Investigating Ribonuclease A Modification Induced by Quinones Using UV/Vis Spectroscopy
|
|
- Kellie Haynes
- 5 years ago
- Views:
Transcription
1 Investigating Ribonuclease A Modification Induced by Quinones Using UV/Vis Spectroscopy Caitlin Redman, Albert Vaughn, Steve Ledford and Jisook Kim, University of Tennessee at Chattanooga, Chattanooga, TN
2 Introduction The goal of this research project is to have a better understanding on the biochemical behavior and biological effect(s) of various quinones that are known to be cellular metabolites of benzene and substituted benzenes. Benzene as well as polycyclic aromatic hydrocarbons are considered to be health hazards. Exposure to these chemicals can occur in a variety of ways such as cigarette smoke, gasoline vapors, pesticides, cosmetics, and food preservatives. This research project primarily focuses on studying the effects that certain quinones have on proteins. Ribonuclease A, RNase, is the model protein used for this project. Several studies suggest that quinones can cause modifications that lead to toxic and abnormal cell behavior. Such modifications include oxidative damage, lipid modification, and/or nucleic acid modifications. There are, however, many details concerning the outcome of such interactions which are not clearly understood. The interaction and subsequent modification of RNase with three different quinones,,-benzoquinone, -chloro-,- benzoquinone, and -methyl-,-benzoquinone, are studied using a UV/Vis spectroscopic approach.
3 Quinones Studied O O O O Cl O O CH -chloro-,-benzoquinone (ClpBQ),-benzoquinone (pbq) -methyl-,-benzoquinone (MepBQ) Polycyclic aromatic hydrocarbons (PAHs) are wide spread environmental toxins. Exposure to these chemicals can occur in a variety of ways. Such ways include: Cigarette Smoke Grilled Meat Paint & Furniture Polish Petroleum Products Food Preservatives The three quinones shown on the left were used during this research project.
4 Proposed Mechanism Oxidative damage Pathway I O O - OH OH [O] O O Protein Nu Pathway II Adduct formation H N O Lys + H N Lys Lys Pathway III Protein crosslink
5 Sequence Map of Ribonuclease A Smyth, D.G., Stein, W.H., and Moore, S. J. Biol. Chem. 8, 7 (96) KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKP VNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCR ETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
6 The Binding of IMP to Ribonuclease A Febs J. v7 pp. 988-, 5 (Z6D)
7 Time Dependent UV/Vis Spectra of RNase Control This graph represents the time dependent stability test of.5mg RNase in a 5mM phosphate buffer, ph 7. The spectrum was scanned every minutes for hours. The spectral data shown demonstrates that our model protein, RNase A, is a stable molecule..5mg RNase in phosphate buffer, ph nm
8 Time Dependent Stability Test of Quinones The time dependent stability of our quinones were studied by taking a spectral scan on the UV/Vis every hour for hours using. The quinones were in a 5mM phosphate buffer, ph 7 and the temperature was set at 7 C. 5 mm Methyl-pBQ Stability Test 5 nm mm p BQ Stability Test 5 mm Cl-p BQ Stability Test 9 nm 9 nm
9 UV/Vis Reactions of pbq and RNase at Various [pbq] mm pbq,.5mg RNase Initial Scan mm pbq,.5mg RNase Initial Scan mm pbq,.5mg RNase Initial Scan mM pbq,.5mg RNase Initial Scan
10 Representative Spectra of RNase Modification by pbq A bsorbance mm pbq,.5mg RNase.5mM pbq and.5mg RNase A bsorbance Initial Scan Spectral Scan every mins for hours Spectral Overlay Daily Spectral Scans for approximately weeks.
11 Determining the Rate Constant Time Dependent Progress of RNase Modification by pbq Time (hours).5mm pbq mm pbq mm pbq mm pbq 5mM pbq Time Dependent Progress of RNase Modification by pbq at 5nm.5.5 Time (hours).5mm pbq mm pbq mm pbq mm pbq 5mM pbq The rate constant of RNase modification by pbq was calculated by selecting a chromophore that was unique to the spectrum of RNase plus quinone. In the case of pbq, a wavelength of 5nm was selected and plotted against time (hrs). Application of the appropriate equations give rise to the reaction rate constant.
12 Kinetic Analysis Rate constant (hr-) Kinetic model: Pseudo first order condition [pbq] is in excess relative to RNase A. U P Kinetic equation used: ln A -A t A -A = -k t Rate Constants: Reaction of RNase A & pbq 5 6 [pbq] (mm) U: Unmodified RNase P: Modified RNase A : of P at the time infinity A t : of P at time t A : Initial absorbance of P k : Pseudo first order rate constant t : Reaction time
13 UV/Vis Scans of mm Methyl-pBQ & mm Cl-pBQ A bsorbance mm Methyl-pBQ,.5mg RNase Initial Scan mm Cl-pBQ,.5mg RNase Initial Scan The rate constant for the Methyl-pBQ and Cl-pBQ has not yet been determined. The spectral data generated for these two quinones did not possess a chromophore unique only to the reaction between the quinone and RNase. Further experimentation will be completed in order to calculate the rate constant.
14 Finding the Optimal Conditions for Dialysis 5 mm p-bq 6hr Dialysis (Tubing) 5 mm p-bq 6hr Dialysis (Snake Skin) Before Dialysis After Dialysis Before Dialysis After Dialysis Wavlength (nm) 5 mm p-bq hr Dialysis (Tubing) 5 mm p-bq hr Dialysis (Tubing) Before Dialysis After Dialysis Before Dialysis After Dialysis Wavlength (nm)
15 UV/Vis Data After Removal of Excess Quinones mm p-bq,.5mg RNase After hr Dialysis hr Incubation Time hr Incubation Time 9hr Incubation Time 7hr Incubation Time mm Cl-pBQ,.5mg RNase After hr Dialysis hr Incubation Time hr Incubation Time 9hr Incubation Time 7.5hr Incubation Time
16 DNP Trapping Experiment A. Intact protein B. Modified protein C. DNP tagged protein Quinone,-DNP O N Dialysis Spectral Scan Lys NH Lys O Lys N NH NO Unmodified RNase treated with,-dnp A bsorbance Modified RNase treated with,-dnp
17 References Bolten, J. L., Trush, M. A., Penning, T. M., Dryhurst, G., Monks, T. J. () Role of Quinones in Toxicology. Chem. Res. Toxicol., 5-6. Bolten, J. L., Pisha, E., Zhang, F., and Qiu, S. (998) Role of quinoids in estrogen carcinogensis. Chem. Res. Toxicol., -7. Monks, T. J., Hanzlik, R. P., Cohen, G. M., Ross, D., and Graham, D. G. (99) Contemporary issues in toxicology: Quinone chemistry and toxicity. Toxicol. Appl. Pharmacol., -6. O Brien, P. J. (99) Molecular mechanisms of quinone cytotoxicity. Chem.-Biol. Interact. 8, -.
Body in a Lab: Aspirin Overdose
Exercise 3 Body in a Lab: Aspirin Overdose 3 Introduction A body has been found in the Lab! The deceased, Mr Blue, was known to be taking aspirin and a sample of his blood plasma has been sent for analysis.
More informationSupporting Information
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Supporting Information A new ICT and CHEF based visible light excitable fluorescent probe easily
More informationElectronic Supplementary Information (ESI) A unique dansyl-based chromogenic chemosensor for rapid and ultrasensitive hydrazine detection
Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is The Royal Society of Chemistry 2014 Electronic Supplementary Information (ESI) A unique dansyl-based chromogenic
More informationThe Tincture of Kraft Pulps. Art J. Ragauskas, Tom J. Dyer Institute of Paper Science and Technology Georgia Institute of Technology
The Tincture of Kraft Pulps Art J. Ragauskas, Tom J. Dyer Institute of Paper Science and Technology Georgia Institute of Technology verview of Kraft Pulping + 200 year old technology Insensitive to wood
More informationElectronic Supplementary Material
Electronic Supplementary Material PAMAM Dendrimers Bearing Electron-Donating Chromophores: Fluorescence and Electrochemical Properties Bing-BingWang a, Xin Zhang a, Ling Yang a, Xin-Ru Jia* a, Yan Ji a,
More informationOxisResearch A Division of OXIS Health Products, Inc.
OxisResearch A Division of OXIS Health Products, Inc. BIOXYTECH MDA-586 Spectrophotometric Assay for Malondialdehyde For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number 21044 INTRODUCTION
More informationSUPPORTING INFORMATION
SUPPORTING INFORMATION Reduction of Aromatic and Heterocyclic Aromatic N-Hydroxylamines by Human Cytochrome P450 2S1 Wang, K., and Guengerich, F. P. (2013) Chem. Res. Toxicol. 26, 000-000 Figure S1. HPLC
More informationSUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to
More informationMetabonomics and MRS BCMB/CHEM 8190
Metabonomics and MRS BCMB/CHEM 8190 Metabolomics, Metabonomics, Metabolic Profiling! Definition: The quantitative measurement of the dynamic multi parametric metabolic response of living systems to physiological
More informationToxicity profiles of heterocyclic aromatic amines Bettina Seeger and Pablo Steinberg
Toxicity profiles of heterocyclic aromatic amines Bettina Seeger and Pablo Steinberg Institute for Food Toxicology and Analytical Chemistry Mutagenic compounds present in strongly heated meat polycyclic
More informationNEAR INFRARED TRANSMISSION SPECTROSCOPY AS APPLIED TO FATS AND OIL
NEAR INFRARED TRANSMISSION SPECTROSCOPY AS APPLIED TO FATS AND OIL Phillip J. Clancy, NIR Technology Systems, 56 Kitchener Pde, Bankstown, NSW, Australia. Near Infrared Transmission (NIT) Spectroscopy
More informationElectronic Supporting Information
Electronic Supporting Information Detection of Hg 2+ by Cyanobacteria in Aqueous media. Moorthy Suresh, Sanjiv K. Mishra, Sandhya Mishra* and Amitava Das* Contents 1. Absorption spectrum of C-Phycocyanin
More informationUV Spectrophotometric Estimation of Alprazolam by Area Under Curve And First Order Derivative Methods in Bulk and Pharmaceutical Dosage Form
Available online at www.scholarsresearchlibrary.com Scholars Research Library Der Pharmacia Lettre, 2016, 8 (5):105-110 (http://scholarsresearchlibrary.com/archive.html) ISSN 0975-5071 USA CODEN: DPLEB4
More informationUV Tracer TM Maleimide NHS ester
UV Tracer TM Maleimide HS ester Product o.: 1020 Product ame: UV-Tracer TM Maleimide-HS ester Chemical Structure: Chemical Composition: C 41 H 67 5 18 Molecular Weight: 1014.08 Appearance: Storage: Yellow
More informationGraphene Quantum Dots-Band-Aids Used for Wound Disinfection
Supporting information Graphene Quantum Dots-Band-Aids Used for Wound Disinfection Hanjun Sun, Nan Gao, Kai Dong, Jinsong Ren, and Xiaogang Qu* Laboratory of Chemical Biology, Division of Biological Inorganic
More informationEquation y = a + b*x Adj. R-Square Value Standard Error Intercept E Slope
Absorbance (a.u.) 4 3 2 1 Equation y = a + b*x Adj. R-Square 0.99826 Value Standard Error Intercept 4.08326E-4 0.02916 Slope 1.58874 0.02503 0 0.0 0.5 1.0 1.5 2.0 2.5 3.0 Electron concentration (mmol/l)
More informationof Serum Oxidation V max ) and
SUPPLEMENTAL DATA Paradoxical Effects of Serum Amyloid A on the Lipoprotein Oxidation Suggest a New Antioxidant t Function for SAA Shobini Jayaraman, Christian Haupt, and Olga Gursky Figure S1. Lipid peroxidation
More informationChemically Reactive Drug Metabolites in Drug Discovery and Development Detection, Evaluation, and Risk Assessment
Chemically Reactive Drug Metabolites in Drug Discovery and Development Detection, Evaluation, and Risk Assessment Pacific Northwest Bio Meeting Seattle, WA, August 14, 2012 Thomas A. Baillie, PhD, DSc
More informationHemoglobin Denaturation in the Presence of Chloroquine Phosphate
522 Journal of Pharmaceutical, Chemical and Biological Sciences ISSN: 2348-7658 CODEN: JPCBBG Impact Factor (GIF): 0.701 Impact Factor (SJIF): 2.092 December 2016- February 2017; 4(4): 522-533 Published
More informationDevelopment of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells
Supporting Information for Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells Sasa Zhu, Weiying Lin,* Lin Yuan State Key Laboratory of Chemo/Biosensing
More informationTitle. YOON, Seokjoo; MARUYAMA, Yutaka; KA FUJITA, Shoichi. Author(s) Issue Date /jjvr
Title Application of FT-IR and ESR spectr study of CCl_4-induced peroxidation Author(s) YOON, Seokjoo; MARUYAMA, Yutaka; KA FUJITA, Shoichi Citation Japanese Journal of Veterinary Rese Issue Date 2000-02-29
More informationHOW CAN MECHANISTIC DATA FROM SYSTEMS APPROACHES IMPROVE OF OUR UNDERSTANDING OF CARCINOGENIC RISK FOR MIXTURES?
HOW CAN MECHANISTIC DATA FROM SYSTEMS APPROACHES IMPROVE OF OUR UNDERSTANDING OF CARCINOGENIC RISK FOR MIXTURES? Susan Tilton, Ph.D. Assistant Professor Environmental and Molecular Toxicology Department
More informationSupplementary Material
Supplementary Material High Photo-Electrochemical Activity of Thylakoid-Carbon Nanotube Composites for Photosynthetic Energy Conversion Jessica O. Calkins a, Yogeswaran Umasankar a, Hugh O Neill b and
More informationCopyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2003 Chem. Eur. J Supporting Information. for
Copyright Wiley-VCH Verlag GmbH & Co. KGa, 69451 Weinheim, 2003 Chem. Eur. J. 2003 Supporting Information for Kinetics of quation and nation of Ruthenium(II) rene nticancer Complexes, cidity and X-ray
More informationSupporting Information for:
Supporting Information for: Tunable Heptamethine-Azo Dye Conjugate as an IR Fluorescent Probe for the Selective Detection of Mitochondrial Glutathione over Cysteine and Homocysteine Soo-Yeon Lim, 1 Keum-Hee
More informationENVIRONMENTAL FACTORS IN VIRUS-ASSOCIATED HUMAN CANCERS
ENVIRONMENTAL FACTORS IN VIRUS-ASSOCIATED HUMAN CANCERS Joint Graduate Seminar Depar tment of Microbiology The Chinese University of Hong Kong PhD Candidate: Zhang Chuqing Super visor: Professor Paul Chan
More informationDiffuse reflectance ultraviolet spectroscopic studies of paper
Diffuse reflectance ultraviolet spectroscopic studies of paper Application Note Author M. Archard Agilent Technologies, Inc. Mulgrave, Victoria 3170, Australia A. J. Michell CSIRO Division of Forestry
More informationChemistry 14C Spring 2018 Second Midterm Exam Page 1
Chemistry 14C Spring 2018 Second Midterm Exam Page 1 Begin this exam by gently removing the last two pages. Nothing on these pages will be graded. These pages will be discarded prior to grading. Please
More informationLesmahagow High School
Lesmahagow High School Higher Chemistry Alcohols and Esters - Past Paper Homework Questions . Carbohydrates are an essential part of our diet. (a) Why are carbohydrates an important part of our diet? (b)
More informationResearch of the Measurement on Palmitic Acid in Edible Oils by Near-Infrared Spectroscopy
Research of the Measurement on Palmitic Acid in Edible Oils by Near-Infrared Spectroscopy Hui Li 1, Jingzhu Wu 1*, Cuiling Liu 1, 1 College of Computer & Information Engineering, Beijing Technology and
More informationANTIOXIDANT ACTIVITY OF THE 1,7-DIARYLHEPTANOIDS AND THEIR METAL COMPLEXES
ANTIOXIDANT ACTIVITY OF THE 1,7-DIARYLHEPTANOIDS AND THEIR METAL COMPLEXES Malini.P.T Lanthanide complexes of curcuminoids Thesis. Department of Chemistry, University of Calicut, 2004 CHAPTER IV ANTIOXIDANT
More informationLipid Peroxidation Assay
Package Insert Lipid Peroxidation Assay 96 Wells For Research Use Only v. 1.0 Eagle Biosciences, Inc. 82 Broad Street, Suite 383, Boston, MA 02110 Phone: 866-419-2019 Fax: 617-419-1110 INTRODUCTION Lipid
More informationAvailable online Research Article
Available online www.jocpr.com Journal of Chemical and Pharmaceutical Research, 2016, 8(3):289-294 Research Article ISSN : 0975-7384 CODEN(USA) : JCPRC5 Simultaneous UV-spectrophotometric estimation of
More informationRecent Studies of Phenylketonuria By: Jennifer Gastelum Dr. Koni Stone Copyright 2014
Recent Studies of Phenylketonuria By: Jennifer Gastelum Dr. Koni Stone Copyright 2014 Phenylketonuria (PKU) is an autosomal recessive genetic disorder that causes an accumulation of toxic metabolites in
More informationSupporting Information
Supporting Information Extracellular Saccharide-Mediated Reduction of Au 3+ to Gold Nanoparticles: New Insights for Heavy Metals Biomineralization on Microbial Surfaces Fuxing Kang,, Xiaolei Qu, Pedro
More informationUV ABSORBANCE OF LYMPHOCYTES ABSTRACT
UV ABSORBANCE OF LYMPHOCYTES Terentyeva Y. Physical Faculty of Taras Shevchenko Kyiv Taras Shevchenko University UKRAINE Pivovarenko Y. Research and Training Center Physical and Chemical Materials Science
More informationSupplementary Figure 1. DTPA does not interfere with the activity of catalase. Dependency of CAT activity on DTPA concentration at 25 C.
Supplementary Figure 1. DTPA does not interfere with the activity of catalase. Dependency of CAT activity on DTPA concentration at 25 C. CAT (40 nm) was pre-incubated for 120 min with DTPA (0-10 mm) before
More informationResearch Topic Seminar
Research Topic Seminar Dr. Claire Coleman The Chemistry and Biology of Wortmannin Claire Coleman @ Wipf Group 1 3/13/2004 ff white to pale yellow solid Hygroscopic/Light sensitive Small molecule natural
More informationSCREENING OF BANGLADESHI VEGETABLES FOR PEROXIDASE. Md. Tanvir Hossain* 1, Md. Abdur Rashid 2 and M. Taufiq Alam 2
IJPSR (23), Vol. 4, Issue 5 (Research Article) Received on 2 January, 23; received in revised form, 26 March, 23; accepted, 26 April, 23 SCREENING OF BANGLADESHI VEGETABLES FOR PEROXIDASE Md. Tanvir Hossain*,
More informationNaoya Takahashi, Keiya Hirota and Yoshitaka Saga* Supplementary material
Supplementary material Facile transformation of the five-membered exocyclic E-ring in 13 2 -demethoxycarbonyl chlorophyll derivatives by molecular oxygen with titanium oxide in the dark Naoya Takahashi,
More informationEnvironmental Toxicology Final Examination Monday, April 26, 2004
Environmental Toxicology Final Examination Monday, April 26, 2004 Name For questions 1-14, circle the letter corresponding to the correct statement(s). Any number of selections may be correct. Incorrect
More informationThis student paper was written as an assignment in the graduate course
77:222 Spring 2001 Free Radicals in Biology and Medicine Page 0 This student paper was written as an assignment in the graduate course Free Radicals in Biology and Medicine (77:222, Spring 2001) offered
More informationBiomarkers in Public Health: Development and Applications
Biomarkers in Public Health: Development and Applications Irina Stepanov, Ph.D. Assistant Professor Division of Environmental Health Sciences and Masonic Cancer Center University of Minnesota Biomarker
More informationEnzChek Myeloperoxidase (MPO) Activity Assay Kit
EnzChek Myeloperoxidase (MPO) Activity Assay Kit Catalog no. E33856 Table 1 Contents and storage Material* Amount Concentration Storage Stability 3 -(p-aminophenyl) fluorescein (APF) (Component A) 5 µl
More informationCHAPTER 5 MEASUREMENT OF UREA AND URIC ACID IN BLOOD SERUM
79 CHAPTER 5 MEASUREMENT OF UREA AND URIC ACID IN BLOOD SERUM 5.1 INTRODUCTION Urea and Uric acid are the metabolic nitrogenous wastes present in the body that can be measured in blood and urine. Serum
More informationSYNTHESIS, CHARACTERIZATION AND BIOCHEMICAL EVALUATION OF N-[3-(SUBSTITUTED PHENYL)-1-OXO- 2-PROPHENYL] ALANINE
Int. J. Chem. Sci.: 13(2), 2015, 837-848 ISSN 0972-768X www.sadgurupublications.com SYNTHESIS, CHARACTERIZATION AND BIOCHEMICAL EVALUATION OF N-[3-(SUBSTITUTED PHENYL)-1-OXO- 2-PROPHENYL] ALANINE B. NAGA
More informationFluorescent Carbon Dots as Off-On Nanosensor for Ascorbic Acid
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2014 Fluorescent Carbon Dots as Off-On Nanosensor for Ascorbic Acid Jun Gong, Xin Lu, Xueqin An*
More informationSupporting Information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2015 Supporting Information A Nonheme Manganese(IV)-Oxo Species Generated in Photocatalytic Reaction
More informationSupplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.
Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50
More informationPractical experiments / Oil/protein crops
ASPECTS OF PRODUCT QUALITY IN PLANT PRODUCTION Practical experiments / Oil/protein crops 1. Glucosinolates 2. NIRS for oil / protein / carbohydrate content Analytical methods for crop Pre-requisites quality
More informationApplication of click chemistry to the production of DNA microarrays
Application of click chemistry to the production of DNA microarrays Barbara Uszczyńska 1, Tomasz Ratajczak 2, Emilia Frydrych 3, Hieronim Maciejewski 3,4, Marek Figlerowicz 1,5, Wojciech T. Markiewicz
More informationRDP Cores Highlights: the CF Analytics Core. Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology
CF@LANTA RDP Cores Highlights: the CF Analytics Core Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology CF@LANTA RDP Center The CF@LANTA RDP Center at Emory University
More informationIdentification of novel endophenaside antibiotics produced by Kitasatospora sp. MBT66
SUPPORTING INFORMATION belonging to the manuscript: Identification of novel endophenaside antibiotics produced by Kitasatospora sp. MBT66 by Changsheng Wu 1, 2, Gilles P. van Wezel 1, *, and Young Hae
More informationMembrane Fluidity Changes Are Associated with Benzo[a]Pyrene-Induced Apoptosis in F258 Cells
Membrane Fluidity Changes Are Associated with Benzo[a]Pyrene-Induced Apoptosis in F258 Cells Protection by Exogenous Cholesterol MORGANE GORRIA, a XAVIER TEKPLI, a ODILE SERGENT, b LAURENCE HUC, a FRANÇOIS
More informationIdentification of Aromatic Fatty Acid Ethyl Esters
Chapter 3.2 Identification of Aromatic Fatty Acid Ethyl Esters The only use of gas chromatography is not sufficient to determine which compounds are eluting from the catalytic bed. At the beginning of
More informationENZYMES QUESTIONSHEET 1
QUESTIONSHEET 1 The apparatus illustrated below can be used to investigate the activity of the enzyme catalase, which is found in liver. The liver tissue has been ground up and mixed with a buffer solution.
More informationGreat Lakes Generation
Great Lakes Generation Jack Boilerman 20338 Progress Dr. Strongsville, OH 44149 216-251-2510 Machine No: 19-1-3007 Fluid Type: Phosphate Ester Machine Type: EHC Hydraulic System Sample Source: Unit 1 EHC
More informationAnalysis of Polyphenoloxidase Enzyme Activity from Potato Extract Biochemistry Lab I (CHEM 4401)
Analysis of Polyphenoloxidase Enzyme Activity from Potato Extract Biochemistry Lab I (CHEM 4401) Background Enzymes are protein molecules (primarily) that serve as biological catalysts. They are responsible
More informationMass Spectrometry Introduction
Mass Spectrometry Introduction Chem 744 Spring 2013 What MS is and is not MS is NOT a spectroscopic method. Molecules are not absorbing EM radiation MS is the generation, separation and characterization
More informationMechanisms of dopamine and dobutamine interference in biochemical tests that use peroxide and peroxidase to generate chromophore
Clinical Chemistry 44:1 155 160 (1998) General Clinical Chemistry Mechanisms of dopamine and dobutamine interference in biochemical tests that use peroxide and peroxidase to generate chromophore Brad S.
More informationReduction of p-benzoquinone on lipid-modified electrodes: effect of the alkyl chain length of lipids on the electron transfer reactions
www.elsevier.nl/locate/jelechem Journal of Electroanalytical Chemistry 484 (2000) 131 136 Reduction of p-benzoquinone on lipid-modified electrodes: effect of the alkyl chain length of lipids on the electron
More informationDatasheet 5-Hydroxythiabendazole
Datasheet 5-Hydroxythiabendazole Reference number : CEC/MAT : 34 Date of preparation : 1995.02.03 date : 2001.07.12 source : CSL "Bank of Reference Standards" The Bank of Reference Standards was financially
More informationdna oestrogen GENOTYPE REPORT Patient Name: Date of Birth: Sample Number: Referring Practitioner: Date Reported:
dna oestrogen GENOTYPE REPORT Patient Name: Date of Birth: Sample Number: Referring Practitioner: Date Reported: BACKGROUND TO THE ANALYSIS The importance of both oestrogen and progesterone in breast cancer
More informationMS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine
Application Note: 346 MS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine Gargi Choudhary and Diane Cho, Thermo Fisher Scientific, San Jose, CA Wayne Skinner and
More informationUser s Manual and Instructions
User s Manual and Instructions Mitochondria Activity Assay (Cytochrome C Oxidase Activity Assay) Kit Catalog Number: KC310100 Introduction Mitochondria are the eukaryotic subcellular organelles that contain
More informationA ph-dependent Charge Reversal Peptide for Cancer Targeting
Supporting Information A ph-dependent Charge Reversal Peptide for Cancer Targeting Naoko Wakabayashi 1, Yoshiaki Yano 1, Kenichi Kawano 1, and Katsumi Matsuzaki 1 1 Graduate School of Pharmaceutical Sciences,
More informationTECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn
GlycoProfile II Enzymatic In-Solution N-Deglycosylation Kit Product Code PP0201 Storage Temperature 2 8 C TECHNICAL BULLETIN Product Description Glycosylation is one of the most common posttranslational
More informationConcurrent Exposure to Ototoxic Chemicals and Noise
1 Concurrent Exposure to Ototoxic Chemicals and Noise Many common industrial chemicals are ototoxic (poisonous to the ears) and as damaging to employees hearing as the industrial noise to which they are
More informationAn Auspicious Application of Laccase and Hydrogen Peroxidases for Biobleaching of Recalcitrant Paper Dyes
An Auspicious Application of Laccase and Hydrogen Peroxidases for Biobleaching of Recalcitrant Paper Dyes Kristina Knutson and Arthur Ragauskas, Institute of Paper Science and Technology, Atlanta, GA %
More informationEngineering of Ministry of Education, Institute of Molecular Science, Shanxi University, Taiyuan , China.
Indicator approach to develop a chemosensor for the colorimetric sensing of thiol-containing in water and its application for the thiol detection in plasma Fang-Jun Huo, a Yu-Tao Yang, b Jing Su, b Yuan-Qiang
More informationQuality of oilseeds, protein crops and fibre plants
Aspects of Product Quality in Plant Production ASPECTS OF PRODUCT QUALITY IN PLANT PRODUCTION Oil and protein analytics (Practical experiments) J. Vollmann, November 2016 1. Glucosinolates 2. NIRS for
More informationThe Importance of ADME/PK to Inform Human Safety Assessments Based on Animal Studies: Example with Furan. Gregory L. Kedderis, PhD Chapel Hill, NC
The Importance of ADME/PK to Inform Human Safety Assessments Based on Animal Studies: Example with Furan Gregory L. Kedderis, PhD Chapel Hill, NC Conflict of Interest None This research was conducted at
More informationFig.S1 ESI-MS spectrum of reaction of ApA and THPTb after 16 h.
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2014 Experiment Cleavage of dinucleotides Dinucleotides (ApA, CpC, GpG, UpU) were purchased from
More informationBorchman, Foulks, Yappert
Spectroscopic Characterization of Human Meibum Borchman, Foulks, Yappert Prof. Marta Yappert Dr. Gary Foulks Composition Structure Function Composition Structure Function Tear Film Lipid Layer
More informationClassifying Foods as Carcinogenic? A Case Study of Red and Processed Meats.
Classifying Foods as Carcinogenic? A Case Study of Red and Processed Meats. Andrew Milkowski Feb 23, 2016 Outline What is IARC? How are Carcinogen Classifications Determined 2015 IARC Evaluation of Red
More informationPhytochemical Analysis and Antioxidant property of Aegle marmelos Extracts
ISSN: 2319-7706 Volume 4 Number 9 (2015) pp. 826-830 http://www.ijcmas.com Original Research Article Phytochemical Analysis and Antioxidant property of Aegle marmelos Extracts Anjay Kumar Gupta*, Sumeet
More informationOptimizing Sample. Chromium Analyses in Waters. Jane Timm, James Lovick Jr, Raymond Siery, ato 2011 NEMC, Bellevue, Washington
Optimizing Sample Preservation for Hexavalent Chromium Analyses in Waters Jane Timm, James Lovick Jr, Raymond Siery, and Yongtao Li Underwriters Laboratories ato 2011 NEMC, Bellevue, Washington 2011 Underwriters
More informationUsing RP-HPLC with Fluorescence Detection and SEC C for Sample Preparation and Its Application for Different Food Samples
Modified Analytical Assay for PAH P Using RP-HPLC with Fluorescence Detection and SEC C for Sample Preparation and Its Application for Different Food Samples Ewa Węgrzyn, Stanisław Grześkiewicz,, Wiesława
More informationOrganic Chemistry Part 2
Organic Chemistry Part 2 Benzene Benzene is a special structure C 6 H 6 The carbon-carbon bonds aren t a single or double bond but something in-between Resonance bond CYCLIC HYDROCARBONS Carbon chains
More informationElectronic Supporting Information for
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2015 Electronic Supporting Information for Rhodamine based Turn-On Fluorescent Probe for Pb(II)
More informationORGANIZATION OF ANTIBIOTIC AMPHOTERICIN B IN MODEL LIPID MEMBRANES. A MINI REVIEW
CELLULAR & MOLECULAR BIOLOGY LETTERS Volume 8, (2003) pp 161 170 http://www.cmbl.org.pl Received 30 September 2002 Accepted 13 February 2003 ORGANIZATION OF ANTIBIOTIC AMPHOTERICIN B IN MODEL LIPID MEMBRANES.
More informationA. Incorrect! The alveolus is where gas exchange takes place. B. Correct! Surfactant is the lipid-rich material that permits lung inflation.
Toxicology - Problem Drill 13: Respiratory Toxicology No. 1 of 10 1. The lipid-rich material that decreases surface tension of the alveoli, allowing sacs to inflate properly and remain inflated during
More informationWhat is worse, cigarettes or narghile?
For students What is worse, cigarettes or narghile? Developers: Ron Blonder Institute: The Weizmann Institute of Science, Rehovot. And Belmonte Science Laboratories center, The Hebrew University of Jerusalem.
More informationSupporting Information 3,4-Dihydroxyphenylalanine Peptides as. Nonperturbative Quantum Dot Sensors of
Supporting Information 3,4-Dihydroxyphenylalanine Peptides as Nonperturbative Quantum Dot Sensors of Aminopeptidase Valle Palomo 1, Sebastián A. Díaz 2, Michael H. Stewart 3, Kimihiro Susumu 3, Igor L.
More informationChemical Carcinogenesis November
Chemical Carcinogenesis November 17 2016 Cancer Incidence and Death rates by Geography Epidemiological studies of cancer incidence indicate: 1. The incidence rates for specific organ tumors varies among
More informationCHAPTER II LITERATURE REVIEW. Maillard reaction has been well understood as a non-enzymatic reaction
4 CHAPTER II LITERATURE REVIEW 2.1. Maillard Reaction Products (MRPs) Maillard reaction has been well understood as a non-enzymatic reaction between reducing sugars and amino acids to generate the Maillard
More informationSupporting Information
Supporting Information Degradation of Paraoxon and the Chemical Warfare Agents VX, Tabun and Soman by the Metal-Organic Frameworks UiO-66- NH 2, MOF-808, NU-1000 and PCN-777. Martijn C. de Koning,* Marco
More informationChronic Toxic Potential of Selected Hydrocarbons in Crude Oil. Peter S. Spencer Oregon Health & Science University
Chronic Toxic Potential of Selected Hydrocarbons in Crude Oil Peter S. Spencer Oregon Health & Science University Crude Oil Composition & Effects Composed of thousands of chemical structures. Few tested
More informationThiol-Activated gem-dithiols: A New Class of Controllable. Hydrogen Sulfide (H 2 S) Donors
Thiol-Activated gem-dithiols: A New Class of Controllable Hydrogen Sulfide (H 2 S) Donors Yu Zhao, Jianming Kang, Chung-Min Park, Powell E. Bagdon, Bo Peng, and Ming Xian * Department of Chemistry, Washington
More informationUsing Infrared and Raman Microspectroscopies to Compare Ex Vivo Involved Psoriatic Skin and Normal Human Skin
Using Infrared and Raman Microspectroscopies to Compare Ex Vivo Involved Psoriatic Skin and Normal Human Skin Leroy, Marie (Laboratoire d'ingénierie de Surface (LIS)) Lefèvre, Thierry (Groupe de recherche
More informationOXIDATIVE FERMENTATION OF D-RIBOSE BY LACTOBACILLUS PLANTARUM NO. 11 (Preliminary Report)
J. Gen. Appl. Microbiol. Vol. 4, No. 2, 1958 OXIDATIVE FERMENTATION OF D-RIBOSE BY LACTOBACILLUS PLANTARUM NO. 11 (Preliminary Report) SAKUZO FUKUI and AKIRA OI Division of 7ymomycology, The Institute
More informationSupporting Information
Supporting Information A single design strategy for dual sensitive ph probe with a suitable range to map ph in living cells Kang-Kang Yu, Ji-Ting Hou, Kun Li, * Qian Yao, Jin Yang, Ming-Yu Wu, Yong-Mei
More informationSupporting information
Electronic Supplementary Material (ESI) for Nanoscale. This journal is The Royal Society of Chemistry 2014 Supporting information Seeing the Diabetes: Visual Detection of Glucose Based on the Intrinsic
More informationSupplementary Material
Supplementary Material Antimicrobial mechanism of theaflavins: They target 1-deoxy-D-xylulose 5-phosphate reductoisomerase, the key enzyme of the MEP terpenoid biosynthetic pathway Xian Hui, Qiao Yue,
More informationPublisable summary. Project description. Main objectives. Updated summary
Publisable summary Project description The overall aim of this project is to investigate the protective action of agents with potential use as functional food constituents with respect to cancer, diabetes
More informationUnveiling transient protein-protein interactions that modulate inhibition of alpha-synuclein aggregation
Supplementary information Unveiling transient protein-protein interactions that modulate inhibition of alpha-synuclein aggregation by beta-synuclein, a pre-synaptic protein that co-localizes with alpha-synuclein.
More informationChemical Carcinogenesis November
Chemical Carcinogenesis November 18 2014 Cancer Incidence and Death rates by Geography Epidemiological studies of cancer incidence indicate: 1. The incidence rates for specific organ tumors varies among
More informationCATCH MY BREATH. ASHA Conference: October 12, Marcella Bianco CATCH My Breath Program Manager CATCH Global Foundation
CATCH MY BREATH ASHA Conference: October 12, 2017 Marcella Bianco CATCH My Breath Program Manager CATCH Global Foundation marcella@catch.org Valerie Phillips Athletic Coordinator/Head of PE Department
More informationMistake Correction!!!!!
Tuzzy Talk # 7: Effects of Oil, Dispersants and Dispersed Oil on Organisms Part 1: Introduction to Toxicology (Continued) November 1, 2014 Nancy E. Kinner University of New Hampshire Center for Spills
More informationBiotransformation-induced toxicity. Challenges in drug design M. Matilde Marques
Biotransformation-induced toxicity. Challenges in drug design M. Matilde Marques Drug Discovery Session July 4, 2016 Drug Discovery Toxicology The Road to Safe Drugs Attrition in drug development remains
More information