Small Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment
|
|
- Iris Hill
- 6 years ago
- Views:
Transcription
1 Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD
2 Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure: Samumed, LLC; salary and equity Allison Hood o Financial disclosure: Former employee of Samumed, LLC Yusuf Yazici, M.D. o Financial disclosure: Samumed, LLC; salary and equity
3 Disclaimer This presentation is not intended to provide a comprehensive overview of all studies using SM755. SM755 is an investigational compound currently in clinical trials; SM755 has not been approved by the US Food and Drug Administration (FDA) or any other pharmaceutical regulatory authority, and no conclusions can or should be drawn regarding the safety or effectiveness of the product candidate. While the complete mechanism of action (MOA) for SM755 is unknown, further investigation is being conducted. All of the MOA information is based on non-clinical data and the relationship to clinical benefit is unknown. This presentation is intended as a scientific exchange of medical information, is provided for educational purposes only, and is not intended for any promotional purpose or to offer medical advice; the information contained in this presentation is confidential and proprietary and is not available for further distribution in any form whatsoever.
4 Scleroderma/Systemic Sclerosis need for therapies Heterogeneous disease characterized by fibroblast dysfunction (fibrosis), small vessel vasculopathy and production of autoantibodies 1 Can be classified based on degree of skin involvement Limited cutaneous, diffuse cutaneous and without skin involvement No FDA approved therapies exist Treatment recommendations focused on immunosuppression and symptom management,3 Majority of patients experience skin sclerosis 1, 1. Van Den Hoogen, F., et al. (13) Arth. & Rheum;. Volkmann, E. R., & Furst, D. E. (15). Rheum. Dis. Clin. N. Am; 3. Kowal-Bielecka, O., (9). Ann. Rheum. Dis.,
5 Skin pathobiology of Scleroderma Clinical Pathology: 1 Dermal thickening, hardening of the skin, vascular changes Progression may lead to painful ulcerations and reactive hyperkeratosis Histopathology: Early - endothelial cell apoptosis, perivascular inflammation Late - excess extra-cellular matrix (ECM) deposition and vasculopathy Fibroblasts produce smooth muscle actin and release collagen, fibronectin and glycosaminoglycans Fibroblast activity becomes independent; mediated by TGFβ, PDGF, IL, IL13 and MCP-1 and other pathways (Notch, Hedgehog and Wnt) 1. Stern, EP. & Denton, CP (15). Rheumatic Disease Clinics of North America. Dees, C. & Distler, J.H.W. (13). Exp. Derm
6 The Wnt/β-Catenin pathway Wnt signaling is present in many cells, particularly in high turn-over tissues Wnt signaling is often implicated in development, tissue repair and regeneration Normal Wnt signaling is crucial for organ development and tissue homeostasis including skin Various human diseases are associated with abnormal Wnt signaling including SCL Mouse plantar epidermis Axin (Wnt target gene) DKK-1 (Wnt antagonist) Image from Lim, et al. (13) Science. 1. Nusse et al. 13. Wnt Signaling. Cold Spring Harbor Lab Press.. Clevers et al. 1. Science.
7 Wnt in Scleroderma Increased Wnt signaling leads to nuclear β-catenin in scleroderma fibroblasts 1 TGFβ cross-talk with Wnt signaling promotes transdifferentiation of fibroblasts into myofibroblasts, increased collagen accumulation and dermal thickening 1, Wnt activation drives upregulation of VEGF leading to angiogenesis 3 Healthy Scleroderma chromatin (blue) β-catenin (green) 1. Beyer, C., et al. (1). Ann. Rheum. Dis.. Akhmetshina, A., et al. (1) Nat. Comm. 3. Dejana, E. (1). Circ. Res.. Image Adapted from Yamamoto, T. (1). Exp.Rev. Derm.
8 Samumed has identified a candidate molecule from preclinical studies - SM755 Topical small molecule Potent inhibitor of Wnt pathway Sustained local and minimal systemic exposure Anti-fibrotic Potentially inhibits angiogenesis
9 F o ld C h a n g e o v e r D M S O R e la tiv e E x p re s s io n SM755 is a potent inhibitor of Wnt activity In vitro screening in a luciferase based Wnt reporter assay Wnt pathway inhibition confirmed by qpcr for Wnt target genes. R e la tiv e W n t in h ib itio n Wnt Target Genes 1.5. DMSO SM755 (3nM) 1. EC5=156.8nM C o n c. S M ( L o g n M ) * * * * * * * * A xin T C F L E F 1 T C F 7
10 F o l d C h a n g e o v e r u n t r e a t e d F o l d C h a n g e o v e r u n t r e a t e d F o l d C h a n g e o v e r u n t r e a t e d F o l d C h a n g e o v e r u n t r e a t e d SM755 inhibited fibrotic gene expression in dermal fibroblasts in vitro Human dermal fibroblasts treated with TGFb1 to induce fibrosis. SM755 significantly inhibited TGFb1- induced ColA1, ACTA, PAI- 1 and CTGF gene expression compared to vehicle Cola1 * * V e h i c l e T G F + T G F + V e h i c l e S M ( 1 M ) * PAI-1 * V e h i c l e T G F + T G F + V e h i c l e S M ( 1 M ) ACTA CTGF V e h i c l e T G F 1 + T G F 1 + V e h i c l e T G F 1 + T G F 1 + V e h i c l e S M ( 1 M ) V e h i c l e S M ( 1 M ) Mean ± SEM, p<.1, *p<.1, ANOVA
11 % S M A p o s itiv e c e lls SM755 reversed fibrosis in human dermal fibroblasts in vitro Human dermal fibroblasts treated with TGFb1 to induce fibrosis Treated with SM755 after 8hrs EC 5 = 15nM N o T G F - 1 T G F - 1 T G F S M SM755 decreased TGFb1-induced smooth muscle actin L o g C o n c. (u M ) TGF-β1 Stimulated Control DMSO SM755 (.3 µm) SM755 (.1 µm) αsma / DAPI αsma / DAPI αsma / DAPI αsma / DAPI
12 SM755 Concentrations (ng/g or ng/ml) SM755 sustained local & minimal systemic exposure In vivo PK following QD x 7 day topical dosing (1mg/ml) of SM755 in healthy rat skin Minimal plasma concentrations with rapid clearance C max < ng/ml in plasma Sustained local exposure and penetration into healthy skin Up to µm concentration in deeper layers (>8x expected Tx dose) High levels of compound retained in the skin beyond days No systemic toxicity observed Time After Last Dose (Days) Plasma Tendon Muscle 1 Muscle Bone Skin
13 Bleomycin model for Scleroderma Bleomycin (5µg) injected sub-cutaneous, every other day for 3 days induced scleroderma like symptoms in mice Thickening of the dermis, hardening of the skin and vascular changes in ~ weeks Bleomycin (q.a.d.) Day Day 3 Day 1 SM755 (q.d., topical.5mg/ml &.5mg/ml) SM755 (.5mg/ml and.5mg/ml) topical treatment (µl/cm ) started day 1 Skin sections stained with H&E/MT and thickness of each layer measured at areas/section, and > sections/mouse Skin Biopsy and Histology Quantification Example Dermis Adipose Tissue Deep Fascia
14 M e a n D e rm a l T h ic k n e s s (p ix e ls S E M ) M e a n D e e p F a s c ia T h ic k n e s s (p ix e ls S E M ) M e a n A d ip o s e T h ic k n e s s (p ix e ls S E M ) SM755 attenuated fibrosis in a mouse model of Scleroderma SM755 (.5mg/ml and.5mg/ml) topical treatment (µl/cm ), started day 1 Significantly reduced dermal and deep fascia thickness and increased adipose thickness on day 3 compared to vehicle treatment (p<.1) Naïve SM755 [.5] Vehicle SM755 [.5] 5 D e rm is 3 D e e p F a s c ia 3 A d ip o s e L a y e r N a ïv e V e h ic le S M (. 5 m g /m l) S M (.5 m g /m l) N a ïv e V e h ic le S M (. 5 m g /m l) S M (.5 m g /m l) N a ïv e V e h ic le S M (. 5 m g /m l) S M (.5 m g /m l) N = 7 mice/group for treatment, 6 mice/group for vehicle and 3 mice/group for naïve, Mean ± SEM, p<.1, ANOVA
15 R e la tiv e E x p re s s io n R e la tiv e E x p re s s io n R e la tiv e E x p re s s io n R e la tiv e E x p re s s io n R e la tiv e E x p re s s io n R e la tiv e E x p re s s io n SM755 inhibited Wnt signaling and attenuated fibrosis in a mouse model of Scleroderma SM755 inhibited expression of fibrotic genes and a Wnt signaling pathway gene (Axin) in bleomycin mice, compared to vehicle 1 A x in 1 T G F S M A * * 1 P A I-1 3 C T G F 3 V im e n tin 8 6 * 1 P=.56 Naive Bleomycin + Vehicle Bleomycin + SM755 (7.5 μg/cm ) 1 Mean ± SEM, n=7 mice/group for treatment, 6 mice/group for vehicle, and 3 mice/group for normal, *p<.5, p<.1 *
16 SM755 may decrease angiogenesis Representative sections stained for CD31 on day 3 CD31 - endothelial cell marker (also found in macrophages and platelets) SM755 treatment decreased CD31 staining SM755.5mg/ml Vehicle x 1x SM755.5mg/ml x 1x x 1x
17 Preclinical data suggest that SM755 may ameliorate fibrosis Wnt signaling is a pivotal pathway in fibrosis Inhibiting the Wnt pathway disrupts the fibrotic process SM755 was a potent inhibitor of Wnt/β-catenin activity SM755 reduced fibrosis and may reduce angiogenesis in an in vivo bleomycin model of SCL
18 Current status Phase 1, single blind, topical study in healthy subjects for SM755 program Primary objectives: safety and tolerability, dose ranging Secondary objective: plasma pharmacokinetics
19 Thank you
Anti-inflammatory properties of SM04690, a small molecule inhibitor of the Wnt pathway as a potential treatment for knee osteoarthritis
Anti-inflammatory properties of SM04690, a small molecule inhibitor of the Wnt pathway as a potential treatment for knee osteoarthritis V. Deshmukh 1, T. Seo 1, C. Swearingen 1, Y. Yazici 1 1 Samumed,
More informationDiscovery of a Small Molecule Inhibitor of the Wnt Pathway as a Potential Disease Modifying Treatment for Knee Osteoarthritis
Discovery of a Small Molecule Inhibitor of the Wnt Pathway as a Potential Disease Modifying Treatment for Knee Osteoarthritis Charlene Barroga, Ph.D., Yong Hu, Ph.D., Vishal Deshmukh, Ph.D., and John Hood,
More informationDiscovery of a Small Molecule Inhibitor of the Wnt Pathway (SM04690) as a Potential Disease Modifying Treatment for Knee Osteoarthritis
Discovery of a Small Molecule Inhibitor of the Wnt Pathway (SM469) as a Potential Disease Modifying Treatment for Knee Osteoarthritis Vishal Deshmukh, Ph.D., Charlene Barroga, Ph.D., Yong Hu, Ph.D., John
More informationDiscovery of a Small Molecule Wnt Pathway Inhibitor (SM04690) as a Potential Disease Modifying Treatment for Knee Osteoarthritis
Discovery of a Small Molecule Wnt Pathway Inhibitor (SM469) as a Potential Disease Modifying Treatment for Knee Osteoarthritis Vishal Deshmukh PhD, Charlene Barroga PhD, Carine Bossard PhD, Sunil KC PhD,
More informationDIA Oligonucleotide-Based Therapeutics Conference
DIA Oligonucleotide-Based Therapeutics Conference North Bethesda MD October 25-27 Translating PD Biomarkers From Preclinical Studies to Clinical Trials: MRG-201, an Oligonucleotide Mimic of mir- 29, Inhibits
More informationAbnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9
Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S1A9 Joanna Nikitorowicz-Buniak UCL Division of Medicine Systemic sclerosis
More informationEuropean Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1
PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:
More informationTissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science
Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationThe Angio-Ready Assay System
The Angio-Ready Assay System Kevin Grady, B.S. Product Line Business Manager, ATCC Cell Systems Charles Zou, Ph.D. Senior Scientist, ATCC Cell Systems About ATCC Founded in 1925, ATCC is a non-profit organization
More informationTcf21 MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W. Postn MCM ; R26 mtmg Sham GFP Col 1/3 TAC 8W TAC 2W
A Tcf21 MCM ; R26 mtmg Sham GFP Col 1/3 Tcf21 MCM ; R26 mtmg TAC 2W Tcf21 MCM ; R26 mtmg TAC 8W B Postn MCM ; R26 mtmg Sham GFP Col 1/3 Postn MCM ; R26 mtmg TAC 2W Postn MCM ; R26 mtmg TAC 8W Supplementary
More informationTissue repair. (3&4 of 4)
Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid
More informationFigure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min
Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with
More informationTAU PATHOLOGY REDUCTION WITH SM07883, A NOVEL, POTENT, AND SELECTIVE ORAL DYRK1A INHIBITOR - A POTENTIAL THERAPEUTIC FOR ALZHEIMER S DISEASE
TAU PATHOLOGY REDUCTION WITH SM07883, A NOVEL, POTENT, AND SELECTIVE ORAL DYRKA INHIBITOR - A POTENTIAL THERAPEUTIC FOR ALZHEIMER S DISEASE Benoît Melchior, Carolyn Lai, Karen Duong-Polk, Amanda Tjitro,
More informationFibrosis Models in Mice
Fibrosis Models in Mice Comparative Biosciences, Inc. 786 Lucerne Drive Sunnyvale, CA 94085 Telephone: 408.738.9260 www.compbio.com Premier Preclinical Contract Research Organization Nearly 20 years of
More informationRole of Inflammation in Pulmonary Hypertension
Role of Inflammation in Pulmonary Hypertension K. R. Stenmark University of Colorado Denver, USA Prominent Fibroproliferative Changes are Observed in the Lung Vasculature of Infants With Pulmonary Arterial
More informationWound Healing Stages
Normal Skin Wound Healing Stages Stages overlap Chronic wounds are stalled in the inflammatory phase COLLAGEN MATURATION MATRIX METALLOPROTEINASES ENDOTHELIAL CELLS EPITHELIAL CELLS MATRIX PROTEINS FIBROBLASTS
More informationPrograma Cooperación Farma-Biotech Jornada : Zaragoza. Efficacy of P17, a TGFbeta1 inhibitor peptide, in lung fibrosis and melanoma
Programa Cooperación Farma-Biotech Jornada 2-2012: Zaragoza Efficacy of P17, a TGFbeta1 inhibitor peptide, in lung fibrosis and melanoma Zaragoza, 6 de junio de 2012 Programa Cooperación Farma-Biotech
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationSupplemental Table 1. Primer sequences for transcript analysis
Supplemental Table 1. Primer sequences for transcript analysis Primer Sequence (5 3 ) Primer Sequence (5 3 ) Mmp2 Forward CCCGTGTGGCCCTC Mmp15 Forward CGGGGCTGGCT Reverse GCTCTCCCGGTTTC Reverse CCTGGTGTGCCTGCTC
More informationIL-24 AND ITS ROLE IN WOUND HEALING
IL-24 AND ITS ROLE IN WOUND HEALING Nancy J. Poindexter, Ryan Williams, Garth Powis, Sunil Chada, and Elizabeth A. Grimm & Introgen Therapeutics, Inc., Houston, TX IL-24/MDA 24/MDA-77 is a Tumor Suppressor
More informationMechanisms of hepatic fibrogenesis in chronic liver disease
Mechanisms of hepatic fibrogenesis in chronic liver disease JPEMS 2014, Physiopathology Module Corentin Bessy (Nantes) _ Gabrielle Cepella (Amsterdam) _ Charly Gaisne (Angers) _ Gwladys Guilloineau (Angers)
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationImproved Perfusion and Wound Healing in Healthy Pigs with MRG-110, an Inhibitor of microrna-92a
Restoring Biological Harmony for Patients with Debilitating Disease Improved Perfusion and Wound Healing in Healthy Pigs with MRG-11, an Inhibitor of microrna-92a Rusty Montgomery, Ph.D. April 27 th, 218
More informationScleroderma. Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis
Scleroderma Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis Incidence 3.7-22.8 cases/million Female:male 5:1 Pulmonary fibrosis common, severe
More informationTAU PATHOLOGY REDUCTION WITH SM07883, A NOVEL, POTENT, AND SELECTIVE ORAL DYRK1A INHIBITOR - A POTENTIAL THERAPEUTIC FOR ALZHEIMER S DISEASE
TAU PATHOLOGY REDUCTION WITH SM07883, A NOVEL, POTENT, AND SELECTIVE ORAL DYRK1A INHIBITOR - A POTENTIAL THERAPEUTIC FOR ALZHEIMER S DISEASE Benoît Melchior, C. Lai, K. Duong-Polk, A. Tjitro, D.C. Ince,
More informationImmunological Lung Diseases
Emphysema and Fibrosis Universitätsklinik für Pneumologie Prof. Thomas Geiser Head Div. of Pulmonary Medicine and Laboratory of Lung Research, MU50 thomas.geiser@insel.ch The healthy lung: The pathway
More informationRole of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress
3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative
More informationHealing & Repair. Tissue Regeneration
Healing & Repair Dr. Srikumar Chakravarthi Repair & Healing: Are they same? Repair :Regeneration of injured cells by cells of same type, as with regeneration of skin/oral mucosa (requires basement membrane)
More informationConnective Tissue Response in IBD
Connective Tissue Response in IBD Dr I C Lawrance MB BS, PhD FRACP School of Medicine and Pharmacology, University of Western Australia, Fremantle Hospital Intestinal response to Chronic Inflammation Control
More informationWnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model
Wnt7a Inhibits Cartilage Matrix Degradation in a Mouse In Vivo Osteoarthritis Model Averi Leahy, Andrea Foote, Tomoya Uchimura, Li Zeng, PhD. Tufts University, Boston, MA, USA. Disclosures: A. Leahy: None.
More informationThe Angiopoietin Axis in Cancer
Ang2 Ang1 The Angiopoietin Axis in Cancer Tie2 An Overview: The Angiopoietin Axis Plays an Essential Role in the Regulation of Tumor Angiogenesis Growth of a tumor beyond a limiting size is dependent upon
More informationThermal Dermal Burn Modeling in Rats and Minipigs
Thermal Dermal Burn Modeling in Rats and Minipigs Comparative Biosciences, Inc. 786 Lucerne Drive Sunnyvale, CA 94085 Telephone: 408.738.9261 www.compbio.com Premier Preclinical Contract Research Organization
More information2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy
2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications DPP-4 Inhibition and Diabetic Nephropathy Daisuke Koya Department of Diabetology & Endocrinology Kanazawa
More informationSupplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation
Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).
More informationMorphologic and histochemical changes in the skin of patients with scleroderma
Romanian Journal of Morphology and Embryology 2007, 48(4):361 367 ORIGINAL PAPER Morphologic and histochemical changes in the skin of patients with scleroderma GABRIELA IEREMIA 1), M. RAICA 2), ANCA MARIA
More informationTopically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals
Topically Applicable Stromal Cell Growth Factors - Encapsulated Cosmeceuticals Stem cells move to injured area, differentiate into neighboring cells, and replace the damaged cells Cell Eons Stem cells
More informationSupplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome
Page 1 Supplemental Data Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in Hermansky-Pudlak Syndrome Lisa R. Young, Peter M. Gulleman, Chelsi W. Short, Harikrishna Tanjore,
More informationMEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS
MEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS Andrew Leask Departments of Dentistry and Physiology and Pharmacology University of Western Ontario Dental Sciences Building London ON Canada
More informationHigh Content Imaging : Meaningful pictures for relevant results in dermocosmetology
High Content Imaging : Meaningful pictures for relevant results in dermocosmetology We deliver High Content screening services with exhaustive, high quality and robust phenotypic data. Nathalie MAUBON,
More informationKD025 in IPF: Topline Results
KD025 in IPF: Topline Results Webcast Presentation February 13, 2018 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs
More informationGamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells
Gamma-aminobutyric acid (GABA) treatment blocks inflammatory pathways and promotes survival and proliferation of pancreatic beta cells Gérald J. Prud homme, MD, FRCPC Keenan Research Centre for Biomedical
More informationDISCLOSURES. T. McAlindon: Samumed, grant/research support; Astellas, Flexion, Pfizer, Regeneron, Samumed,and Seikugaku, consulting
Radiographic Outcomes from a Randomized, Double- Blind, Placebo-Controlled, Phase 2 Study of a Novel, Intra-Articular, Wnt Pathway Inhibitor (SM04690) for the Treatment of Osteoarthritis of the Knee: Week
More informationResearch article. Department of Pharmacology and Toxicology, Medical College of Georgia, Georgia Health Sciences University, Augusta, Georgia, USA.
Research article Calpain mediates pulmonary vascular remodeling in rodent models of pulmonary hypertension, and its inhibition attenuates pathologic features of disease Wanli Ma, 1 Weihong Han, 1 Peter
More informationRecovery of Myocardial Infarction via Unique Modulation of the Cardiac Microenvironment
2016 춘계심혈관통합학술대회, 경주 Recovery of Myocardial Infarction via Unique Modulation of the Cardiac Microenvironment Youngkeun Ahn, MD, PhD Department of Cardiology, Cardiovascular Center Chonnam National University
More informationInflammation Pathways
Inflammation Pathways Siam Oottamasathien, MD FAAP FACS Associate Professor of Surgery and Pediatric Urology Research Associate Professor of Medicinal Chemistry Director of Pediatric Urology Basic Science
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationIrf1 fold changes (D) 24h 48h. p-p65. t-p65. p-irf3. t-irf3. β-actin SKO TKO 100% 80% 60% 40% 20%
Irf7 Fold changes 3 1 Irf1 fold changes 3 1 8h h 8h 8h h 8h p-p6 p-p6 t-p6 p-irf3 β-actin p-irf3 t-irf3 β-actin TKO TKO STKO (E) (F) TKO TKO % of p6 nuclear translocation % % 1% 1% % % p6 TKO % of IRF3
More informationScleroderma. Nomenclature Synonyms. Scleroderma. Progressive Systemic Sclerosis. Systemic Sclerosis. Edward Dwyer, M.D. Division of Rheumatology
Scleroderma Edward Dwyer, M.D. Division of Rheumatology Nomenclature Synonyms Scleroderma Progressive Systemic Sclerosis Systemic Sclerosis Scleroderma 1 Scleroderma Chronic systemic autoimmune disease
More informationScleroderma. Nomenclature Synonyms. Scleroderma. Progressive Systemic Sclerosis. Systemic Sclerosis. Limited vs. Diffuse Scleroderma.
Scleroderma Edward Dwyer, M.D. Division of Rheumatology Nomenclature Synonyms Scleroderma Progressive Systemic Sclerosis Systemic Sclerosis Scleroderma Chronic systemic autoimmune disease characterized
More informationCorporate Presentation
Corporate Presentation June 2018 Kadmon Holdings, Inc. 1 Disclaimers This presentation contains forward looking statements that are based on the beliefs and assumptions and on information currently available
More informationHisto lab 7. Special connective tissue is derived from the mesoderm (mesenchyme).
Histo lab 7 Special connective tissue is derived from the mesoderm (mesenchyme). If we have high density of fibers, we call it dense connective tissue. (Fibers are more than the ground substance). If we
More informationSCLERODERMA 101. Maureen D. Mayes, MD, MPH Professor of Medicine University of Texas - Houston
SCLERODERMA 101 Maureen D. Mayes, MD, MPH Professor of Medicine University of Texas - Houston TYPES OF SCLERODERMA Localized versus Systemic Two Kinds of Scleroderma Localized Scleroderma Morphea Linear
More informationCYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt
Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,
More informationYun-Jung Choi, Jiangao Song, Jeff D. Johnson, Charles McWherter. NASH-TAG Conference Park City, Utah January 4, 2019
Combination Therapy of Seladelpar and Liraglutide Attenuates Obesity, Hepatic Steatosis and Fibrosis in a Diet-induced and Biopsy-confirmed Mouse Model of NASH Yun-Jung Choi, Jiangao Song, Jeff D. Johnson,
More informationSupplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was
Supplementary Figure 1 IMQ-Induced Mouse Model of Psoriasis. IMQ cream was painted on the shaved back skin of CBL/J and BALB/c mice for consecutive days. (a, b) Phenotypic presentation of mouse back skin
More informationSupplementary Figure 1: Fn14 is upregulated in the epidermis and dermis of mice
Supplementary Figure 1: Fn14 is upregulated in the epidermis and dermis of mice undergoing AD- and psoriasis-like disease. Immunofluorescence staining for Fn14 (green) and DAPI (blue) in skin of naïve
More informationWhich molecules of the initial phase of wound healing may be used as markers for early detection of skin damage?
Which molecules of the initial phase of wound healing may be used as markers for early detection of skin damage? L.H. Cornelissen October 2004 BMTE 04.53 Promotor: prof.dr.ir. F.P.T. Baaijens Coach: dr.ir.
More informationSupplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each
Supplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each species observed. Data show a binary response to a 4 mm
More informationLack of inhibitory effects of the anti-fibrotic drug imatinib on endothelial cell functions in vitro and in vivo
J. Cell. Mol. Med. Vol 13, No 10, 2009 pp. 4185-4191 Lack of inhibitory effects of the anti-fibrotic drug imatinib on endothelial cell functions in vitro and in vivo Paulius Venalis a, b, Britta Maurer
More informationFig 1 CD163. CD11b S100A9. Sirius Red. 100μm ** ** CD163. CD11b S100A9 ** Sirius Red (PL) Sirius Red SUM Mo.
T47D T47D + o SU-59 Fig SU-59 + o IHC score (-3) IHC score (-2) CD63 3 2 IHC score (-3) CD63 3 ** 2 CDb CDb * * SA9 SA9 ** * 2 IHC score (-4) αsa αsa 4 ** ** 2 Sirius Red μm IHC score (%) Sirius Red 8
More informationSupporting Information
Supporting Information Rock et al. 10.1073/pnas.1117988108 Fig. S1. Heterogeneity of stromal cells in normal and fibrotic mouse lungs. Sections of normal mouse lungs (A and D) and fibrotic lungs collected
More informationvi Preface Table 2 Association of Fibrosis With Types of Injury: Representative Examples
Fibrosis or scar, defined pathologically as inappropriate repair by connective tissue, is increasingly recognized as an important feature of many chronic diseases (Table 1), and as such, represents an
More informationSupplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β
Supplementary Figures Supplementary Figure 1. Expression of CUGBP1 in non-parenchymal liver cells treated with TGF-β and LPS. Non-parenchymal liver cells were isolated and treated with or without TGF-β
More informationObservations on the Pathology of Lesions Associated with Stephanofilaria dinniki Round, 1964 from the Black Rhinoceros (Diceros bicornis)
Journal of Helminthology, ~ol. XXXVIII, Nos. 1/2, 1964, pp. 171-174. Observations on the Pathology of Lesions Associated with Stephanofilaria dinniki Round, 1964 from the Black Rhinoceros (Diceros bicornis)
More informationTitle: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events
Title: Smooth muscle cell-specific Tgfbr1 deficiency promotes aortic aneurysm formation by stimulating multiple signaling events Pu Yang 1, 3, radley M. Schmit 1, Chunhua Fu 1, Kenneth DeSart 1, S. Paul
More informationSupplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
More informationIKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung
IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung Se-Ran Yang, Samantha Valvo, Hongwei Yao, Aruna Kode, Saravanan Rajendrasozhan, Indika Edirisinghe, Samuel
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationBiomarker Discovery: Prognosis and Management of Chronic Diabetic Foot Ulcers
Biomarker Discovery: Prognosis and Management of Chronic Diabetic Foot Ulcers Joseph Colasurdo, BS Dr. William M. Scholl College of Podiatric Medicine July 29, 2017 S Disclosure of Conflicts of Interest
More informationLymphoid System: cells of the immune system. Answer Sheet
Lymphoid System: cells of the immune system Answer Sheet Q1 Which areas of the lymph node have most CD3 staining? A1 Most CD3 staining is present in the paracortex (T cell areas). This is towards the outside
More informationhemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and
More informationSupplementary Figure 1. DNA methylation of the adiponectin promoter R1, Pparg2, and Tnfa promoter in adipocytes is not affected by obesity.
Supplementary Figure 1. DNA methylation of the adiponectin promoter R1, Pparg2, and Tnfa promoter in adipocytes is not affected by obesity. (a) Relative amounts of adiponectin, Ppar 2, C/ebp, and Tnf mrna
More informationFavorable human safety, pharmacokinetics and pharmacodynamics of the autotaxin inhibitor GLPG1690, a potential new treatment in COPD
Favorable human safety, pharmacokinetics and pharmacodynamics of the autotaxin inhibitor GLPG1690, a potential new treatment in COPD Ellen M. van der Aar, PhD Galapagos, Mechelen, Belgium L. Fagard, J.
More informationPeripheral (digital) vasculopathy in systemic. sclerosis. Ariane Herrick
Peripheral (digital) vasculopathy in systemic sclerosis Ariane Herrick Raynaud s phenomenon VASOPASM DEOXYGENATION REPERFUSION Main causes of RP Primary (idiopathic) Connective tissue diseases, including
More informationSosei Group Corporation
Sosei Group Corporation Shinichi Tamura President and CEO www.sosei.com Sosei History - Background Incorporated in Japan in 1990 and traded initially as a technology transfer company In 1999 switched to
More informationSupplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells
Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells (b). TRIM33 was immunoprecipitated, and the amount of
More informationAdjunctive Therapies: The Use of Skin Substitutes and Growth Factors in Venous Leg Ulceration (VLU)
Adjunctive Therapies: The Use of Skin Substitutes and Growth Factors in Venous Leg Ulceration (VLU) Sami Khan, MD FACS Associate Professor of Surgery Division of Plastic and Reconstructive Surgery SUNY-Stony
More informationCorporate Presentation
Corporate Presentation November 2016 Kadmon Holdings, Inc. 1 Forward-looking Statement This presentation contains forward looking statements that are based on the beliefs and assumptions and on information
More informationEvaluation of the wound healing response post - deep dermal heating by fractional RF: INTRACEL
12th symposium of the Association of Korean Dermatologists (2009) 1 Evaluation of the wound healing response post - deep dermal heating by fractional RF: INTRACEL Un-Cheol.Yeo, MD S&U Dermatologic Clinic,
More informationMANIFEST Phase 2 Enhancement / Expansion
MANIFEST Phase 2 Enhancement / Expansion Investor Conference Call Stellar Science, Breakthrough Medicine October 11, 2018 Forward-Looking Statements This presentation contains forward-looking statements
More informationJournal Club WS 2012/13 Stefanie Nickl
Journal Club WS 2012/13 Stefanie Nickl Background Mesenchymal Stem Cells First isolation from bone marrow 30 ys ago Isolation from: spleen, heart, skeletal muscle, synovium, amniotic fluid, dental pulp,
More informationCh 4. Skin and Body Membranes
Ch 4 Skin and Body Membranes TITLE HISTOLOGY SLIDES & NOTES ESSENTIAL QUESTION What tissues compose the integumentary system? Stratified Squamous Epithelium Stratified = several layers; Squamous = shape
More informationRicardo E. Colberg, MD, RMSK. PM&R Sports Medicine Physician Andrews Sports Medicine and Orthopedic Center American Sports Medicine Institute
Ricardo E. Colberg, MD, RMSK PM&R Sports Medicine Physician Andrews Sports Medicine and Orthopedic Center American Sports Medicine Institute Pathophysiology of chronic orthopedic injuries Definition of
More informationSupplemental Table 1: Demographics and characteristics of study participants. Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± ± 9.
SUPPLEMENTAL DATA Supplemental Table 1: Demographics and characteristics of study participants Lean (n=15) Obese (n=12) Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± 9.5 44.8 ± 9.1 White, n
More informationRath, N., and Olson, M. (2016) Regulation of pancreatic cancer aggressiveness by stromal stiffening. Nature Medicine, 22(5), pp. 462-463. There may be differences between this version and the published
More informationCathepsin S Inhibitors for the Treatment of Inflammatory Bowel Disease. Therapeutic Area Partnerships Presentation.
Inhibitors for the Treatment of Inflammatory Bowel Disease Therapeutic Area Partnerships Presentation November 29, 2012 Cathepsin Cysteine Proteinases Fibrosis Cathepsin O Cathepsin B Cathepsin C Cathepsin
More informationsupplementary information
DOI: 10.1038/ncb2133 Figure S1 Actomyosin organisation in human squamous cell carcinoma. (a) Three examples of actomyosin organisation around the edges of squamous cell carcinoma biopsies are shown. Myosin
More informationKD : A Phase 2 Trial of KD025 to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF)
-207: A Phase 2 Trial of to Assess Safety, Efficacy and Tolerability in Patients with Idiopathic Pulmonary Fibrosis (IPF) K. F. Gibson 1, F. Averill 2, T.E. Albertson 3, D. M. Baratz 4, S. Chaudhary 5,
More informationNature Medicine: doi: /nm.4324
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Supplementary Figure 1. Kinetics of SnCs development in surgically-induced OA and effect of GCV-induced SnC clearance on OA disease progression
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure S1: Fibroblast-induced elongation of cancer cells requires direct contact with living fibroblasts. A. Representative images of HT29-GFP cultured in the presence
More informationAs outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the
3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing
More informationSupplementary Materials. for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis
Supplementary Materials for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis 1 Supplementary Figure Legends Supplementary Figure 1: Integrin expression
More informationEvaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel
12th symposium of the Association of Korean Dermatologists (2009) 1 Evaluation of the wound healing response post deep dermal heating by fractional RF: INTRAcel Un-Cheol.Yeo, M.D. S&U Dermatologic Clinic,
More informationSupplemental Methods: Histopathology scoring of individual components of Valentino
Supplementary Materials Online: Supplemental Methods: Histopathology scoring of individual components of Valentino synovitis grade and Mankin cartilage pathology scale Hemophilic synovitis was graded 0-10
More informationPostnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter
Postnatal Hyperoxia-induced Lung and Retinal Injury in Infant Rats: Qin Zhang, Alireza Ebrahimnejad, Felisha Paniagua, Robert Sukhu, Carol Meschter Comparative Biosciences, Inc 786 Lucerne Drive Sunnyvale,
More informationIn the treatment of partial and full-thickness chronic wounds TRANSFORM YOUR APPROACH TO HEALING: SIGNAL THE BODY, NOT THE WOUND DERMA
In the treatment of partial and full-thickness chronic wounds TRANSFORM YOUR APPROACH TO HEALING: SIGNAL THE BODY, NOT THE WOUND DERMA It s time to signal a new direction in chronic wound treatment. WHY
More informationExpressional Changes In Growth And Inflammatory Mediators During Achilles Tendon Repair In Diabetic Rats.
Expressional Changes In Growth And Inflammatory Mediators During Achilles Tendon Repair In Diabetic Rats. Paul W. Ackermann, MD, PhD 1, Aisha Ahmed, PhD 1, Nicos Schizas, MD 1, Jian Li, MD, PhD 1, Mahmood
More informationImmunology of Wound Healing
Immunology of Wound Healing Danielle Tartar, MD, PhD Assistant Clinical Professor Interim Director of Inpatient Dermatology University of California - Davis Outline Traditional model of wound healing Role
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More information