Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A.
|
|
|
- Lesley Cunningham
- 6 years ago
- Views:
Transcription
1 Supplementary Figure 1. Genotyping strategies for Mcm3 +/+, Mcm3 +/Lox and Mcm3 +/- mice and luciferase activity in Mcm3 +/Lox mice. A. Upper part, three-primer PCR strategy at the Mcm3 locus yielding a 225 bp product in the wild-type allele and a 714 bp product in the Mcm3-Lox allele. Arrows indicate primer positions. Bottom part, genotyping examples of eight mice, of which #2 and #4 are Mcm3 +/Lox. B. Upper part, three-primer strategy yielding a 693 bp product in the wild-type Mcm3 allele and a 385 bp product in the Mcm3-null allele. Bottom part, genotyping examples of 10 mice, of which #1 to #7 were Mcm3 +/-. C. Top, bioluminescent signal in internal organs of Mcm3 +/Lox mice. Bottom, MCM3 protein level determined by immunoblot in extracts prepared from the same tissues. MEK2 levels are shown as reference. Full immunoblots are shown in Supplementary Fig. 9B. Tissue code: 1, pancreas; 2, small intestine; 3, testis; 4, spleen; 5, large intestine; 6, kidney; 7, liver; 8, seminal vesicle; 9, lung; 10, bladder; 11, stomach; 12, heart.
2 Supplementary Figure 2. Complete mrna sequencing of the Mcm3-Lox allele. A. Schematic representation of the Mcm3-Lox mrna. Left, PCR reactions confirming the presence of Mcm3-Lox mrna only in MEFs of Mcm3 +/Lox and Mcm3 Lox/Lox genotype. Right, PCR reactions showing amplification of three overlapping cdna fragments used for sequencing. B. Alignment of the experimental mrna-derived Mcm3-Lox sequence with the murine Mcm3 NCBI reference sequence (NM_ ) and the targeting vector used for mouse generation. Only the last four exons are shown for clarity. Numbers are positions from ATG (+1). The experimental sequence was identical
3 (100%) to that of the targeting vector. One silent point mutation (G-T) at position 2351 (highlighted in yellow) was found in both the experimental and vector sequences, relative to the reference sequence. The corresponding amino acid in MCM3 protein (Phe784) remained invariant. C. Alignment of the corresponding protein sequences. Numbers indicate positions from the +1 Met amino acid.
4 Supplementary Figure 3. DNA replication with reduced activation of dormant origins in Mcm3 Lox/Lox MEFs. A. BrdU incorporation profiles in Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox MEFs. The percentage of cells in the G1, S and G2/M phases of the cell cycle are indicated. B. Proliferation curves of Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox MEFs. Error bars represent SD of duplicates. C. Top left, outline of the experiment. MEFs were sequentially labeled with CldU (red) and IdU (green), in the absence or presence of 0.5 µm aphidicolin. Top right, schematic of a DNA molecule with two active origins, representing the fibers used to measure inter-origin distance (IOD). Bottom left, quantification of IOD of Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox MEFs. Median IOD values are indicated ( IODs scored for each condition). Experiments were done in triplicate and statistical analysis was done with Fisher s test (** p<0.01; n.s. not significant). Bottom right, fiber examples. Scale bar, 10 μm. D. Confocal microscopy images of H2AX nuclear staining in Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox MEFs. Scale bar, 2.5 m. Right, quantification of H2AX nuclear intensity. Red lines indicate the median value (>700 nuclei scored per condition). Data are representative of 3 independent experiments. P-values were calculated by Mann-Whitney test (*** p<0.001; ns, not significant).
5 Supplementary Figure 4. Low expression of Mcm3 in the fetal liver of Mcm3 Lox/Lox embryos. A. Mcm3 mrna expression in the fetal liver of Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox embryos, as determined by qrt-pcr. Histogram bars represent average value SD of 3 independent experiments. B. Immunoblots showing total MCM3, H2AX and ps15-p53 protein levels in fetal liver extracts. For accurate comparisons, different amounts of each extract were loaded. In each SDS-PAGE, MEK2 levels are shown as loading control. Full immunoblots are shown in Supplementary Fig. 9C. C. Top, IHC detection of MCM3 protein in Mcm3 +/+, Mcm3 +/Lox and Mcm3 Lox/Lox wholeembryo (E16.5) sections. Scale bar, 5 mm. Lower panels, IHC of MCM3 and Ki67 and H2AX in the fetal liver. Scale bar, 25 M. Signal quantifications represents stainingpositive area (average value SD) in the fetal liver of Mcm3 +/+ (n=4 for MCM3, n=2 for Ki67); Mcm3 +/Lox (n=5 for MCM3, n=2 for Ki67) and Mcm3 Lox/Lox (n=5 for MCM3, n=2 for Ki67) embryos. P-values were calculated by Fisher s test (***p<0.001; n.s. not significant).
6 Supplementary Figure 5. IHC stainings of mature hematopoietic populations in fetal liver and thymus. IHC stainings of B-lymphocytes (Pax5), megakaryocytes (FVIII) and T-lymphocytes (CD3) in MCM3 +/+, MCM3 +/Lox and MCM3 Lox/Lox whole embryos. Scale bar, 5 mm. Magnifications show Pax5 and FVIII staining in the fetal liver and CD3 staining in the fetal thymus. Scale bar, 50 m.
7 Supplementary Figure 6. Detection of activated caspase 3 in Mcm3 Lox/Lox EBs. A. Examples of cytometric detection of activated caspase 3 (C3A) in R1-R5 EBs previously gated using CD71/Ter119. See Materials and Methods for details. B. Quantification of the percentage of C3A-positive cells in each population (n=5 Mcm3 +/+, n=6 Mcm3 +/Lox, n=6 Mcm3 Lox/Lox. * denotes p< 0.05 in One-way Anova test).
8 Supplementary Figure 7. Quantification of DNA fiber length in the experiments shown in Main Figure 5. Box-plot representation of DNA fiber lengths. A minimum of 200 fibers labeled with at least one replication structure (origin/fork/termination) were counted in each condition. The median value of fiber length is indicated in each case.
9 Supplementary Figure 8. Partial rescue of Mcm3 Lox/Lox embryonic lethality by Chk1 overexpression. A. Percentages of mice of the indicated genotypes (obtained/expected) derived from continued breeding of Mcm3 +/Lox : Chk1 +/Tg mice. B. Immunoblots showing MCM3 protein levels in whole fetal liver extracts of Mcm3 +/+, Mcm3 +/Lox, Mcm3 Lox/Lox embryos in the Chk1 +/Tg genetic background. The amount of MCM3 protein in Mcm3 Lox/Lox extracts is comparable to that of the C57BL/6 background, shown in Supplementary Fig. 4. Full immunoblots are shown in Supplementary Fig. 9D.
10 Supplementary Figure 9. Full immunoblots. This figure includes larger areas of the immunoblots corresponding to (A) Figure 1F; (B) Supplementary Figure 1C; (C) Supplementary Figure 4B; (D) Supplementary Figure 8B. Dashed boxes correspond to the area shown in the main figures.
11 Case Age (months) Diagnosis Location IHC BBG Lymphoma BBG115 30,5 Lymphoma Liver Lymphatic gland Kidney Adenomatous hyperplasia Thyroid BBG Follicular lymphoma Infiltration Lung Follicular adenoma Thyroid Epithelial hyperplasia Skin Polyp Intestine BBG Histiocytic sarcoma BBG193 27,5 Lymphoma Lymphoma infiltration Adipose tissue BBG Adenocarcinoma Harderian gland BBG621 18,5 Bronchioalveolar adenocarcinoma (II) Lung Hyperplasia Forestomach BBG Lymphoma Peripancreatic gland Supplementary Table 1. Summary of tumor incidence in MCM3 +/+ mice.
12 Case Age (months) Diagnosis Location IHC BBG51* 30 Adenocarcinoma Lung Hepatocarcinoma Liver Skin BBG52* 30 Histiocytic sarcoma Stomach Lung Lymphatic gland BBG54* 33 Histiocytic sarcoma Liver BBG55* 33 Histiocytic sarcoma Liver F4/80 Mesenteric glanglion Kidney BBG60* 28 Lymphoma PAX5/ CD3/ F4/80 BBG66* 22 Lymphoma BBG137* 23 Histiocytic sarcoma Liver CD3/ F4/80 Mesenteric glanglion BBG145* 26 Lymphoma Adipose tissue BBG150* 22 Adenocarcinoma Mammary gland BBG170* 28 Angiosarcoma Lymphatic glands Mesenteric glanglion BBG177* 23 Lymphoma Ureter Thymus Lung Bone marrow PAX5/ CD3 BBG181* 25 Lymphoma Liver Mesenteric ganglion Kidney BBG190* 25 Lymphoma Adenocarcinoma Lung BBG202* 21 Papilloma Stomach BBG203* 21 Lymphoma
13 Mesenteric ganglion Pancreas Lung Lymphoma Adipose tissue BBG235* 28 Mammary gland Hepatocarcinoma Liver Adenoma Small intestine Thyroid BBG261* 20 Lymphoma PAX5 Mesenteric ganglion PAX5/ CD3 BBG295* 20 Lymphoma Kidney Lung Mammary gland Lipoma Adipose tissue BBG Follicular hyperplasia Thyroid Bone CD31 BBG340* 20 Angiosarcoma Adipose tissue Lymphoma Adipose tissue Lymphatic glands Pancreas BBG Intestine Papilloma Stomach Adenomatous hyperplasia Thyroid Cystic hyperplasia Endometrium BBG Lymphoma Bone marrow Prostate Epididyme Lymphoma BBG Bone marrow Follicular hyperplasia Thyroid Adipose tissue BBG Leiomyosarcoma Skin Actin /p-p53
14 Histiocytic sarcoma Muscle F4/80 /CD3 BBG Adenoma Thyroid Lipoma Adipose tissue Supplementary Table 2. Summary of tumor incidence in MCM3 +/Lox and MCM3 +/Lox-Neo (*) mice.
15 Case Age (months) Diagnosis Location IHC Lymphatic glands Lymphoma Liver BBG111 30,5 Adrenal hyperplasia Kidney Papilloma Stomach Serous cystadenome Uterus Adenomatous hyperplasia Small intestine Peripancreatic gland CD3/ PAX5/ F4/80 Kidney Lymphoma Liver BBG Lung Folicular hyperplasia Thyroid gland Prostate hyperplasia Prostate BBG Adenocarcinoma Lung Lymphoma Pancreas CD3/ PAX5 BBG Follicular adenoma, mesenteric and thoracic CD3/ PAX5 ganglions Ductal hyperplasia Mammary gland BBG Adenocarcinoma Lung Hyperplasia Thyroid BBG Mesothelioma Mesenteric ganglion Hyperplasia Thymus BBG464 17,5 Lymphoma Peripancreatic gland BBG Hepatocarcinoma Liver Adenoma Small intestine Liver Adipose tissue BBG Histiocytic sarcoma Lung (B-cell type) Lymphatic ganglions Testis Bladder BBG Lymphoma Intestine
16 Liver Adrenal hyperplasia Kidney Hyperplasia Bladder Myeloid hyperplasia Bone Marrow Adenoma Thyroid/ Parathyroid BBG Hyperplasia (Leydig cells) Testis Pax5 BBG Lymphoma Lymphatic glands Adipose tissue Cholangioma Liver Cytokeratin 19/ CD31 BBG689 17,5 Lymphoma Kidney Follicular hyperplasia Thyroid BBG943 15,5 Hyperplasia Stomach Supplementary Table 3. Summary of tumor incidence in MCM3 +/- mice.
17 Allele Primer name Sequence (5 3 ) 1 GTGTCTGAGGGCATCGTCTT Mcm3-Lox 2 CCTCACAAGCCCAATCCTAA 3 GCAAGCTGACCCTGAAGTTC M TGCCTATGGCTCATCTGAAGAACTGC Mcm3-null 2 CCTCACAAGCCCAATCCTAA 4 TCTCCCAGTGTTCTTGAGGC Supplementary Table 4. Oligonucleotide primers used for mice genotyping. Gene Primer Sequence (5 3 ) Mcm3 MCM3-Fw TTCCTCAGCTGTGTGGTCTG MCM3-Rv TCACCACCCTAGTGGCTTTC Gapdh GAPDH-Fw TGAAGCAGGCATCTGAGGG GAPDH-Rv CGAAGGTGGAAGAGTGGGAG Supplementary Table 5. Oligonucleotide primers used for qrt-pcr. Gene Primer Sequence (5 3 ) Fw1 ATTTCGGAGCTGCGAC Fw3 CCATCACCATCCAGGAGATG Fw4 AAGCTGGTGCTATGGTCCTG Mcm3 Fw6 CGTTTCCGGACTGTTTGGT Rv2 CGATTCTTAAGTGATACTTGGTAGC Rv3 AGCAGAGGATTGCCTTCTTG Rv4 GAACTACCCAATGGCAAAGC Supplementary Table 6. Oligonucleotide primers for used for DNA sequencing.
SUPPLEMENTARY FIGURE LEGENDS
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Hippocampal sections from new-born Pten+/+ and PtenFV/FV pups were stained with haematoxylin and eosin (H&E) and were imaged at (a) low and (b) high
SUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
MT09 - Normal Human Tissue Microarray, FDA
Reveal Biosciences offers Histochemical Staining, Immunohistochemistry (IHC), In Situ Hybridization (ISH), Whole Slide Imaging, and Quantitative Image Analysis on any TMA MT09 - Normal Human Tissue Microarray,
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
The autoimmune disease-associated PTPN22 variant promotes calpain-mediated Lyp/Pep
SUPPLEMENTARY INFORMATION The autoimmune disease-associated PTPN22 variant promotes calpain-mediated Lyp/Pep degradation associated with lymphocyte and dendritic cell hyperresponsiveness Jinyi Zhang, Naima
fl/+ KRas;Atg5 fl/+ KRas;Atg5 fl/fl KRas;Atg5 fl/fl KRas;Atg5 Supplementary Figure 1. Gene set enrichment analyses. (a) (b)
KRas;At KRas;At KRas;At KRas;At a b Supplementary Figure 1. Gene set enrichment analyses. (a) GO gene sets (MSigDB v3. c5) enriched in KRas;Atg5 fl/+ as compared to KRas;Atg5 fl/fl tumors using gene set
AP VP DLP H&E. p-akt DLP
A B AP VP DLP H&E AP AP VP DLP p-akt wild-type prostate PTEN-null prostate Supplementary Fig. 1. Targeted deletion of PTEN in prostate epithelium resulted in HG-PIN in all three lobes. (A) The anatomy
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic
Supplementary Figure 1: Expression of NFAT proteins in Nfat2-deleted B cells (a+b) Protein expression of NFAT2 (a) and NFAT1 (b) in isolated splenic B cells from WT Nfat2 +/+, TCL1 Nfat2 +/+ and TCL1 Nfat2
(a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable
Supplementary Figure 1. Frameshift (FS) mutation in UVRAG. (a) Schematic diagram of the FS mutation of UVRAG in exon 8 containing the highly instable A 10 DNA repeat, generating a premature stop codon
(A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC,
Supplemental Figure Legends Figure S1. Cell line characterization (A) Cells grown in monolayer were fixed and stained for surfactant protein-c (SPC, green) and co-stained with DAPI to visualize the nuclei.
stability and tumor suppression
Supplementary information The stress kinase MKK7 couples oncogenic stress to p53 stability and tumor suppression Daniel Schramek 1, Athanassios Kotsinas 2, Arabella Meixner 1, Teiji Wada 1, Ulrich Elling
Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.
Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.
Supporting Information Table of Contents
Supporting Information Table of Contents Supporting Information Figure 1 Page 2 Supporting Information Figure 2 Page 4 Supporting Information Figure 3 Page 5 Supporting Information Figure 4 Page 6 Supporting
SUPPLEMENTARY FIGURES AND TABLE
SUPPLEMENTARY FIGURES AND TABLE Supplementary Figure S1: Characterization of IRE1α mutants. A. U87-LUC cells were transduced with the lentiviral vector containing the GFP sequence (U87-LUC Tet-ON GFP).
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus
Supplementary Fig. 1. GPRC5A post-transcriptionally down-regulates EGFR expression. (a) Plot of the changes in steady state mrna levels versus changes in corresponding proteins between wild type and Gprc5a-/-
SHN-1 Human Digestive Panel Test results
SHN-1 Human Digestive Panel Test results HN-30 tongue HN-24 salivary gland HN-12 larynx HN-28 esophagus HN-29 stomach HN-20 pancreas HN-13 liver HN-14 gall bladder HN-27-1 duodenum HN-27-2 ileum HN-27-3
Supplementary Figure 1. Double-staining immunofluorescence analysis of invasive colon and breast cancers. Specimens from invasive ductal breast
Supplementary Figure 1. Double-staining immunofluorescence analysis of invasive colon and breast cancers. Specimens from invasive ductal breast carcinoma (a) and colon adenocarcinoma (b) were staining
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis
Supplementary Figure 1: STAT3 suppresses Kras-induced lung tumorigenesis (a) Immunohistochemical (IHC) analysis of tyrosine 705 phosphorylation status of STAT3 (P- STAT3) in tumors and stroma (all-time
Supplemental Information. Myocardial Polyploidization Creates a Barrier. to Heart Regeneration in Zebrafish
Developmental Cell, Volume 44 Supplemental Information Myocardial Polyploidization Creates a Barrier to Heart Regeneration in Zebrafish Juan Manuel González-Rosa, Michka Sharpe, Dorothy Field, Mark H.
T H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Amelio et al., http://www.jcb.org/cgi/content/full/jcb.201203134/dc1 Figure S1. mir-24 regulates proliferation and by itself induces
Supplementary Figures
Supplementary Figures Supplementary Figure 1 Increased ABHD5 expression in human colon cancer associated macrophages. (a) Murine peritoneal macrophages were treated with regular culture medium (Ctrl) or
Nature Immunology: doi: /ni Supplementary Figure 1. Cellularity of leukocytes and their progenitors in naive wild-type and Spp1 / mice.
Supplementary Figure 1 Cellularity of leukocytes and their progenitors in naive wild-type and Spp1 / mice. (a, b) Gating strategies for differentiated cells including PMN (CD11b + Ly6G hi and CD11b + Ly6G
The Ufm1-activating enzyme Uba5 is indispensable for erythroid differentiation in mice
Supplementary information The Ufm1-activating enzyme Uba5 is indispensable for erythroid differentiation in mice Kanako Tatsumi 1, 2, Harumi Yamamoto-Mukai 2, Ritsuko Shimizu 3, Satoshi Waguri 4, Yu-Shin
Supporting Information
Supporting Information Franco et al. 10.1073/pnas.1015557108 SI Materials and Methods Drug Administration. PD352901 was dissolved in 0.5% (wt/vol) hydroxyl-propyl-methylcellulose, 0.2% (vol/vol) Tween
B220 CD4 CD8. Figure 1. Confocal Image of Sensitized HLN. Representative image of a sensitized HLN
B220 CD4 CD8 Natarajan et al., unpublished data Figure 1. Confocal Image of Sensitized HLN. Representative image of a sensitized HLN showing B cell follicles and T cell areas. 20 µm thick. Image of magnification
Supplemental Table S1
Supplemental Table S. Tumorigenicity and metastatic potential of 44SQ cell subpopulations a Tumorigenicity b Average tumor volume (mm ) c Lung metastasis d CD high /4 8. 8/ CD low /4 6./ a Mice were injected
NEW IHC A n t i b o d i e s
NEW IHC Antibodies TABLE OF CONTENTS NEW IHC ANTIBODIES from Cell Marque CITED1 (5H6).... 1 Claudin 7 (5D10F3).... 1 GATA1 (4F5).... 1 Transgelin (2A10C2).... 1 NEW IHC ANTIBODIES using RabMAb Technology
Supplementary Figure 1. Generation of knockin mice expressing L-selectinN138G. (a) Schematics of the Sellg allele (top), the targeting vector, the
Supplementary Figure 1. Generation of knockin mice expressing L-selectinN138G. (a) Schematics of the Sellg allele (top), the targeting vector, the targeted allele in ES cells, and the mutant allele in
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein
Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein content relative to GAPDH in two independent experiments.
Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of
Supplemental Figure Legends Supplemental Figure 1. Western blot analysis indicated that was detected in the fractions of plasma membrane and cytosol but not in nuclear fraction isolated from Pkd1 null
(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
Supplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
Supplemental Figures:
Supplemental Figures: Figure 1: Intracellular distribution of VWF by electron microscopy in human endothelial cells. a) Immunogold labeling of LC3 demonstrating an LC3-positive autophagosome (white arrow)
Supplementary Figure 1. Nature Neuroscience: doi: /nn.4547
Supplementary Figure 1 Characterization of the Microfetti mouse model. (a) Gating strategy for 8-color flow analysis of peripheral Ly-6C + monocytes from Microfetti mice 5-7 days after TAM treatment. Living
SUPPLEMENTARY INFORMATION
doi:10.1038/nature12652 Supplementary Figure 1. PRDM16 interacts with endogenous EHMT1 in brown adipocytes. Immunoprecipitation of PRDM16 complex by flag antibody (M2) followed by Western blot analysis
and follicular helper T cells is Egr2-dependent. (a) Diagrammatic representation of the
Supplementary Figure 1. LAG3 + Treg-mediated regulation of germinal center B cells and follicular helper T cells is Egr2-dependent. (a) Diagrammatic representation of the experimental protocol for the
Atg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1
Takamura_Fig. S1 brain heart lung spleen stomach colon kidney SM Supplemental Figure 1 Histological findings of tg5 flox/flox ;CG-Cre mouse tissues. H&E staining of the brain, heart, lung, spleen, stomach,
Supplementary Information
Supplementary Information mediates STAT3 activation at retromer-positive structures to promote colitis and colitis-associated carcinogenesis Zhang et al. a b d e g h Rel. Luc. Act. Rel. mrna Rel. mrna
Nature Immunology: doi: /ni Supplementary Figure 1. Huwe1 has high expression in HSCs and is necessary for quiescence.
Supplementary Figure 1 Huwe1 has high expression in HSCs and is necessary for quiescence. (a) Heat map visualizing expression of genes with a known function in ubiquitin-mediated proteolysis (KEGG: Ubiquitin
Nature Neuroscience: doi: /nn Supplementary Figure 1. MADM labeling of thalamic clones.
Supplementary Figure 1 MADM labeling of thalamic clones. (a) Confocal images of an E12 Nestin-CreERT2;Ai9-tdTomato brain treated with TM at E10 and stained for BLBP (green), a radial glial progenitor-specific
Spontaneous Neoplasms and Survival in Wistar Han Rats: Compilation of Control Group Data. March, 2003
Spontaneous Neoplasms and Survival in Wistar Han Rats: Compilation of Control Group Data March, 2003 Information Prepared by Mary L.A. Giknis Ph.D Charles B. Clifford D.V.M, Ph.D TABLE OF CONTENTS INTRODUCTION...1
Multi-normal human tissues, FDA, 96 samples, 35 organs/sites from three individuals (1.5mm)
ab178228 Multi-normal human tissues, FDA, 96 samples, 35 organs/sites from three individuals (1.5mm) Instructions for Use Designed for antibody cross reactivity analysis and IHC or ISH based protein or
Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts
Supplementary Figure 1 Induction of cellular senescence and isolation of exosome. a to c, Pre-senescent primary normal human diploid fibroblasts (TIG-3 cells) were rendered senescent by either serial passage
Supplementary Figure 1. BMS enhances human T cell activation in vitro in a
Supplementary Figure 1. BMS98662 enhances human T cell activation in vitro in a concentration-dependent manner. Jurkat T cells were activated with anti-cd3 and anti-cd28 antibody in the presence of titrated
Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
SUPPLEMENTARY LEGENDS...
TABLE OF CONTENTS SUPPLEMENTARY LEGENDS... 2 11 MOVIE S1... 2 FIGURE S1 LEGEND... 3 FIGURE S2 LEGEND... 4 FIGURE S3 LEGEND... 5 FIGURE S4 LEGEND... 6 FIGURE S5 LEGEND... 7 FIGURE S6 LEGEND... 8 FIGURE
Nature Biotechnology: doi: /nbt Supplementary Figure 1. Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM.
Supplementary Figure 1 Analysis of hair bundle morphology in Ush1c c.216g>a mice at P18 by SEM. (a-c) Heterozygous c.216ga mice displayed normal hair bundle morphology at P18. (d-i) Disorganized hair bundles
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
Nature Immunology: doi: /ni Supplementary Figure 1. Gene expression profile of CD4 + T cells and CTL responses in Bcl6-deficient mice.
Supplementary Figure 1 Gene expression profile of CD4 + T cells and CTL responses in Bcl6-deficient mice. (a) Gene expression profile in the resting CD4 + T cells were analyzed by an Affymetrix microarray
Spontaneous Neoplastic Lesions in the Crl:CD-1 (ICR)BR Mouse. March, 2000
Spontaneous Neoplastic Lesions in the Crl:CD-1 (ICR)BR Mouse March, 2000 Information Prepared by Mary L. A. Giknis, Ph.D. Charles B. Clifford, D.V.M., Ph.D. CHARLES RIVER LABORATORIES TABLE OF CONTENTS
SUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
Supplementary Information
Supplementary Information Supplementary Figure 1. Western blotting with ERβ antibodies Full blots corresponding to Fig. 2, along with replicated experiments at different time points, different batches,
Supplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent Protein.
prfp-vector RFP Exon1 Intron RFP Exon2 prfp-mir-124 mir-93/124 RFP Exon1 Intron RFP Exon2 Untransfected prfp-vector prfp-mir-93 prfp-mir-124 Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent
Spontaneous Neoplastic Lesions in the CrI:CD-1(ICR) Mouse in Control Groups from 18 Month to 2 year Studies. March, 2005
Spontaneous Neoplastic Lesions in the CrI:CD-1(ICR) Mouse in Control Groups from 18 Month to 2 year Studies March, 2005 Information Prepared by Mary L.A. Giknis Ph.D Charles B. Clifford D.V.M, Ph.D 1063
sequences of a styx mutant reveals a T to A transversion in the donor splice site of intron 5
sfigure 1 Styx mutant mice recapitulate the phenotype of SHIP -/- mice. (A) Analysis of the genomic sequences of a styx mutant reveals a T to A transversion in the donor splice site of intron 5 (GTAAC
SUPPLEMENTARY INFORMATION
doi: 1.138/nature89 IFN- (ng ml ) 5 4 3 1 Splenocytes NS IFN- (ng ml ) 6 4 Lymph node cells NS Nfkbiz / Nfkbiz / Nfkbiz / Nfkbiz / IL- (ng ml ) 3 1 Splenocytes IL- (ng ml ) 1 8 6 4 *** ** Lymph node cells
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier
Supplementary Figure S1 Expression of mir-181b in EOC (A) Kaplan-Meier curves for progression-free survival (PFS) and overall survival (OS) in a cohort of patients (N=52) with stage III primary ovarian
Supplementary Figure 1: GFAP positive nerves in patients with adenocarcinoma of
SUPPLEMENTARY FIGURES AND MOVIE LEGENDS Supplementary Figure 1: GFAP positive nerves in patients with adenocarcinoma of the pancreas. (A) Images of nerves stained for GFAP (green), S100 (red) and DAPI
Supplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons
Supplementary Figure 1 ETBF activate Stat3 in B6 and Min mice colons a pstat3 controls Pos Neg ETBF 1 2 3 4 b pstat1 pstat2 pstat3 pstat4 pstat5 pstat6 Actin Figure Legend: (a) ETBF induce predominantly
Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al
Supplementary Figures for TSC1 controls macrophage polarization to prevent inflammatory disorder by Linnan Zhu et al Suppl. Fig. 1 Tissue DN C Proteins kd TSC1-17 TSC 1 loxp bp -48-285 ctin PEMs Neutrophils
Supplementary Figures
Supplementary Figures Supplementary Fig. 1. Galectin-3 is present within tumors. (A) mrna expression levels of Lgals3 (galectin-3) and Lgals8 (galectin-8) in the four classes of cell lines as determined
Supplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as
Supplementary Figure 1. Basal level EGFR across a panel of ESCC lines. Immunoblots demonstrate the expression of phosphorylated and total EGFR as well as their downstream effectors across a panel of ESCC
Supplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Cheng MH, Fan U, Grewal N, et al. Acquired autoimmune polyglandular
TEB. Id4 p63 DAPI Merge. Id4 CK8 DAPI Merge
a Duct TEB b Id4 p63 DAPI Merge Id4 CK8 DAPI Merge c d e Supplementary Figure 1. Identification of Id4-positive MECs and characterization of the Comma-D model. (a) IHC analysis of ID4 expression in the
Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )
770 771 Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 ) Human CXCL1 GCGCCCAAACCGAAGTCATA ATGGGGGATGCAGGATTGAG PF4 CCCCACTGCCCAACTGATAG TTCTTGTACAGCGGGGCTTG
33VASTVNGATSANNHGEPPS51PADARPR58
Pro-rich region Trans-membrane region 214 246 359 381 UL50 1 397 211SSRTAS216PPPPPR222 NLS CR1 CR2 CR3 CR4 UL53 1 376 11RERRS15ALRS19LLRKRRR25 33VASTVNGATSANNHGEPPS51PADARPR58 FIG S1. UL97 phosphorylation
(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
AMDCC Progress Report Duke/UNC/Stanford Unit. Program Director Thomas M. Coffman, MD
AMDCC Progress Report Duke/UNC/Stanford Unit Program Director Thomas M. Coffman, MD Susceptibility Mutation Model Development + ApoE-/- +STZ Kidney Phenotype Screen Vascular & Kidney Phenotype Screen Generate
Supplementary Figure S1. PTPN2 levels are not altered in proliferating CD8+ T cells. Lymph node (LN) CD8+ T cells from C57BL/6 mice were stained with
Supplementary Figure S1. PTPN2 levels are not altered in proliferating CD8+ T cells. Lymph node (LN) CD8+ T cells from C57BL/6 mice were stained with CFSE and stimulated with plate-bound α-cd3ε (10µg/ml)
SUPPLEMENTARY INFORMATION
DOI: 1.138/ncb3355 a S1A8 + cells/ total.1.8.6.4.2 b S1A8/?-Actin c % T-cell proliferation 3 25 2 15 1 5 T cells Supplementary Figure 1 Inter-tumoral heterogeneity of MDSC accumulation in mammary tumor
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.
Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage
Supplemental Figure S1. RANK expression on human lung cancer cells.
Supplemental Figure S1. RANK expression on human lung cancer cells. (A) Incidence and H-Scores of RANK expression determined from IHC in the indicated primary lung cancer subgroups. The overall expression
Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections
Supplementary Figure 1. Expression of phospho-sik3 in normal and osteoarthritic articular cartilage in the knee. (a) Semiserial histological sections of normal cartilage were stained with safranin O-fast
The subcortical maternal complex controls symmetric division of mouse zygotes by
The subcortical maternal complex controls symmetric division of mouse zygotes by regulating F-actin dynamics Xing-Jiang Yu 1,2, Zhaohong Yi 1, Zheng Gao 1,2, Dan-dan Qin 1,2, Yanhua Zhai 1, Xue Chen 1,
marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is
Supplementary Figure 1. (a) Nos is detected in glial cells in both control and GFAP R79H transgenic flies (arrows), but not in deletion mutant Nos Δ15 animals. Repo is a glial cell marker. DAPI labels
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin
Supplementary Figure 1. Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Nature Immunology: doi: /ni.
Supplementary Figure 1 Efficiency of Mll4 deletion and its effect on T cell populations in the periphery. Expression of Mll4 floxed alleles (16-19) in naive CD4 + T cells isolated from lymph nodes and
Nature Genetics: doi: /ng Supplementary Figure 1
Supplementary Figure 1 MSI2 interactors are associated with the riboproteome and are functionally relevant. (a) Coomassie blue staining of FLAG-MSI2 immunoprecipitated complexes. (b) GO analysis of MSI2-interacting
Mutant p53 establishes targetable tumor dependency by promoting unscheduled replication
Mutant p53 establishes targetable tumor dependency by promoting unscheduled replication Shilpa Singh, 1 Catherine A. Vaughan, 1 Rebecca A. Frum, 2 Steven R. Grossman, 2 Sumitra Deb, 1 and Swati Palit Deb
Supplementary Figure 1. Blood glucose and insulin levels in mice during 4-day infusion.
Supplementary Figure 1. Blood glucose and insulin levels in mice during 4-day infusion. (A-B) WT and HT mice infused with saline or glucose had overlapping achieved blood glucose and insulin levels, necessitating
Supplementary Figure 1
Supplementary Figure 1 Kif1a RNAi effect on basal progenitor differentiation Related to Figure 2. Representative confocal images of the VZ and SVZ of rat cortices transfected at E16 with scrambled or Kif1a
Diabetic pdx1-mutant zebrafish show conserved responses to nutrient overload and anti-glycemic treatment
Supplementary Information Diabetic pdx1-mutant zebrafish show conserved responses to nutrient overload and anti-glycemic treatment Robin A. Kimmel, Stefan Dobler, Nicole Schmitner, Tanja Walsen, Julia
Bone Marrow Pop. (% Total) Mature Pool (Absolute %) Immature Pool (Absolute %) A10 EC Control A10 EC Control A10 EC Control
Bone Marrow Pop. (% Total) Mature Pool (Asolute %) Immature Pool (Asolute %) A10 EC A10 EC A10 EC Myeloid 50.7 57.5 37.5 46.2 13.2 11.3 Erythroid 38.3 23.2 33.3 16.8 9.3 6.3 Lymphocytes 13.8 19.0 - - -
SUPPLEMENTARY FIGURE LEGENDS. atypical adenomatous hyperplasias (AAH); Grade II: adenomas; Grade III: adenocarcinomas;
SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure S1: Tumor grades in Ras G12D ; p53 / lung tumors. Representative histology (H&E) of K-Ras G12D ; p53 / lung tumors 13 weeks after tumor initiation. Grade
Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse
Supplemental figure legends Supplemental Figure 1. Intracranial transduction of a modified ptomo lentiviral vector in the mouse hippocampus targets GFAP-positive but not NeuN-positive cells. (A) Stereotaxic
BRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information)
BRaf V600E cooperates with Pten silencing to elicit metastatic melanoma (Nature Genetics Supplementary Information) David Dankort, David P. Curley, Robert A. Cartlidge, Betsy Nelson, Anthony N. Karnezis,
Neoplasia part I. Dr. Mohsen Dashti. Clinical Medicine & Pathology nd Lecture
Neoplasia part I By Dr. Mohsen Dashti Clinical Medicine & Pathology 316 2 nd Lecture Lecture outline Review of structure & function. Basic definitions. Classification of neoplasms. Morphologic features.
Descriptive Histology
Atlas of Descriptive Histology Michael H. Ross University of Florida College of Medicine Gainesville, Florida Wojciech Pawlina Mayo Medical School College of Medicine, Mayo Clinic Rochester, Minnesota
Supplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
mir-7a regulation of Pax6 in neural stem cells controls the spatial origin of forebrain dopaminergic neurons
Supplemental Material mir-7a regulation of Pax6 in neural stem cells controls the spatial origin of forebrain dopaminergic neurons Antoine de Chevigny, Nathalie Coré, Philipp Follert, Marion Gaudin, Pascal
Supplementary Materials and Methods
Supplementary Materials and Methods Whole Mount X-Gal Staining Whole tissues were collected, rinsed with PBS and fixed with 4% PFA. Tissues were then rinsed in rinse buffer (100 mm Sodium Phosphate ph
Supplemental Data. Wang et al. (2013). Plant Cell /tpc
Supplemental Data. Wang et al. (2013). Plant Cell 10.1105/tpc.112.108993 Supplemental Figure 1. 3-MA Treatment Reduces the Growth of Seedlings. Two-week-old Nicotiana benthamiana seedlings germinated on
Supplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2
Supplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2 activity. Upper panel: Representative histograms for FACS
a) Primary cultures derived from the pancreas of an 11-week-old Pdx1-Cre; K-MADM-p53
1 2 3 4 5 6 7 8 9 10 Supplementary Figure 1. Induction of p53 LOH by MADM. a) Primary cultures derived from the pancreas of an 11-week-old Pdx1-Cre; K-MADM-p53 mouse revealed increased p53 KO/KO (green,
Supplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
Transgenic Mice and Genetargeting
Transgenic Mice and Genetargeting mice In Biomedical Science Techniques of transgenic and gene-targeting mice are indispensable for analyses of in vivo functions of particular genes and roles of their