acids and Liver Fibrosis Causative Agent and Therapeutic Tool Peter Fickert, Andrea Fuchsbichler, Tarek Moustafa, Gernot Zollner, Emina Halilbasic, Ulrike Stöger, Cord Langner, Helmut Denk, and Michael
More informationMechanisms of hepatic fibrogenesis in chronic liver disease
Mechanisms of hepatic fibrogenesis in chronic liver disease JPEMS 2014, Physiopathology Module Corentin Bessy (Nantes) _ Gabrielle Cepella (Amsterdam) _ Charly Gaisne (Angers) _ Gwladys Guilloineau (Angers)
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): The manuscript by Wu et al describes critical role of RNA binding protein CUGBP1 in the development of TGF-beta-mediated liver fibrosis. The activation
More informationConnective Tissue Response in IBD
Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control
More informationLaura Smart 9/22/2011
Laura Smart 9/22/2011 Fibrosis is a wound healing response in which damaged regions are encapsulated by an extracellular matrix or scar. Fibrosis develops in almost all patients with chronic liver injury
More informationModels of liver fibrosis: exploring the dynamic nature of inflammation and repair in a solid organ
Review series Models of liver fibrosis: exploring the dynamic nature of inflammation and repair in a solid organ John P. Iredale Medical Research Council/University of Edinburgh Centre for Inflammation
More informationStimulating healthy tissue regeneration by targeting the 5-HT 2B receptor in chronic liver disease.
Stimulating healthy tissue regeneration by targeting the 5-HT 2B receptor in chronic liver disease. Mohammad R Ebrahimkhani, Fiona Oakley, Lindsay B Murphy, Jelena Mann, Anna Moles, Maria J Perugorria,
More informationLiposome Mediated Delivery of sirna to Hepatic Stellate Cells Alfica Sehgal, Mohammad Zafari, Boris Klebanov, Greg Hinkle, Satya Kuchimanchi, Sarfraz
Liposome Mediated Delivery of sirn to Hepatic Stellate ells lfica Sehgal, Mohammad Zafari, oris Klebanov, Greg Hinkle, Satya Kuchimanchi, Sarfraz Shaikh, Martin Maier, Jonathan O Shea, Lauren Speciner,
More informationPathogenesis and treatment of hepatic fibrosis: is cirrhosis reversible?
Clinical Medicine 2011, Vol 11, No 2: 179 83 Pathogenesis and treatment of hepatic fibrosis: is cirrhosis reversible? Jonathan Fallowfield, Academy of Medical Sciences/Health Foundation clinician scientist
More informationNottingham Patterns of liver fibrosis and their clinical significance
Nottingham 2006 Patterns of liver fibrosis and their clinical significance Alastair D Burt Professor of Pathology and Dean of Clinical Medicine University of Newcastle upon Tyne Collapse of reticulin
More informationHealing & Repair. Tissue Regeneration
Healing & Repair Dr. Srikumar Chakravarthi Repair & Healing: Are they same? Repair :Regeneration of injured cells by cells of same type, as with regeneration of skin/oral mucosa (requires basement membrane)
More informationWHAT THE EXPERIMENTAL MODELS CAN TEACH US IN NAFLD/NASH? Claudio Tiribelli, MD PhD Scientific Director FIF
WHAT THE EXPERIMENTAL MODELS CAN TEACH US IN NAFLD/NASH? Claudio Tiribelli, MD PhD Scientific Director FIF ctliver@fegato.it Worldwide estimated prevalence of NAFLD distribution of PNPLA3 genotypes 2017-Younussi
More informationHepaRG LX2. HepaRG HepaRG LX2 LX2
C Supporting Figure 1. Experimental design of s between and cells. (A) -hepatocytes were isolated from a 30 days of -progenitors. Differentiation into mature hepatocytes was achieved following a 2-weeks
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationTissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science
Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration
More informationThe Enhancement of Toxin-Induced Liver Fibrosis in Fatty Liver Disease. Ekihiro Seki, M.D.,Ph.D. University of California San Diego
The Enhancement of Toxin-Induced Liver Fibrosis in Fatty Liver Disease Ekihiro Seki, M.D.,Ph.D. University of California San Diego - A manufactured chemical. - Does not exist naturally. Carbon tetrachloride
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationSupplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation
Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).
More informationIn the treatment of partial and full-thickness chronic wounds TRANSFORM YOUR APPROACH TO HEALING: SIGNAL THE BODY, NOT THE WOUND DERMA
In the treatment of partial and full-thickness chronic wounds TRANSFORM YOUR APPROACH TO HEALING: SIGNAL THE BODY, NOT THE WOUND DERMA It s time to signal a new direction in chronic wound treatment. WHY
More informationLiver fibrosis and its endstage, cirrhosis, represent
Elastin Accumulation Is Regulated at the Level of Degradation by Macrophage Metalloelastase (MMP-12) During Experimental Liver Fibrosis Antonella Pellicoro, 1 Rebecca L. Aucott, 1 Prakash Ramachandran,
More informationΑνάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο
Ανάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο ΔΗΜΗΤΡΙΟΣ Σ. ΓΟΥΜΕΝΟΣ Νεφρολογικό και Μεταμοσχευτικό Κέντρο Πανεπιστημιακό Νοσοκομείο Πατρών Causes of chronic
More informationStudy Design to Validate Biomarkers of Therapeutic Response in NASH Due to Cirrhosis
Study Design to Validate Biomarkers of Therapeutic Response in NASH Due to Cirrhosis Detlef Schuppan Institute of Translational Immunology and Research Center for Immune Therapy, University Medical Center
More informationLiver Fibrosis: Which Mechanisms Matter?
REVIEW Liver Fibrosis: Which Mechanisms Matter? Ralf Weiskirchen, Ph.D.,* and Frank Tacke, M.D., Ph.D. HEPATIC FIBROSIS Historically, fibrosis was defined by a World Health Organization expert group in
More informationFigure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B)
Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) PCR identified expected hhb-egf band (left panel) and HA tag band (right) in kidneys of transgenic (TG) mice
More informationMacrophage derived Wnt signalling opposes Notch signalling in a Numb mediated manner to specify HPC fate in chronic liver disease in human and mouse.
Macrophage derived Wnt signalling opposes Notch signalling in a Numb mediated manner to specify HPC fate in chronic liver disease in human and mouse. Luke Boulter, Olivier Govaere, Tom G Bird, Sorina Radulescu,
More informationApoptosis of hepatic stellate cells: involvement in resolution of biliary fibrosis and regulation by soluble growth factors
548 Liver Research Group, Division of Cell and Molecular Medicine, Level D, South Lab and Path Block, Southampton General Hospital, Southampton, UK R Issa E Williams NTrim T Kendall MJPArthur R C Benyon
More informationExpression of MMPs and TIMPs in liver fibrosis a systematic review with special emphasis on anti-fibrotic strategies
Journal of Hepatology 46 (2007) 955 975 Special article Expression of MMPs and TIMPs in liver fibrosis a systematic review with special emphasis on anti-fibrotic strategies Stefanie Hemmann 1,Jürgen Graf
More informationAvailable online at
Available online at www.annclinlabsci.org Annals of Clinical & Laboratory Science, vol. 45, no. 6, 2015 669 Galectin-3 Concentration in Liver Diseases Monika Gudowska 1, Ewa Gruszewska 1, Bogdan Cylwik
More informationUniversity of Groningen
University of Groningen Broad-spectrum matrix metalloproteinase inhibition curbs inflammation and liver injury but aggravates experimental liver fibrosis in mice de Meijer, Vincent E.; Sverdlov, Deanna
More informationPathophysiology of heart failure with preserved ejection fraction. Extracellular matrix
Pathophysiology of heart failure with preserved ejection fraction Extracellular matrix Javier Díez, MD, PhD. Full Professor of Cardiovascular Medicine and Director Division of Cardiovascular Sciences Centre
More informationMark D Gorrell Sumaiya Chowdhury, Fiona Keane, Stephen Twigg, Geoff McCaughan
The protease fibroblast activation protein [FAP] as a biomarker and therapeutic target in chronic liver injury Mark D Gorrell Sumaiya Chowdhury, Fiona Keane, Stephen Twigg, Geoff McCaughan A.W. Morrow
More informationAbnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9
Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S1A9 Joanna Nikitorowicz-Buniak UCL Division of Medicine Systemic sclerosis
More informationRelaxin inhibits evective collagen deposition by cultured hepatic stellate cells and decreases rat liver fibrosis in vivo
Gut 21;49:577 583 577 Liver Research Group, Division of Cell and Molecular Medicine, D Level, South Academic Block, Southampton General Hospital, Southampton, UK E J Williams R C Benyon NTrim R Hadwin
More informationSupplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
More informationNovel therapeutic approach for kidney fibrosis
University of Sydney Novel therapeutic approach for kidney fibrosis DAVID HARRIS 30/09/17 Westmead Hospital Cadnapaphornchai CJASN 2014;9:889 Liraglutide: Renal Outcomes Mann JFE et al. N Engl J Med 2017;377:839-848
More informationEARLY INFLAMMATORY RESPONSES TO VASCULAR DEVICES
EARLY INFLAMMATORY RESPONSES TO VASCULAR DEVICES JAMES M. ANDERSON, MD, PhD DISTINGUISHED UNIVERSITY PROFESSOR DEPARTMENTS OF PATHOLOGY, MACROMOLECULAR SCIENCE, AND BIOMEDICAL ENGINEERING CASE WESTERN
More informationLung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy
7th to 10th Nov. 2016 Minatec-Grenoble, France. Lung Remodeling After Pulmonary Exposure of Mice to Cerium oxide Nanoparticles - Role of Autophagy Balasubramanayam Annangi bala.annangi@inserm.fr 10 th
More informationSupplementary Figure 1: Lgr5 expression in liver was induced by CCL4 and decreased after liver recovery. Mice were treated with single dose of CCL4
Supplementary Figure 1: Lgr5 expression in liver was induced by CCL4 and decreased after liver recovery. Mice were treated with single dose of CCL4 or control oil, the livers were collected at various
More informationDIA Oligonucleotide-Based Therapeutics Conference
DIA Oligonucleotide-Based Therapeutics Conference North Bethesda MD October 25-27 Translating PD Biomarkers From Preclinical Studies to Clinical Trials: MRG-201, an Oligonucleotide Mimic of mir- 29, Inhibits
More informationSPHINGOSINE 1-PHOSPHATE SIGNALLING
OPTIMISING STEM CELL THERAPY FOR LIVER DISEASE THROUGH MODULATION OF SPHINGOSINE 1-PHOSPHATE SIGNALLING by ANDREW LAURENCE KING A thesis submitted to the University of Birmingham for the degree of Doctor
More informationAfter this presentation and discussion, the participants should be able to:
Tissue Repair Robert F. Diegelmann, Ph.D. OBJECTIVES After this presentation and discussion, the participants should be able to: 1. Define the biochemical responses to tissue injury 2. Describe the mechanisms
More informationOriginal Article Epigenetic histone methylation regulates MMP-1 expression in myofibroblastic hepatic stellate cell
Int J Clin Exp Med 2017;10(11):15187-15195 www.ijcem.com /ISSN:1940-5901/IJCEM0055752 Original Article Epigenetic histone methylation regulates MMP-1 expression in myofibroblastic hepatic stellate cell
More informationNASH Bench to Bedside
NASH Bench to Bedside October 2006 Anna Mae Diehl, M.D. Gastroenterology Division Duke University NonAlcoholic Fatty Liver Disease Common ~1/4-1/3 1/3 US adults Outcome highly variable Course indolent
More informationPortal Fibroblasts in Biliary Fibrosis
Curr Pathobiol Rep (2014) 2:185 190 DOI 10.1007/s40139-014-0054-y MYOFIBROBLAST (TATIANA KISSELEVA, SECTION EDITOR) Portal Fibroblasts in Biliary Fibrosis Rebecca G. Wells Published online: 14 September
More informationMSC-derived exosomes: a novel possible treatment for liver fibrosis
MSC-derived exosomes: a novel possible treatment for liver fibrosis Essay Lotte Dietz Supervised by Marco Harmsen S2250853 Master Biology, Neuro- and behavioural track (started sept 2014) December 2016
More informationRegenerative Tissue Matrix in Treatment of Wounds
Regenerative Tissue Matrix in Treatment of Wounds Learning Objectives Differentiate between reparative and regenerative healing Review surgical techniques for applying a regenerative tissue scaffold to
More informationBile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response. Supplementary Results
Bile acids initiate cholestatic liver injury by triggering a hepatic specific inflammatory response Shi-Ying Cai 1, Xinshou Ouyang 1, Yonglin Chen 1, Carol J. Soroka 1, Juxian Wang 2, Albert Mennone 1,
More informationTopical nanocrystalline silver cream inhibits expression of matrix metalloproteinase-9 in animal models of allergic contact dermatitis.
Topical nanocrystalline silver cream inhibits expression of matrix metalloproteinase-9 in animal models of allergic contact dermatitis. K C Bhol, P J Schechter NUCRYST Pharmaceuticals Inc, Wakefield, MA
More informationWhere a licence is displayed above, please note the terms and conditions of the licence govern your use of this document.
Stabilin-1 expression defines a subset of macrophages that mediate tissue homeostasis and prevent fibrosis in chronic liver injury Rantakari, Pia; Patten, Daniel; Valtonen, Joona; Karikoski, Marika; Gerke,
More informationMesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis
Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis Yukinori Koyama,, David A. Brenner, Tatiana Kisseleva J Clin Invest. 2017;127(4):1254-1270. https://doi.org/10.1172/jci88845.
More informationInterleukin-20 is associated with delayed healing in diabetic wounds
Interleukin-20 is associated with delayed healing in diabetic wounds Phillip Finley, PhD Integrated and Applied Sciences Program Biology and Statistics/Research Methodology Normal Healing Body s natural
More informationAbout OMICS Group Conferences
About OMICS Group OMICS Group International is an amalgamation of Open Access publications and worldwide international science conferences and events. Established in the year 2007 with the sole aim of
More informationLiver 102: Injury and Healing
Liver 102: Injury and Healing Dawn Pease, MSN, RN, ANP-BC Brackenridge Specialty Clinics University Medical Center Brackenridge Austin, TX Seton Healthcare Family Liver 102 Outline Biochemical patterns
More informationDiverse functions of matrix metalloproteinases during fibrosis
2014. Published by The Company of Biologists Ltd (2014) 7, 193-203 doi:10.1242/dmm.012062 REVIEW Diverse functions of matrix metalloproteinases during fibrosis Matthew Giannandrea 1 and William C. Parks
More informationSupplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained
Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained with MitoTracker (red), then were immunostained with
More informationAddressing liver fibrosis with lipid-based drug carriers targeted to hepatic stellate cells Adrian, Joanna Ewa
University of Groningen Addressing liver fibrosis with lipid-based drug carriers targeted to hepatic stellate cells Adrian, Joanna Ewa IMPORTANT NOTE: You are advised to consult the publisher's version
More informationHealing and Repair. Dr. Nabila Hamdi MD, PhD
Healing and Repair Dr. Nabila Hamdi MD, PhD 1 ILOs Know the classification of human cells according to their ability for proliferation. Understand the mechanism of cellular regeneration. Identify the types
More informationForward-looking Statements
NASDAQ:CNAT Forward-looking Statements This presentation contains forward-looking statements. All statements other than statements of historical facts contained in this presentation, including statements
More informationSupplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
More informationRegulator of G-protein signaling 5 is expressed in hepatic stellate cells. and moderates the fibrotic response to injury. Arya J.
Regulator of G-protein signaling 5 is expressed in hepatic stellate cells and moderates the fibrotic response to injury Arya J. Bahrami A dissertation submitted in partial fulfillment of the requirements
More informationPage 39 of 44. 8h LTA & AT h PepG & AT h LTA
Page 39 of 44 Fig. S1 A: B: C: D: 8h LTA 8h LTA & AT7519 E: F: 8h PepG G: 8h PepG & AT7519 Fig. S1. AT7519 overrides the survival effects of lipoteichoic acid (LTA) and peptidoglycan (PepG). (A) Human
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationFibrosis is a highly conserved response to hepatic
NEW HORIZONS Hepatic Inflammation and Fibrosis: Functional Links and Key Pathways Ekihiro Seki 1,2 and Robert F. Schwabe 3,4 Inflammation is one of the most characteristic features of chronic liver disease
More informationc Ischemia (30 min) Reperfusion (8 w) Supplementary Figure bp 300 bp Ischemia (30 min) Reperfusion (4 h) Dox 20 mg/kg i.p.
a Marker Ripk3 +/ 5 bp 3 bp b Ischemia (3 min) Reperfusion (4 h) d 2 mg/kg i.p. 1 w 5 w Sacrifice for IF size A subset for echocardiography and morphological analysis c Ischemia (3 min) Reperfusion (8
More informationEvaluation of the wound healing response post - deep dermal heating by fractional RF: INTRACEL
12th symposium of the Association of Korean Dermatologists (2009) 1 Evaluation of the wound healing response post - deep dermal heating by fractional RF: INTRACEL Un-Cheol.Yeo, MD S&U Dermatologic Clinic,
More information3D in vitro modelling using material from the Breast Cancer Now Tissue Bank
@QMBCI bartscancerinstitute 3D in vitro modelling using material from the Breast Cancer Now Tissue Bank Richard Grose Barts Cancer Institute Ed Carter Normal Breast Architecture Calponin / CK8 Myoepithelial
More informationFigure S1. IRF5 mrna expression is not expressed modulated by steatosis grade in
9-INS-RG-TR- SUPPLEMENTRY MTERILS B IRF mrn expression 1 Control Fatty liver NSH HCV αsm IRF 1 ERG IRF < -33 33- Steatosis (%) < Figure S1. IRF mrn expression is not expressed modulated by steatosis grade
More informationClinical Trials & Endpoints in NASH Cirrhosis
Clinical Trials & Endpoints in NASH Cirrhosis April 25, 2018 Peter G. Traber, MD CEO & CMO, Galectin Therapeutics 2018 Galectin Therapeutics NASDAQ: GALT For more information, see galectintherapeutics.com
More informationNiki Prakoura. Calreticulin upregulation in renal fibrosis
Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,
More informationAs outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the
3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing
More informationNonalcoholic Fatty Liver Disease in Children: Typical and Atypical
Nonalcoholic Fatty Liver Disease in Children: Typical and Atypical Disclosure Naim Alkhouri, MD discloses the following relationships with commercial companies: Membership in the Speakers Bureau for Alexion
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationLong term stability of isolated human serum derived exosomes
Long term stability of isolated human serum derived exosomes Candice de Boer (PhD student) Regenerative Medicine Laboratory Supervisor: Associate Professor Neil Davies Exosomes First discovered during
More informationNon-Invasive Assessment of Liver Fibrosis. Patricia Slev, PhD University of Utah Department of Pathology
Non-Invasive Assessment of Liver Fibrosis Patricia Slev, PhD University of Utah Department of Pathology Disclosure Patricia Slev has no relevant financial relationships to disclose. 2 Chronic Liver Disease
More informationEvaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel
12th symposium of the Association of Korean Dermatologists (2009) 1 Evaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel Un-Cheol.Yeo, M.D. S&U Dermatologic Clinic,
More informationIncreases in p53 expression induce CTGF synthesis by mouse and human hepatocytes and result in liver fibrosis in mice
Research article Increases in p53 expression induce CTGF synthesis by mouse and human hepatocytes and result in liver fibrosis in mice Takahiro Kodama, 1 Tetsuo Takehara, 1 Hayato Hikita, 1 Satoshi Shimizu,
More informationTHE BIOLOGY OF PLATELET-GEL THERAPY
THE BIOLOGY OF PLATELET-GEL THERAPY The synopsis of normal healing includes a well known sequence of coordinated phases. The unique process leading to healing is ontologically partitioned in three sequential
More informationPathology MCQs. lipid. protein. glycogen. lipofuscin. water. Karyolysis. Cellular swelling. Involvement of a large number of cells
Pathology MCQs 1. In hypoxic cell injury, cell swelling occurs because of increased intracellular: lipid protein glycogen lipofuscin water 2. Which of the following is a feature of apoptosis? Karyolysis
More informationSupplementary Figure 1
Supplementary Figure 1 A B mir-141, human cell lines mir-2c, human cell lines mir-141, hepatocytes mir-2c, hepatocytes Relative RNA.1.8.6.4.2 Relative RNA.3.2.1 Relative RNA 1.5 1..5 Relative RNA 2. 1.5
More informationMesenchymal Stem Cell-Dependent Modulation of Liver Diseases
1109 Review Ivyspring International Publisher International Journal of Biological Sciences 2017; 13(9): 1109-1117. doi: 10.7150/ijbs.20240 Mesenchymal Stem Cell-Dependent Modulation of Liver Diseases Marina
More informationAnalysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats
Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Summary of Doctoral Thesis Hidenori Yasuda Graduate School of Veterinary
More informationIn vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell
Supplementary Methods BrdU incorporation in vivo In vivo bromodeoxyuridine (BrdU) incorporation was performed to analyze cell proliferation in the heart. Mice were subjected to LI-TAC, and 5 days later
More informationMARK AARON BARNES, JR. Submitted in partial fulfillment of the requirements. For the degree Doctor of Philosophy
MACROPHAGE MIGRATION INHIBITORY FACTOR AND LIVER DISEASE: THE ROLE OF MIF IN ALCOHOL-INDUCED LIVER INJURY AND CARBON TETRACHLORIDE (CCI 4 )-INDUCED LIVER FIBROSIS by MARK AARON BARNES, JR Submitted in
More informationImmunology of Wound Healing
Immunology of Wound Healing Danielle Tartar, MD, PhD Assistant Clinical Professor Interim Director of Inpatient Dermatology University of California - Davis Outline Traditional model of wound healing Role
More informationStudy of Zinc in Cirrhosis of Liver
74 Clinical Study Study of Zinc in Cirrhosis of Liver Kaushik Kar, Assistant Professor, Gorachand Bhattyacharya, Professor Department of Biochemistry, Calcutta National Medical College, Kolkata. Jayanta
More informationSupplementary table I. Real-time primers used in the study. The fold change was obtained by
Supplementary table I. Real-time primers used in the study. The fold change was obtained by normalizing the gene expression number to those of HPRT, then comparing the samples to untreated or naive mice.
More information* Author to whom correspondence should be addressed; Tel.: ; Fax:
Cancers 2014, 6, 1220-1255; doi:10.3390/cancers6031220 Review OPEN ACCESS cancers ISSN 2072-6694 www.mdpi.com/journal/cancers Fibrogenesis and Carcinogenesis in Nonalcoholic Steatohepatitis (NASH): Involvement
More informationCHAPTER 2 LITERATURE REVIEW
CHAPTER 2 LITERATURE REVIEW 2.1 MAJOR COMPONENTS OF THE LIVER 2.1.1 The Hepatocytes 2.1.2 Liver Sinusoidal Cells 2.1.3 Liver Endothelial Cells 2.1.4 Kupffer Cells 2.1.5 Hepatic Stellate Cells 2.2 LIVER
More informationLiver cirrhosis as a consequence of many forms of
GASTROENTEROLOGY 2011;140:1642 1652 Tissue Transglutaminase Does Not Affect Fibrotic Matrix Stability or Regression of Liver Fibrosis in Mice YURY POPOV,* DEANNA Y. SVERDLOV,* ANISHA K. SHARMA,* K. RAMAKRISHNAN
More informationSupplementary Figure 1
CD31 FN Supplementary Figure 1 a Multivariate Cox regression analysis of predicting factors for disease-free and overall survival in 435 HNSCC patients b FN staining in whole sections of HNSCC c FN expression
More informationI.O.D.A.S. - "VASILE GOLDIS" Western University of Arad DOCTORAL SCHOOL OF BIOLOGY
I.O.D.A.S. - "VASILE GOLDIS" Western University of Arad DOCTORAL SCHOOL OF BIOLOGY Arad, 2018 I.O.D.A.S.- "VASILE GOLDIS" Western University of Arad DOCTORAL SCHOOL OF BIOLOGY SUMMARY DOCTORAL THESIS Arad,
More informationPAI-1 deficiency reduces liver fibrosis after bile duct ligation in mice through activation of tpa
FEBS Letters 581 (2007) 3098 3104 PAI-1 deficiency reduces liver fibrosis after bile duct ligation in mice through activation of tpa Hongtao Wang a, Yan Zhang b,c, Robert O. Heuckeroth a, * a Division
More informationLiver fibrosis represents a wound-healing process
Inhibition of Phosphatidylinositol 3-Kinase Signaling in Hepatic Stellate Cells Blocks the Progression of Hepatic Fibrosis Gakuhei Son, 1 Ian N. Hines, 1 Jeff Lindquist, 1 Laura W. Schrum, 2 and Richard
More informationAntifibrotic therapy: between hopes and reality. Fabio Marra Dipartimento di Medicina Sperimentale e Clinica University of Florence, Italy
Antifibrotic therapy: between hopes and reality Fabio Marra Dipartimento di Medicina Sperimentale e Clinica University of Florence, Italy Disclosures Abbvie: consultant fees AstraZeneca: consultant fees
More informationBiologics in ACL: What s the Data?
Biologics in ACL: What s the Data? Jo A. Hannafin, M.D., Ph.D. Professor of Orthopaedic Surgery, Weill Cornell Medical College Attending Orthopaedic Surgeon and Senior Scientist Sports Medicine and Shoulder
More information