Molecular mechanisms of antibiotic resistance in Neisseria gonorrhoeae
|
|
- Spencer Maximilian Carter
- 5 years ago
- Views:
Transcription
1 medicaldaily.com ppcorn.com Molecular mechanisms of antibiotic resistance in Neisseria gonorrhoeae Robert Nicholas University of North Carolina at Chapel Hill cdc.gov
2 Timeline of Antibiotic Resistance in N. gonorrhoeae 1987 Penicillin Not Recommended 2012 Cefixime Not Recommended 1945 Sulfonamide Resistance 1958 Penicillin Resistance 1977 Erythromycin Not Recommended 1977 Widespread Sulfonamide Resistance 1987 Widespread Spectinomycin Resistance 1987 Tetracycline Not Recommended 2009 Ceftriaxone Resistance 2007 Fluoroquinolones Not Recommended 1937 Sulfonamides 1949 Streptomycin/ Chloramphenicol 1961 Spectinomycin 1983 Azithromycin/ Cefixime 1991 Fluoroquinolones 1943 Penicillin 1952 Erythromycin 1962 Tetracycline 1989 Ceftriaxone
3 Modes of resistance in Neisseria gonorrhoeae Plasmid-mediated resistance Penicillin, Tetracycline Resistance occurs due to expression of a modifying protein or ribosome-protection protein TEM-1-like β-lactamase for Pen R TetM ribosomal-binding protein for Tet R β-lactamase does not hydrolyze ceftriaxone, so not important in cephalosporin resistance However, 1 aa change could convert bla gene into extendedspectrum β-lactamase Chromosomally mediated resistance Penicillin, Ceftriaxone, Tetracycline, Ciprofloxacin, Azithromycin, Spectinomycin Due to acquisition of chromosomal mutations by homologous recombination The most common form of resistance to penicillin, ciprofloxacin, tetracycline, and azithromycin All of the strains with decreased susceptibility to ceftriaxone are chromosomally mediated
4 pona pona pona Stepwise Transfer of Antibiotic Resistance Genes in Neisseria gonorrhoeae pona
5 Ceftriaxone Antibiotic Efflux Outer Membrane PenB PorB 1B Overexpression of MtrCDE Efflux Pump (mtr) Overexpression Activates PorB1B Mutations Decreased Influx Decreased Inactivation PBP 1 Mosaic WT PBP 2 (pena) Cytoplasmic Membrane
6 Genetics of Resistance-MICs of Stepwise Transformants 5X Resistant Susceptible 6X 2X 6X Overall increase: 400-fold Stepwise Resistance: Each step is a relatively small increase in resistance, but when multiplied overall, leads to a large increase in MIC FA19 = Susceptible wild-type strain FA6140 = Pen R clinical isolate
7 Emergence of Ceph I and Ceph R strains Strain MIC (µg/ml) Ceftriaxone Cefixime Date Isolated FA / H F Breakpoint for resistance is for both antibiotics
8 pena-mediated Resistance in the Gonococci The type of pena allele determines whether the strain is Pen R, Ceph I, or Ceph R The mtrr and penb determinants contribute additional resistance to β-lactam antibiotics and provide a general permeability barrier for antibiotics Ceph I and Ceph R strains likely have emerged by a single transformation event of a mosaic pena allele into existing Ceph S /Pen R strains
9 Clinical Ceph I Strains Harboring a Mosaic pena Allele Also Have mtrr, penb, and pona Alleles Lindberg et al Antimicrob Agents Chemother 51:2117
10 Mosaic pena alleles in Ceph I /Ceph R strains Wild Type N. gonorrhoeae N. meningiditis N. flavescens N. cinerea Mosaic pena allele Ito et al. (2005) AAC 49(1):
11 PBP2 mutations in β-lactam-resistant strains of N. gonorrhoeae Active site 13 new or different mutations compared to 35/ MIC PEN =4.0 µg/ml 5 mutations in PBP2 compared to FA19 35/02 MIC CFX =0.38 µg/ml 58 mutations in PBP2 compared to FA19 H041 MIC CFX =8 µg/ml 61 mutations in PBP2 compared to FA19
12 Of the 61 differences between PBP2 from FA19 and H041, what is the minimal set of mutations that increase resistance to the same level when incorporated into wildtype PBP2?
13 pena-mediated Resistance in the Gonococci The type of pena allele determines whether the strain is Ceph R The mtrr and penb determinants contribute additional resistance to β-lactam antibiotics and provide a general permeability barrier for antibiotics Ceph I and Ceph R strains likely have evolved by a single transformation event of a mosaic pena allele into existing Ceph S /Pen R strains The mosaic pena allele in Ceph I strains can accrue additional mutations, leading to Ceph R strains In some instances, a single additional mutation in a mosaic pena allele can lead to Ceph R Ala-501 mutations in a Ceph I pena allele generate a Ceph R strain
14 PBP2 F89 is essentially PBP2 35/02 with an A501P mutation Ala-501 Mutations in a Mosaic PBP2 Background FA19 Modeled Cefuroxime Breakpoint > 0.25 µg/ml FA6140 A501T
15 Meropenem α4 α2 α5 α8 α11 Thr501 β3-β4 loop β4 β3 β5
16 Contribution of non-pena resistance determinants on the MICs of different β-lactam antibiotics 50X 20X 4X 12X 20X 100X 600X 400X 400X Zhao et al. (2009) AAC, 53(9):
17 MtrCDE Efflux Pump Outer Membrane Cytoplasmic Membrane Member of the Resistance- Nodulation-Division (RND) Superfamily of Efflux Pumps The major efflux pump in N. gonorrhoeae involved in resistance Resistance occurs not by coding mutations but by promoter mutations that overexpress the pump Confers resistance to a wide range of compounds Detergents (e.g. Triton X-100 and spermicides) Hydrophobic agents (Crystal Violet, Erythromycin) Antibiotics Host Antimicrobial Peptides Shafer Lab, Emory University
18 Knockout of the MtrCDE Efflux Pump Markedly Decreases the MICs of β-lactam Antibiotics Veal et al. (2002) J Bact 184:5619; Golparian et al. (2014) AAC 58:3556
19 penb PorB1b
20 PenB mutations map to AA 120,121 of PorB 1b PIB LNSPLKNTGANVNAWESGKFTGNVLEISGMAQREHRY G120D/A121D G120K/A121X Loop 3 Olesky et al AAC; Olesky et al J Bacteriol
21 PenB mutations map to Loop 3 of PIB Loop 3 N. meningitidis porin PorB PDB 3A2R; Tanabe et al PNAS
22 Genetics of Resistance-penB is silent in the absence of mtrr Olesky et al J Bacteriol
23 Permeation of β-lactam antibiotics in whole cells Cross outer membranerate determining step nitrocefin Hydrolyzed by β-lactamase Increase in OD 480
24 Structural model of PorB1b
25
26 Conclusions Three resistance determinants (four including pona) encode altered forms of endogenous genes These determinants work in concert to increase the MIC above the breakpoint of the antibiotics The mtr and penb determinants work in concert to decrease the influx of antibiotics into the bacterium All future antibiotics will have to overcome this permeability barrier We are nearing a time in which we will have untreatable gonococcal infections
27 Future goals Identify new antibiotics that are active against antibioticresistant strains of N. gonorrhoeae My colleague Pei Zhou will talk about our efforts to develop an inhibitor of lipid A biosynthesis What additional mutations are there that compensate for the loss of fitness caused by the mosaic pena allele? We have identified at least two compensatory mutations that arise during competitive infections in the mouse model What is the mechanism by which mosaic PBP2 variants exclude β-lactam antibiotics (which are substrate analogs), but still retain essential PG transpeptidase activity?
28 UNC Acknowledgements USUHS Orebrö Univ Josh Tomberg Kate Newns Leah Vincent Ann Jerse Magnus Unemo UNC Emory MUSC Sam Kerr Yang Tan Alex Duncan Bill Shafer Chris Davies Funding: NIAID, NIGMS, AC STI CRC U19
Emergence, spread and characteristics of Neisseria
Emergence, spread and characteristics of Neisseria gonorrhoeae isolates with in vitro decreased susceptibility and resistance to extended-spectrum cephalosporins in Sweden Daniel Golparian, Bengt Hellmark,
More informationNIH Public Access Author Manuscript Future Microbiol. Author manuscript; available in PMC 2013 October 01.
NIH Public Access Author Manuscript Published in final edited form as: Future Microbiol. 2012 December ; 7(12): 1401 1422. doi:10.2217/fmb.12.117. Emergence of multidrug-resistant, extensively drug-resistant
More informationNovel pena mutations identified in Neisseria gonorrhoeae with decreased susceptibility to ceftriaxone isolated between 2000 and 2014 in Japan
J Antimicrob Chemother 2016; 71: 2466 2470 doi:10.1093/jac/dkw161 Advance Access publication 13 May 2016 Novel pena mutations identified in Neisseria gonorrhoeae with decreased susceptibility to ceftriaxone
More informationTreatment resistant STIs relevant to MSM
Treatment resistant STIs relevant to MSM David A. Lewis FRCP (UK) PhD Centre for HIV and STIs National Institute for Communicable Diseases (NHLS) Johannesburg, South Africa Regional Director, IUSTI Africa
More informationReceived 10 March 2011/Returned for modification 19 April 2011/Accepted 2 May 2011
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, July 2011, p. 3538 3545 Vol. 55, No. 7 0066-4804/11/$12.00 doi:10.1128/aac.00325-11 Copyright 2011, American Society for Microbiology. All Rights Reserved. Is Neisseria
More informationHigh-level cefixime- and ceftriaxone-resistant N. gonorrhoeae in Europe (France): novel
AAC Accepts, published online ahead of print on 12 December 2011 Antimicrob. Agents Chemother. doi:10.1128/aac.05760-11 Copyright 2011, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationNucleic acid amplification testing for Neisseria gonorrhoeae where are we going?
Nucleic acid amplification testing for Neisseria gonorrhoeae where are we going? David Whiley QPID Laboratory, Queensland Children s Medical Research Institute, Children s Health Service District, and
More informationDetailed characterization of the first high-level ceftriaxone resistant strain.
AAC Accepts, published online ahead of print on 16 May 2011 Antimicrob. Agents Chemother. doi:10.1128/aac.00325-11 Copyright 2011, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationCDC Grand Rounds: The Growing Threat of Multidrug-
Page 1 of 8 Morbidity and Mortality Weekly Report (MMWR) CDC Grand Rounds: The Growing Threat of Multidrug- Resistant Gonorrhea Weekly February 15, 2013 / 62(06);103-106 Although gonorrhea has afflicted
More informationRésistance bactérienne au cours des Infections Sexuellement Transmissibles Cécile Bébéar
Résistance bactérienne au cours des Infections Sexuellement Transmissibles Cécile Bébéar French Na*onal Center for bacterial STIs Bordeaux University hospital, Bordeaux, France University of Bordeaux,
More informationIn vitro assessment of dual drug combinations to inhibit growth of Neisseria gonorrhoeae
AAC Accepted Manuscript Posted Online 26 January 2015 Antimicrob. Agents Chemother. doi:10.1128/aac.04127-14 Copyright 2015, American Society for Microbiology. All Rights Reserved. 1 2 In vitro assessment
More informationAntimicrobial susceptibility and genetic characteristics of Neisseria gonorrhoeae isolates from Vietnam, 2011
Olsen et al. BMC Infectious Diseases 2013, 13:40 RESEARCH ARTICLE Open Access Antimicrobial susceptibility and genetic characteristics of Neisseria gonorrhoeae isolates from Vietnam, 2011 Birgitta Olsen
More informationTranslocation Studies Mid-Term Review (MTR) Meeting Marseille, France
Marie Curie Actions Research Training Networks (RTN) Translocation Studies Mid-Term Review (MTR) Meeting Marseille, France F. Vidal-Aroca, M.G.P. Page and J. Dreier Background Deteriorating situation regarding
More informationEmergence et impact clinique de la résistance aux antibiotiques chez Chlamydia trachomatis, Neisseria gonorrhoeae, les mycoplasmes
Emergence et impact clinique de la résistance aux antibiotiques chez Chlamydia trachomatis, Neisseria gonorrhoeae, les mycoplasmes Cécile Bébéar French National Center for bacterial STIs Bordeaux University
More informationThe Gonococcal Antimicrobial Surveillance Program (GASP): A snapshot from Southern Africa Dumisile Venessa Maseko
The Gonococcal Antimicrobial Surveillance Program (GASP): A snapshot from Southern Africa Dumisile Venessa Maseko Centre for HIV and STIs Na9onal Ins9tute for Communicable Diseases, Na9onal Health Laboratory
More informationAntimicrobial resistance and molecular epidemiology of Neisseria gonorrhoeae in New Zealand,
Antimicrobial resistance and molecular epidemiology of Neisseria gonorrhoeae in New Zealand, 2014-15 December 2015 PREPARED FOR: CLIENT REPORT No: PREPARED BY: Ministry of Health FW15061 Helen Heffernan,
More informationUpdate on Treatment Options for Gonococcal Infections
Update on Treatment Options for Gonococcal Infections Jason W. Lancaster, 1,2, * Monica V. Mahoney, 3 Sana Mandal, 1 and Kenneth R. Lawrence, 4 1 School of Pharmacy, Northeastern University, Boston, Massachusetts;
More informationAntimicrobial susceptibility and genetic characteristics of Neisseria gonorrhoeae isolates from India, Pakistan and Bhutan in
Sethi et al. BMC Infectious Diseases 2013, 13:35 RESEARCH ARTICLE Open Access Antimicrobial susceptibility and genetic characteristics of Neisseria gonorrhoeae isolates from India, Pakistan and Bhutan
More informationAntimicrobial Resistance of Neisseria gonorrhoeae Isolated in Korea
Journal of Bacteriology and Virology 2012. Vol. 42, No. 1 p.9 16 http://dx.doi.org/10.4167/jbv.2012.42.1.9 Review Article Antimicrobial Resistance of Neisseria gonorrhoeae Isolated in Korea Hyukmin Lee
More informationMolecular tests for the detection of antimicrobial resistant Neisseria gonorrhoeae: when, where, and how to use?
REVIEW C URRENT OPINION Molecular tests for the detection of antimicrobial resistant Neisseria gonorrhoeae: when, where, and how to use? Nicola Low a and Magnus Unemo b Purpose of review Molecular methods
More informationORIGINAL ARTICLES. Antibiotic-resistant gonococci past, present and future. The pre-antibiotic era. David A Lewis
Antibiotic-resistant gonococci past, present and future David A Lewis 1146 Gonorrhoea remains one of the commonest STIs from a global perspective and, left untreated or treated inadequately, may result
More information* these authors contributed equally to the preparation of this report
AAC Accepts, published online ahead of print on June 00 Antimicrob. Agents Chemother. doi:0./aac.000-0 Copyright 00, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationEndimiani et al. BMC Infectious Diseases 2014, 14:106
Endimiani et al. BMC Infectious Diseases 2014, 14:106 RESERCH RTICLE Open ccess Characterization of Neisseria gonorrhoeae isolates detected in Switzerland (1998 2012): emergence of multidrug-resistant
More informationTrends of sexually transmitted diseases and antimicrobial resistance in Neisseria gonorrhoeae
International Journal of Antimicrobial Agents 31S (2008) S35 S39 Trends of sexually transmitted diseases and antimicrobial resistance in Neisseria gonorrhoeae T. Matsumoto Department of Urology, School
More informationAmsterdam, the Netherlands 9 Department of Dermatology, Academic Medical Center, University of Amsterdam, Amsterdam, the
JCM Accepted Manuscript Posted Online 22 February 2017 J. Clin. Microbiol. doi:10.1128/jcm.00100-17 Crown copyright 2017. The government of Australia, Canada, or the UK ("the Crown") owns the copyright
More informationNeisseria gonorrhoeae 2009
Magnus Unemo Date: 2010-05-12 Page 1 of 7 Neisseria gonorrhoeae 2009 Annual report regarding serological characterisation and antibiotic susceptibility of Swedish Neisseria gonorrhoeae strains In 2009,
More information6. Gonococcal antimicrobial susceptibility
6. Gonococcal antimicrobial susceptibility Key points Gonococcal AMR continues to increase worldwide and could lead to a pandemic of extensively drug-resistant (XDR) N. gonorrhoeae with serious public
More informationMeeting Report. 7 9 April 2010 Manila, Philippines
Meeting Report Consultation on the Strategic Response to the Threat of Untreatable Neisseria gonorrhoeae and Emergence of Cephalosporin Resistance in Neisseria gonorrhoeae 7 9 April 2010 Manila, Philippines
More informationBECAUSE OF NEISSERIA GONORrhoeae
PRELIMINARY COMMUNICATION Neisseria gonorrhoeae Treatment Failure and Susceptibility to Cefixime in Toronto, Canada Vanessa G. Allen, MD, MPH Leo Mitterni Christine Seah, MLT Anuradha Rebbapragada, PhD
More informationRapid communication.
Rapid communication Gonorrhoea treatment failure caused by a Neisseria gonorrhoeae strain with combined ceftriaxone and highlevel azithromycin resistance, England, February 2018 David W Eyre 1,2, Nicholas
More informationNational Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae
National Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2011 Streptococcus and STI Unit Bacteriology and Enteric Diseases Program National Microbiology Laboratory
More informationNeisseria gonorrhoeae 2007
Magnus Unemo Date: 2008-03-14 Page 1 of 6 Neisseria gonorrhoeae 2007 Annual report regarding serological characterisation and antibiotic susceptibility of Swedish Neisseria gonorrhoeae strains In 2007,
More informationMedical Interventions- Unit 1 Study Guide (Due Dec. 15 th!)
Medical Interventions- Unit 1 Study Guide (Due Dec. 15 th!) Name: Lesson 1.1 1. Define medical intervention. What are 3 medical interventions that Sue Smith would have encountered during her infection
More informationGonorrhea Antimicrobial Resistance in Alberta. Gonorrhea Antimicrobial Resistance Review
2011 Review in Alberta Alberta Gonorrhea AMR Surveillance Working Group November 2013 2011 Review Background Gonorrhea remains one of the oldest infections known to man. Infections can result in significant
More informationORIGINAL ARTICLE. 120 J Formos Med Assoc 2010 Vol 109 No 2
ORIGINAL ARTICLE High Prevalence of Mutations in Quinolone-resistance-determining Regions and mtrr Loci in Polyclonal Neisseria gonorrhoeae Isolates at a Tertiary Hospital in Southern Taiwan Po-Lin Chen,
More informationMolecular characterization of Neisseria gonorrhoeae on non-cultured specimens from multiple anatomic sites
Ann Ist Super Sanità 2017 Vol. 53, No. 3: 213-217 DOI: 10.4415/ANN_17_03_06 Molecular characterization of Neisseria gonorrhoeae on non-cultured specimens from multiple anatomic sites Anna Carannante 1,
More informationRETURN OF THE CLAP: Emerging Issues in Gonorrhea Management and Antibiotic Resistance
RETURN OF THE CLAP: Emerging Issues in Gonorrhea Management and Antibiotic Resistance Ina Park, MD, MS University of California San Francisco California Prevention Training Center DISCLOSURE No Relevant
More informationMultidrug-resistant Neisseria gonorrhoeae infection with ceftriaxone resistance and intermediate resistance to azithromycin, Denmark, 2017
Downloaded from orbit.dtu.dk on: Jun 07, 2018 Multidrug-resistant Neisseria gonorrhoeae infection with ceftriaxone resistance and intermediate resistance to azithromycin, Denmark, 2017 Terkelsen, David;
More informationDiversity of pena Alterations and Subtypes in Neisseria gonorrhoeae Strains from Sydney, Australia, That Are Less Susceptible to Ceftriaxone
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Sept. 2007, p. 3111 3116 Vol. 51, No. 9 0066-4804/07/$08.00 0 doi:10.1128/aac.00306-07 Copyright 2007, American Society for Microbiology. All Rights Reserved. Diversity
More informationRises in STI Rates: Who, What, Why, and What Public Health Can Do
Number of Cases 5/24/2018 Rises in STI Rates: Who, What, Why, and What Public Health Can Do Katherine Hsu, MD, MPH, FAAP* Medical Director, Div. of STD Prev., Mass. Dept. of Pub. Health Associate Professor
More informationNational Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2014
1 National Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2012 National Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2014
More informationM u lt i d r u g - r e s i s ta n t N e i s s e r i a g o n o r r h o e a e w i t h
R e s e a rc h a r ti cl e s M u lt i d r u g - r e s i s ta n t N e i s s e r i a g o n o r r h o e a e w i t h r e d u c e d c e f o ta x i m e s u s c e p t i b i l i t y i s i n c r e a s i n g ly
More informationSai Li 1, Xiao-Hong Su 1*, Wen-Jing Le 1, Fa-Xing Jiang 2, Bao-Xi Wang 1 and Peter A Rice 3
Li et al. BMC Infectious Diseases 2014, 14:622 RESEARCH ARTICLE Open Access Antimicrobial susceptibility of Neisseria gonorrhoeae isolates from symptomatic men attending the Nanjing sexually transmitted
More informationNew Insights into Peptidoglycan Biosynthesis. Louis B. Rice Warren Alpert Medical School of Brown University Providence, RI
New Insights into Peptidoglycan Biosynthesis Louis B. Rice Warren Alpert Medical School of Brown University Providence, RI Outline of Presentation Review role of penicillin-binding proteins in cell wall
More informationNeisseria gonorrhoeae: The Ontario perspective. Michael Whelan and Dr. Vanessa Allen PHO Grand Rounds, May 5, 2015
Neisseria gonorrhoeae: The Ontario perspective Michael Whelan and Dr. Vanessa Allen PHO Grand Rounds, May 5, 2015 Objectives Participants will be able to: Describe preferred specimen collection for testing
More informationMonitoring Antimicrobial Susceptibility of Neisseria gonorrhoeae
J HEALTH POPUL NUTR Oct;28(5):443-449 ISSN 16-997 $ 5.+. INTERNATIONAL CENTRE FOR DIARRHOEAL DISEASE RESEARCH, BANGLADESH Monitoring Antimicrobial Susceptibility of Neisseria gonorrhoeae Isolated from
More informationDiscussion points CLSI M100 S19 Update. #1 format of tables has changed. #2 non susceptible category
Discussion points 2009 CLSI M100 S19 Update Nebraska Public Health Laboratory Changes most important to routine antimicrobial susceptibility testing. Documents available Janet Hindler discussion slide
More informationNational Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2012
1 National Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2012 National Surveillance of Antimicrobial Susceptibilities of Neisseria gonorrhoeae Annual Summary 2012
More informationAffinity of Doripenem and Comparators to Penicillin-Binding Proteins in Escherichia coli and ACCEPTED
AAC Accepts, published online ahead of print on February 00 Antimicrob. Agents Chemother. doi:./aac.01-0 Copyright 00, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationSTRUCTURE OF COMMONLY USED PENICILLINS
PENICILLINS Alice Prince I. CHEMISTRY A basic structure of penicillins consists of a nucleus with three components: a thiazolidine ring, a β-lactam ring and a side chain. The side chain determines, in
More informationNeisseria gonorrhoeae 2008
Magnus Unemo Date: 2009-03-21 Page 1 of 7 Neisseria gonorrhoeae 2008 Annual report regarding serological characterisation and antibiotic susceptibility of Swedish Neisseria gonorrhoeae strains In 2008,
More informationInternationell utblick STI/HIV i världen
Internationell utblick STI/HIV i världen Magnus Unemo, PhD, Assoc. Professor, Director Swedish Reference Laboratory for Pathogenic Neisseria, Department of Laboratory Medicine, Microbiology Örebro University
More informationVeterinary and Agrochemical Research Centre
Veterinary and Agrochemical Research Centre Report on susceptibility of Salmonella serotypes in Belgium. P. Butaye Susceptibility of Salmonella strains was assessed by MIC determination using Sensititer
More informationMedical Interventions- Unit 1 Study Guide (Due Dec. 16 th!)
Medical Interventions- Unit 1 Study Guide (Due Dec. 16 th!) Name: Lesson 1.1 1. Define medical intervention. What are 3 medical interventions that Sue Smith would have encountered during her infection
More informationNeisseria gonorrhoeae: testing, typing and treatment in an era of increased antimicrobial resistance Wind, C.M.
UvA-DARE (Digital Academic Repository) Neisseria gonorrhoeae: testing, typing and treatment in an era of increased antimicrobial resistance Wind, C.M. Link to publication Citation for published version
More informationST11 KPC-2 Klebsiella pneumoniae detected in Taiwan
AAC Accepts, published online ahead of print on 30 January 2012 Antimicrob. Agents Chemother. doi:10.1128/aac.05576-11 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 3 4 5
More informationAmpicillin Resistance Mechanisms in Clinical Haemophilus influenzae: What is Happening in Portugal?
Ampicillin Resistance Mechanisms in Clinical Haemophilus influenzae: What is Happening in Portugal? M. Paula Bajanca-Lavado Haemophilus Reference Laboratory Infectious Disease Department National Institute
More informationDevelopment of C sporins. Beta-lactam antibiotics - Cephalosporins. Second generation C sporins. Targets - PBP s
Beta-lactam antibiotics - Cephalosporins Development of C sporins Targets - PBP s Activity - Cidal - growing organisms (like the penicillins) Principles of action - Affinity for PBP s Permeability properties
More informationMacrolides, Clindamycin & Ketolides Polymyxins
Macrolides, Clindamycin & Ketolides Polymyxins Kwan Soo Ko Macrolides - Erythromycin - Azithromycin - Clarithromycin Lincosamides - Lincomycin - Clindamycin Unrelated chemically But, many similar biological
More informationExpert rules in antimicrobial susceptibility testing: State of the art
Expert rules in antimicrobial susceptibility testing: State of the art ESCMID Postgraduate Education Course Antimicrobial Susceptibility Testing and Surveillance: from Laboratory to Clinic Hospital Universitario
More informationMicrobiology - Problem Drill 16: Antibiotics. Question No. 1 of 10. Question. Feedback. Question
Microbiology - Problem Drill 16: Antibiotics No. 1 of 10 1. An effective chemotherapeutic drug should have. (A) Low therapeutic index (B) More toxicity (C) Selective toxicity (D) Mutation inducing properties
More informationAdenium Biotech. Management: - Peter Nordkild, MD, CEO, ex Novo Nordisk, Ferring, Egalet - Søren Neve, PhD, project director, ex Lundbeck, Novozymes
Adenium Biotech Management: - Peter Nordkild, MD, CEO, ex Novo Nordisk, Ferring, Egalet - Søren Neve, PhD, project director, ex Lundbeck, Novozymes Board of Directors: - Stephan Christgau, PhD, chairman,
More informationApplications of genomics to slow the spread of multidrug-resistant Neisseria gonorrhoeae
Ann. N.Y. Acad. Sci. ISSN 0077-8923 ANNALS OF THE NEW YORK ACADEMY OF SCIENCES Special Issue: Antimicrobial Therapeutics Reviews REVIEW Applications of genomics to slow the spread of multidrug-resistant
More informationMOLECULAR EPIDEMIOLOGY AND MOLECULAR MECHANISMS OF ANTIMICROBIAL RESISTANCE IN NEISSERIA GONORRHOEAE IN CHINA: IMPLICATIONS FOR DISEASE CONTROL
MOLECULAR EPIDEMIOLOGY AND MOLECULAR MECHANISMS OF ANTIMICROBIAL RESISTANCE IN NEISSERIA GONORRHOEAE IN CHINA: IMPLICATIONS FOR DISEASE CONTROL A Thesis Submitted to the College of Graduate Studies and
More informationA genomic dissection of travel associated ESBL producing Salmonella Typhi originating from the Philippines
A genomic dissection of travel associated ESBL producing Salmonella Typhi originating from the Philippines A one-off occurrence or threat to the effective treatment of typhoid fever? Rene S. Hendriksen,
More informationIncreasing Antimicrobial Resistance of Vibrio cholerae O1 Biotype El Tor Strains Isolated in a Tertiary-care Centre in India
J HEALTH POPUL NUTR 2012 Mar;30(1):12-16 ISSN 1606-0997 $ 5.00+0.20 INTERNATIONAL CENTRE FOR DIARRHOEAL DISEASE RESEARCH, BANGLADESH Increasing Antimicrobial Resistance of Vibrio cholerae O1 Biotype El
More informationβ-lactamase inhibitors
β-lactamase inhibitors Properties, microbiology & enzymology DAVID M LIVERMORE Professor of Medical Microbiology, UEA Lead on Antibiotic Resistance, Public Health England β-lactamase classes A B C D Serine
More informationUpdate on CLSI and EUCAST
Update on CLSI and EUCAST 1 Completed work» Cephalosporin breakpoints for Enterobacteriaceae ESBL screens MIC versus resistance mechanism» Carbapenem breakpoints for Enterobacteriaceae Modified Hodge Test»
More informationIncreasing Incidence of High-Level Tetracycline- Resistant Neisseria gonorrhoeae due to Clonal Spread and Foreign Import
Original Article Yonsei Med J 2016 Mar;57(2):350-357 pissn: 0513-5796 eissn: 1976-2437 Increasing Incidence of High-Level Tetracycline- Resistant Neisseria gonorrhoeae due to Clonal Spread and Foreign
More informationNeisseria gonorrhoeae: testing, typing and treatment in an era of increased antimicrobial resistance Wind, C.M.
UvA-DARE (Digital Academic Repository) Neisseria gonorrhoeae: testing, typing and treatment in an era of increased antimicrobial resistance Wind, C.M. Link to publication Citation for published version
More informationNeisseria gonorrhoeae azithromycin susceptibility in the United States, the Gonococcal Isolate Surveillance Project:
AAC Accepts, published online ahead of print on 1 December 2014 Antimicrob. Agents Chemother. doi:10.1128/aac.04337-14 Copyright 2014, American Society for Microbiology. All Rights Reserved. 1 2 Neisseria
More informationOther β-lactam. A. Carbapenems:
A. Carbapenems: Other β-lactam Carbapenems are synthetic β-lactam antibiotics Differ in structure from the penicillins in that the sulfur atom of the thiazolidine ring. Imipenem, meropenem, doripenem,
More informationAntimicrobial Susceptibility Testing of Neisseria gonorrhoeae
CLINICAL MICROBIOLOGY REVIEWS, Jan. 1993, p. 22-33 Vol. 6, No. 1 0893-8512/93/010022-12$02.00/0 Copyright D 1993, American Society for Microbiology Antimicrobial Susceptibility Testing of Neisseria gonorrhoeae
More informationAntibacterial-Resistant Pseudomonas aeruginosa: Clinical Impact and Complex Regulation of Chromosomally Encoded Resistance Mechanisms
CLINICAL MICROBIOLOGY REVIEWS, Oct. 2009, p. 582 610 Vol. 22, No. 4 0893-8512/09/$08.00 0 doi:10.1128/cmr.00040-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. Antibacterial-Resistant
More informationZoliflodacin (ETX0914) for Uncomplicated Gonorrhoea
Zoliflodacin (ETX0914) for Uncomplicated Gonorrhoea Global Antibiotic Research and Development Partnership, Pasteur Institute, 29 February, 2016 Entasis Therapeutics - Introduction Entasis Therapeutics
More informationAntibiotic Treatment of GNR MDR Infections. Stan Deresinski
Antibiotic Treatment of GNR MDR Infections Stan Deresinski Kucers: The Use of Antibiotics 1st Edition 1972 392 pages Kucers: The Use of Antibiotics 7 th Edition 2017 5338 pages Carbapenem Susceptibility
More informationgram neg.(semisynthetic) Bacteria Drugs that inhibit cell wall synthesis Drug Action Organisms Comments Spectrum of Action Mycobacterium
Mickey Dufilho s Drugs and Bugs Revised 10/10/15 Bacteria Drugs that Inhibit Cell Wall Synthesis Drug Action Spectrum of Action Comments Spectrum of Action Bacitracin Beta-Lactam antibiotics Penicillin
More informationThe Emerging Threat of Cephalosporin (& Multidrug) Resistant Gonorrhea
The Emerging Threat of Cephalosporin (& Multidrug) Resistant Gonorrhea Robert D. Kirkcaldy, MD, MPH Division of STD Prevention National Center for HIV/AIDS, Viral Hepatitis, TB and STD Prevention Centers
More informationNEW ANTI-INFECTIVE AGENTS IN 2003 : SPECTRUM AND INDICATIONS. 20th Symposium (spring 2003) Thursday May 22nd 2003
NEW ANTI-INFECTIVE AGENTS IN 2003 : SPECTRUM AND INDICATIONS 20th Symposium (spring 2003) Thursday May 22nd 2003 The slides presented at this meeting are available on this site as "Web slide shows" and
More informationREPORT ON THE ENHANCED SURVEILLANCE OF ANTIMICROBIAL-RESISTANT GONORRHEA
i Report on the enhanced surveillance of antimicrobial-resistant gonorrhea REPORT ON THE ENHANCED SURVEILLANCE OF ANTIMICROBIAL-RESISTANT GONORRHEA RESULTS FROM THE 2014 PILOT i TO PROMOTE AND PROTECT
More informationCharacterisation of bla TEM genes and types of β- lactamase plasmids in Neisseria gonorrhoeae the prevalent and conserved bla
Characterisation of bla TEM genes and types of β- lactamase plasmids in Neisseria gonorrhoeae the prevalent and conserved bla TEM-135 has not recently evolved and existed in the Toronto plasmid from the
More informationin 2004 the Russian gonococcal antimicrobial susceptibility
Surveillance and outbreak reports The Russian gonococcal antimicrobial susceptibility programme (RU-GASP) national resistance prevalence in 2007 and 2008, and trends during 2005-2008 A Kubanova 1, N Frigo
More informationOvercoming the PosESBLities of Enterobacteriaceae Resistance
Overcoming the PosESBLities of Enterobacteriaceae Resistance Review of current treatment options Jamie Reed, PharmD Pharmacy Grand Rounds August 28, 2018 Rochester, MN 2018 MFMER slide-1 Disclosure No
More informationScottish Bacterial Sexually Transmitted Infections Reference Laboratory (SBSTIRL) User Report for the period January - December 2011
Scottish Bacterial Sexually Transmitted Infections Reference Laboratory (SBSTIRL) User Report for the period January - ember 211 Kirstine Eastick PhD FRCPath (Director) SBSTIRL, Microbiology Edinburgh
More informationUpdate on resistance and epidemiology of CAP pathogens in Asia. Cao Bin, MD
Update on resistance and epidemiology of CAP pathogens in Asia Cao Bin, MD Dept Infectious Diseases and Clinical Microbiology Beijing Chaoyang Hospital, Capital Medical University Outlines Resistance trends
More informationparticularly to third-generation cephalosporins,
Research article Antimicrobial resistance of Neisseria gonorrhoeae isolates in south-west Germany, to 5: increasing minimal inhibitory concentrations of tetracycline but no resistance to third-generation
More informationThe Journal of Experimental Microbiology & Immunology+ Yasaman Jalalkamali, Niknaz Malekafzali, Raisa Shabbir, Tianna Sihota
Vol 4:1-10 The Journal of Experimental Microbiology & Immunology+ The RcsB-dependent Upregulation of rpra Contributes to the Intrinsic Antibiotic Resistance of Escherichia coli Exposed to Antibiotics Targeting
More informationA Multiplex Real-Time PCR with High Resolution Melting Analysis for the. Characterization of Antimicrobial Resistance in Neisseria gonorrhoeae
JCM Accepted Manuscript Posted Online 25 May 2016 J. Clin. Microbiol. doi:10.1128/jcm.03354-15 Copyright 2016, American Society for Microbiology. All Rights Reserved. 1 2 A Multiplex Real-Time PCR with
More informationThe objectives of this presentation are; to increase awareness of the issue of antimicrobial resistant gonorrhea, and to inform primary care and
1 Antimicrobial resistant gonorrhea is an emerging public health threat that needs to be addressed. Neisseria gonorrhoeae is able to develop resistance to antimicrobials quickly. Effective antibiotic stewardship
More informationCefotaxime Rationale for the EUCAST clinical breakpoints, version th September 2010
Cefotaxime Rationale for the EUCAST clinical breakpoints, version 1.0 26 th September 2010 Foreword EUCAST The European Committee on Antimicrobial Susceptibility Testing (EUCAST) is organised by the European
More informationGenotypes and antimicrobial resistant phenotypes of Neisseria gonorrhoeae in
Author manuscript, published in "Sexually Transmitted Infections 86, 6 (2010) 449" DOI : 10.1136/sti.2010.044321 Genotypes and antimicrobial resistant phenotypes of Neisseria gonorrhoeae in Portugal (2004-2009)
More informationMechanisms of Resistance to Ceftazidime-Avibactam. Romney M. Humphries, PhD D(ABMM) Chief Scientific Officer Accelerate Diagnostics.
Mechanisms of Resistance to Ceftazidime-Avibactam Romney M. Humphries, PhD D(ABMM) Chief Scientific Officer Accelerate Diagnostics UCLA, January 2015 62 year old woman with advanced pancreatic cancer Vomiting
More informationValidation of the MALDI-TOF for the Identification of Neisseria gonorrhoeae
Proposal Validation of the MALDI-TOF for the Identification of Neisseria gonorrhoeae Laboratory Director Sandip H. Shah, Ph.D. 517-335-8063 517-335-8051 (fax) ShahS@Michigan.gov Acting Director, Division
More informationReport on susceptibility of Salmonella serotypes in Belgium Vicky Jasson
CODA-CERVA Report on susceptibility of Salmonella serotypes in Belgium 2014. Vicky Jasson Veterinary and Agrochemical Research Centre 1 Introduction Salmonella is one of the most important bacterial zoonotic
More informationAntibiotic Resistance Pattern of Blood and CSF Culture Isolates At NHLS Academic Laboratories (2005)
Antibiotic Resistance Pattern of Blood and CSF Culture Isolates At NHLS Academic Laboratories (2005) Streptococcus pneumoniae (SP) Blood Culture Isolates Penicillin intermediate Penicillin Cefotaxime 336
More informationSection 10: Genetic Variation and Antibiotic
Section 10: Genetic Variation and Antibiotic Resistance TOPICS Genetic variation Antibiotic resistance mechanisms Natural selection Horizontal gene transfer SUMMARY This section is devoted to a discussion
More information6/11/15. BACTERIAL STDs IN A POST- HIV WORLD. Learning Objectives. How big a problem are STIs in the U.S.?
BACTERIAL STDs IN A POST- HIV WORLD Tracey Graney, PhD, MT(ASCP) Monroe Community College Learning Objectives Describe the epidemiology and incidence of bacterial STDs in the U.S. Describe current detection
More informationSexually Transmitted Disease Surveillance 1998 Supplement
Sexually Transmitted Disease Surveillance 1998 Supplement Division of STD Prevention November 1999 Gonococcal Isolate Surveillance Project (GISP) Annual Report - 1998 DEPARTMENT OF HEALTH AND HUMAN SERVICES
More informationMuhammad et al. BMC Infectious Diseases 2014, 14:454
Muhammad et al. BMC Infectious Diseases 2014, 14:454 RESEARCH ARTICLE Open Access Characterisation of bla TEM genes and types of β-lactamase plasmids in Neisseria gonorrhoeae the prevalent and conserved
More information