Mass Histology Service
|
|
- Darrell Small
- 5 years ago
- Views:
Transcription
1 Mass Histology Service A complete anatomical pathology laboratory Telephone: (877) Report on Pathology A Time Course Study of the Local Effects of Intramuscular XXXXXXX Injection in -glucosidase Knockout 6neo(-)/6neo(-) Mice Michael L. Hawes, D.V.M., Diplomate A.C.V.P. Consulting Pathologist FINAL REPORT May 17, 2013 Conclusions: GAA KO mice undergo myocyte regeneration more quickly in response to intramuscular XXXXXXXXXX injection compared to wild type mice, though by Day 14 both strains show comparable regeneration. Necrosis, inflammation and edema are processes that follow a similar time course in both strains, peaking early and largely subsiding by Day 14. Fibrosis in this model is modest but measurable, and occurs earlier in GAA KO mice (Day 5) compared to WT mice (Day 7). Please note: Should any portion of the pathology data, including photomicrographs, from this report be included in a manuscript or an abstract for a professional meeting presentation (oral or poster), the pathologist of record should be listed as an author and consulted for editorial input. 1
2 REPORT ON PATHOLOGY Date: May 17, 2013 Study: A Time Course Study of the Local Effects of Intramuscular XXXXXXXX Injection in -glucosidase Knockout 6neo(-)/6neo(-) Mice Pathologist: Michael Hawes, D.V.M., Diplomate A.C.V.P. Conclusions: GAA KO mice undergo myocyte regeneration more quickly in response to intramuscular XXXXXXXX injection compared to wild type mice, though by Day 14 both strains show comparable regeneration. Necrosis, inflammation and edema are processes that follow a similar time course in both strains, peaking early and largely subsiding by Day 14. Fibrosis in this model is modest but measurable, and occurs earlier in GAA KO mice (Day 5) compared to WT mice (Day 7). Study Objective: The objective of this study was to assess the local histopathological effects of the intramuscular injection of XXXXXXXX in - glucosidase knockout 6neo(-)/6neo(-) and wild type mice at different time points out to 14 days. Study Design: Twelve week old female -glucosidase knockout 6neo(-)/6neo(-) (GAA KO) mice were injected with 25 microliters of XXXXXXXX intramuscularly (IM) in each tibialis anterior (TA) muscle on Day 0. Groups of animals were sacrificed on Day 3, 5, 7 and 14 post-injection. Age matched female wild type (WT) B6.129SF2/J mice were similarly injected and sacrificed at matching time points. Untreated controls were also included for each mouse strain. At sacrifice tibialis anterior muscles were harvested. See the study design table below for additional details. 2
3 Table 1: Study Design Group Mouse Strain/ No. of Animals Treatment Sacrifice Time Point 1 GAA KO / 4 None Day 0 2 GAA KO / 8 25 l IM in each TA muscle Day 3 3 GAA KO / 8 25 l IM in each TA muscle Day 5 4 GAA KO / 6 25 l IM in each TA muscle Day 7 5 GAA KO / 6 25 l IM in each TA muscle Day 14 6 B6.129SF2/J / 4 None Day 0 7 B6.129SF2/J / 8 25 l IM in each TA muscle Day 3 8 B6.129SF2/J / 8 25 l IM in each TA muscle Day 5 9 B6.129SF2/J / 6 25 l IM in each TA muscle Day 7 10 B6.129SF2/J / 6 25 l IM in each TA muscle Day 14 Tissues examined: TA muscles were harvested, fixed in 10% neutral buffered formalin, embedded transversely in paraffin, and sectioned at approximately 5 microns. Two serial sections were stained for each sample: one with hematoxylin and eosin (H&E), and one with trichrome. Tissues were analyzed using scoring systems for a number of individual parameters including central nuclei, fiber size reduction, regeneration, necrosis, inflammation, edema, and fibrosis. A sum score was also generated by adding individual parameter scores together for each sample. Individual parameter scoring system details are located at the end of this report in the appendix along with individual animal findings. Slides were read by a board-certified veterinary pathologist blinded to study group designation. Statistical analysis was performed using GraphPad Prizm version 4.03 software, and included a nonparametric Kruskal-Wallis test followed by a Dunn s test comparing all treatment groups using a confidence level of 95%. Results: Figures 1-8 below are graphical depictions of the data generated for this study. In these figures GAA KO mice are denoted at Pompe and wild type mice are denoted as WT. Individual data points are shown and horizontal bars depict group median scores. 3
4 Central Nucle Score (0-5) Sum Score (0-35) Sum Score p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 1: The sum score for pathological changes occurring in the tibialis anterior muscle after IM XXXXXXXX injection. While GAA KO mice (denoted as Pompe) trend higher at every timepoint compared to WT mice, there are no statistically significant differences. Only the Day 3 GAA mice differ significantly from the untreated rhgaa mice (p<0.05, Kruskal-Wallis test). Central Nuclei 5 4 p<0.05 p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 2: The central nuclei score trends higher at every timepoint in GAA KO mice compared to WT mice. Statistical significance is only present between the groups shown (Kruskal-Wallis test). 4
5 Regeneration Score (0-5) Fiber Size Reduction Score (0-5) 5 Fiber Size Reduction 4 p< p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 3: There is a statistically greater proportion of smaller muscle fibers in GAA KO mice compared to WT mice at the Day 3 time point (p<0.0001, Kruskal- Wallis test). There is also a greater proportion of smaller muscle fibers at Day 3 in GAA KO mice compared to untreated GAA KO mice (p<0.0001, Kruskal-Wallis test). 5 Regeneration p< p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 4: Regeneration scores are statistically higher at Day 14 compared to Day 3 in WT mice (p<0.05, Kruskal-Wallis test). In addition, GAA KO mouse regeneration scores at Day 3 are statistically higher than WT mouse scores at Day 3 (p<0.05, Kruskal-Wallis test). 5
6 Edema Score (0-5) Inflammation Score (0-5) Inflammation 5 4 p<0.01 p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 5: Inflammation is not statistically different at any of the time points analyzed between GAA KO and WT mice. The only statistical differences are between the Day 3 WT and GAA mice and their respective untreated controls (p<0.01, Kruskal-Wallis test). 5 Edema 4 3 p<0.05 p<0.01 p<0.05 p< p<0.05 p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 6: Edema is elevated early after XXXXXXXXX injury, but subsides to baseline by Day 14. Edema is not statistically different at any of the time points analyzed between GAA KO and WT mice. Statistical significance is only present between the groups shown (Kruskal-Wallis test). 6
7 Necrosis Score (0-5) Fibrosis Score (0-5) 5 4 Fibrosis p< p<0.05 p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 7: Fibrosis is statistically elevated by Day 5, 7 and 14 in GAA KO mice compared to Day 3 (p<0.05, Kruskal-Wallis test). GAA KO mice at Day 5 also have a modest, but statistically significant, elevation in fibrosis compared to WT mice at the same time point (p<0.01, Kruskal-Wallis test). Necrosis 5 p<0.01 p< WT UnTx WT D3 WT D5 WT D7 WT D14 Pompe UnTx Pompe D3 Pompe D5 Pompe D7 Pompe D14 Figure 8: Necrosis scores are elevated at the Day 3, 5 and 7 time points compared to baseline in both GAA KO and WT mice. Many of these elevations are only trends, except for those shown with brackets (p<0.01, Kruskal-Wallis test). 7
8 Histopathological Description and Representative Photomicrographs: DAY 0: WT Untreated Mice: These samples are within expected limits with no abnormalities (see Figure 9). GAA KO Untreated Mice: These samples are within expected limits for the knockout phenotype. Punctate, clear vacuoles (lysosomal glycogen) are scattered within the sarcoplasm of most myocytes. Two of the four samples have minimal (score 1) regeneration and one sample has minimal (score 1) chronic inflammation. These are expected background alterations in this knockout strain. GAA KO TA muscle has subjectively more myocyte nuclei compared to WT. Most of these myocyte nuclei are also slightly enlarged with prominent magenta nucleoli, and an open chromatin pattern compared to WT myocyte nuclei (see Figure 9). DAY 3: Cardiotoxin-treated WT Mice: All wild type mice treated with XXXXXX have large contiguous areas of myocyte necrosis. In addition to the typical morphologic features of necrosis, including sarcoplasmic hypereosinophilia, loss of sarcoplasmic cross-striational detail, and nuclear karyorrhexis and karyolysis, trichrome stained necrotic myocytes stain bluish-purple instead of the usual bright red expected with viable myocytes (see Figure 10). These are bordered by a rim of primarily macrophages and a few neutrophils that separate the necrotic muscle from viable, uninjured muscle (see Figure 11). While some of the cells within the inflammatory zone could be early regenerative myocytes (myoblasts), this cannot be distinguished by H&E or trichrome staining. Additional immunohistochemical (IHC) markers such as F/480 (macrophage marker), fmhc (skeletal myocyte sarcoplasmic marker), and myogenin (skeletal myocyte nuclear marker) could be employed to make more detailed characterizations. Edema (clear space) separates cells within the necrotic and inflammatory zones. XXXXXX-treated GAA KO Mice: All but one of the cardiotoxin-treated GAA KO mice has areas of contiguous myocyte necrosis (see Figure 10). As in WT mice these areas of necrosis are bordered by a rim of macrophages and neutrophils. Notably, there are numerous skeletal myocytes within this inflammatory rim that have characteristics of regenerative myocytes. These myocytes are smaller than adjacent uninjured myocytes, have central often multiple nuclei, and an increased sarcoplasmic basophilia (see Figure 11). Edema (clear space) separates cells within the necrotic and inflammatory zones. 8
9 DAY 5: XXXXXX-treated WT Mice: By Day 5 necrotic zones are still present in most muscles, but these areas are typically smaller than that observed at Day 3 (not significant; p>0.05). The degree of inflammation is also reduced compared to Day 3, but again not significantly (p>0.05). Notably, there is now a zone of regenerating myocytes that separates the necrotic and viable muscle tissue, similar to that seen in GAA KO mice at Day 3 (see Figure 12). Edema (clear space) separates cells within the necrotic and inflammatory zones. XXXXXX-treated GAA KO Mice: Day 5 samples are generally similar to Day 3 samples (see Figure 12). Minimal fibrosis (score 1) is now evident separating regenerating myocytes in many samples. DAY 7: XXXXXX-treated WT Mice: Three Day 7 samples show no histopathologic changes. Given the consistency and magnitude of many of the changes at the Day 5 time point, it is likely that these samples were mis-injected. These samples were included in the analysis. Exclusion of these samples from the analysis would not yield substantially different results. The other three samples at this time point are very similar to those at the Day 5 time point, except that minimal fibrosis (score 1) is now evident separating regenerating myocytes. XXXXXX-treated GAA KO Mice: Day 7 samples are generally similar to Day 5 samples. DAY 14: XXXXXX-treated WT Mice: By Day 14 necrotic zones are not present in any samples. Instead, much of each sample is composed of near normal to slightly smaller skeletal myocytes, most with central nuclei. Inflammation has largely subsided, with only scattered macrophages and lymphocytes often located in fine strands of fibrous connective tissue between myocytes (see Figure 13). Edema is now absent in all samples. XXXXXX-treated rhgaa Mice: By Day 14 GAA KO mouse samples are quite similar to WT samples (see Figure 13), except that 3/6 still retain small areas of necrosis (score 1). 9
10 A B Figure 9: Photomicrographs of H&E-stained untreated TA muscles from WT (A) and GAA KO (B) mice. Note the eccentrically-located myocyte nuclei in each strain (black arrows). Subjectively GAA KO TA muscle contains more myocyte nuclei that are slightly enlarged compared to WT (600x magnification). 10
11 A B C D Figure 10: Photomicrographs of Day 3 XXXXXX-injected TA muscles from WT (A,C; animal 7-3) and GAA KO (B,D; animal 2-1) mice. The top panels (40x magnification) are trichrome-stained sections showing the large areas of necrosis induced by XXXXXX injection (bluish-purple tissue) part of which is highlighted with the black inset boxes. These areas of necrosis are separated from the bright red-stained viable myocytes by a zone of inflammation and regeneration, part of which is highlighted by the blue inset boxes. The bottom panels (600x magnification) are from areas similar to the black inset boxes in serial H&Estained sections that demonstrate typical features of necrosis: karyolysis and loss of sarcoplasmal cross-striational detail (black arrows). 11
12 A B C D Figure 11: Photomicrographs of H&E-stained Day 3 XXXXXX-injected TA muscles from WT (A,C; animal 7-5) and GAA KO (B,D; animal 2-4) mice. While both samples have a zone of inflammation (to left of black brackets in A and B), only the GAA KO sample suggests morphologic evidence of myocyte regeneration: myocytes with central and often multiple nuclei along with increased sarcoplasmic basophilia (black arrows in D). A and B: 200x magnification. C and D: 600x magnification photomicrographs from the areas outlined by the black inset boxes in A and B, respectively. 12
13 A B Figure 12: Photomicrographs of H&E-stained Day 5 XXXXXX-injected TA muscles from WT (A, animal 8-2) and GAA KO (B, animal 3-5) mice. These images demonstrate the myocyte regeneration now present in both strains (black arrows; 200x magnification). 13
14 A B C D Figure 13: Photomicrographs of Day 14 XXXXXX-injected TA muscles from WT (A,C; animal 10-4) and GAA KO (B,D; animal 5-2) mice. The top panels (H&E stain, 400x magnification) show the areas of myocyte regeneration that were comparable between the strains at this time point (black arrows). The bottom panels (trichrome stain, 400x magnification) show the typical degree of fibrosis present at the 14 Day time point (black arrows). 14
15 Summary: Intramuscular injection of XXXXXX into the TA muscle of GAA KO and WT mice results in large contiguous areas of myocyte necrosis by 3 days postinjection. This necrosis largely subsides by day 14 post-injection. In response to this necrotizing stimulus skeletal myocytes in both strains of mice undergo a regenerative process. GAA KO mice appear to respond more quickly to this stimulus as evidenced by statistically elevated regeneration scores (p<0.05), central nuclei scores (p<0.05), and fiber size reduction scores (p<0.0001) at the Day 3 time point compared to WT mice. Inflammation and edema are part of the response to XXXXXX injection in both strains. These processes peak at Day 3 and largely subside by Day 14 in both strains. Fibrosis also occurs after XXXXXX injury in both GAA KO and WT mice. Fibrosis begins earlier after injury in GAA KO mice (Day 5) compared to WT mice (Day 7). Fibrosis progresses in both strains over time and is greatest at Day 14. Conclusions: GAA KO mice undergo myocyte regeneration more quickly in response to intramuscular XXXXXX injection compared to wild type mice, though by Day 14 both strains show comparable regeneration. Necrosis, inflammation and edema are processes that follow a similar time course in both strains, peaking early and largely subsiding by Day 14. Fibrosis in this model is modest but measurable, and occurs earlier in GAA KO mice (Day 5) compared to WT mice (Day 7). Recommendations: Myocyte regeneration should be confirmed via myogenin immunohistochemistry. Studies to probe the differences in the regenerative and fibrotic responses between the strains could prove insightful. In vitro assays using GAA KO and WT skeletal myocyte cultures to measure proliferation rates and other responses to positive and negative stimuli would be one avenue of investigation. It would be interesting to see if TGF- is up- or down-regulated in GAA KO mice compared to WT mice at any of the time points examined in this study. 15
16 Appendix: Central Nuclei Scoring System: Score Description Central nuclei in myocytes are not present in any part of the 0 tissue 1 Central nuclei in myocytes are present in 1-20% of the tissue 2 Central nuclei in myocytes are present in 21-40% of the tissue 3 Central nuclei in myocytes are present in 41-60% of the tissue 4 Central nuclei in myocytes are present in 61-80% of the tissue 5 Central nuclei in myocytes are present in % of the tissue Fiber Size Reduction Scoring System: Score Description 0 Myocytes are not reduced in size in any part of the tissue 1 Myocytes are reduced in size in 1-20% of the tissue 2 Myocytes are reduced in size in 21-40% of the tissue 3 Myocytes are reduced in size in 41-60% of the tissue 4 Myocytes are reduced in size in 61-80% of the tissue 5 Myocytes are reduced in size in % of the tissue 16
17 Myocyte Regeneration Scoring System: Score Description Evidence of myocytes regeneration* is not present in any part of 0 the tissue Evidence of myocytes regeneration is present in 1-20% of the 1 tissue 2 Central nuclei in myocytes are present in 21-40% of the tissue 3 Central nuclei in myocytes are present in 41-60% of the tissue 4 Central nuclei in myocytes are present in 61-80% of the tissue 5 Central nuclei in myocytes are present in % of the tissue * Evidence of myocyte regeneration: myocytes with centralized and/or multiple nuclei, and increased sarcoplasmic basophilia. Necrosis Scoring System: Score Description 0 Necrosis is not present in any part of the tissue 1 Necrosis is present in 1-20% of the tissue 2 Necrosis is present in 21-40% of the tissue 3 Necrosis is present in 41-60% of the tissue 4 Necrosis is present in 61-80% of the tissue 5 Necrosis is present in % of the tissue 17
18 Inflammation Scoring System: Score Description 0 Inflammation is not present in any part of the tissue 1 Inflammation is present in 1-20% of the tissue 2 Inflammation is present in 21-40% of the tissue 3 Inflammation is present in 41-60% of the tissue 4 Inflammation is present in 61-80% of the tissue 5 Inflammation is present in % of the tissue Edema Scoring System: Score Description 0 Edema is not present in any part of the tissue 1 Edema is present in 1-20% of the tissue 2 Edema is present in 21-40% of the tissue 3 Edema is present in 41-60% of the tissue 4 Edema is present in 61-80% of the tissue 5 Edema is present in % of the tissue Fibrosis Scoring System: Score Description 0 Fibrosis is not present in any part of the tissue 1 Fibrosis is present in 1-20% of the tissue 2 Fibrosis is present in 21-40% of the tissue 3 Fibrosis is present in 41-60% of the tissue 4 Fibrosis is present in 61-80% of the tissue 5 Fibrosis is present in % of the tissue 18
19 Raw Data: Central Nuclei Fiber Size Regen* Infl Edema Fibrosis Necrosis Sum Group 1 TA TA TA TA Group 2 TA TA TA TA TA TA TA TA Group 3 TA TA TA TA TA TA TA TA Group 4 TA TA TA TA TA TA Group 5 TA TA TA TA TA TA *Regen = Regeneration Infl = Inflammation 19
20 Central Nuclei Fiber Size Regen* Infl Edema Fibrosis Necrosis Sum Group 6 TA TA TA TA Group 7 TA TA TA TA TA TA TA TA Group 8 TA TA TA TA TA TA TA TA Group 9 TA TA TA TA TA TA Group 10 TA TA TA TA TA TA *Regen = Regeneration Infl = Inflammation 20
Postn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationHistopathology of Wooden Breast
Histopathology of Wooden Breast Canadian Poultry and Egg Processors Council Aviagen Frederic J. Hoerr, DVM, PhD June 10, 2016 Halifax, Nova Scotia FJ Hoerr 1 Normal Veterinary Diagnostic Pathology, LLC
More informationReport on Pathology. Study: The effect of Compound X on pancreatic islets in rhesus macaques
Report on Pathology Study: The effect of Compound X on pancreatic islets in rhesus macaques Prepared for: Client Name Client Address January 1, 2013 Prepared by: Charter Preclinical Services 21 Main St.,
More informationCellular Pathology. Histopathology Lab #2 (web) Paul Hanna Jan 2018
Cellular Pathology Histopathology Lab #2 (web) Paul Hanna Jan 2018 Slide #91 Clinical History: a necropsy was performed on an aged cat the gross pathological changes included: widespread subcutaneous edema
More informationEDUCATIONAL COMMENTARY MORPHOLOGIC ABNORMALITIES IN LEUKOCYTES
EDUCATIONAL COMMENTARY MORPHOLOGIC ABNORMALITIES IN LEUKOCYTES Educational commentary is provided through our affiliation with the American Society for Clinical Pathology (ASCP). To obtain FREE CME/CMLE
More informationHistopathology: skin pathology
Histopathology: skin pathology These presentations are to help you identify, and to test yourself on identifying, basic histopathological features. They do not contain the additional factual information
More informationReceptor-interacting Protein Kinases Mediate Necroptosis In Neural Tissue Damage After Spinal Cord Injury
Receptor-interacting Protein Kinases Mediate Necroptosis In Neural Tissue Damage After Spinal Cord Injury Haruo Kanno, M.D., Ph.D., Hiroshi Ozawa, M.D., Ph.D., Satoshi Tateda, M.D., Kenichiro Yahata, M.D.,
More informationAmyloid neuropathy: (A) scattered Congo Red positive material in endoneurium displays apple green birefringence under polarized light.
Cơ vân Cơ vân Cơ vân (cắt dọc) Amyloid neuropathy: (A) scattered Congo Red positive material in endoneurium displays apple green birefringence under polarized light. (A, Congo Red). Amyloid neuropathy:
More informationVETERINARY HEMATOLOGY ATLAS OF COMMON DOMESTIC AND NON-DOMESTIC SPECIES COPYRIGHTED MATERIAL SECOND EDITION
VETERINARY HEMATOLOGY ATLAS OF COMMON DOMESTIC AND NON-DOMESTIC SPECIES SECOND EDITION COPYRIGHTED MATERIAL CHAPTER ONE HEMATOPOIESIS GENERAL FEATURES All blood cells have a finite life span, but in normal
More informationAfrican Trypanosomes
African Trypanosomes Giemsa-stained blood smear of African trypanosomes viewed under the 100X objective lens. The block arrows denote trypomastigote forms of the African trypanosomes found within the blood
More informationLai et al 2008 JCI RG-Revision 2
Lai et al 2008 JCI 36612-RG-Revision 2 Suppmentary Table 1. Epitope specific dystrophin antibodies Name Epitope Dilution Source Dys-3* Hinge 1 1:20 Novocastra Dys-1 Repeats 6-8 1:100 Novocastra Mandys8
More informationSupplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in
Supplemental figure 1. PDGFRα is expressed dominantly by stromal cells surrounding mammary ducts and alveoli. A) IHC staining of PDGFRα in nulliparous (left panel) and InvD6 mouse mammary glands (right
More informationHistopathology: granulomatous inflammation, including tuberculosis
Histopathology: granulomatous inflammation, including tuberculosis These presentations are to help you identify basic histopathological features. They do not contain the additional factual information
More informationVENTANA PD-L1 (SP263) Assay Staining in Urothelial Carcinoma Interpretation Guide
VENTANA PD-L1 (SP263) Assay Staining in Urothelial Carcinoma Interpretation Guide 2 VENTANA PD-L1 (SP263) Assay in Urothelial Carcinoma Interpretation Guide Table of Contents Introduction 4 Intended Use
More informationBIOCHEMICAL INVESTIGATIONS IN THE DIAGNOSTICS OF CARDIOVASCULAR DISORDERS. As. MARUSHCHAK M.I.
BIOCHEMICAL INVESTIGATIONS IN THE DIAGNOSTICS OF CARDIOVASCULAR DISORDERS As. MARUSHCHAK M.I. Heart attack symptoms Acute MI Measurement of cardiac enzyme levels Measure cardiac enzyme levels at regular
More informationMacrophages form functional vascular mimicry channels in vivo. SI Figures and Legend
Macrophages form functional vascular mimicry channels in vivo Authors: *Faith H. Barnett, *Mauricio Rosenfeld, Malcolm Wood, William Kiosses, Yoshihiko Usui, Valentina Marchetti, Edith Aguilar, and Martin
More informationSupplementary Figure 1 Chemokine and chemokine receptor expression during muscle regeneration (a) Analysis of CR3CR1 mrna expression by real time-pcr
Supplementary Figure 1 Chemokine and chemokine receptor expression during muscle regeneration (a) Analysis of CR3CR1 mrna expression by real time-pcr at day 0, 1, 4, 10 and 21 post- muscle injury. (b)
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10188 Supplementary Figure 1. Embryonic epicardial genes are down-regulated from midgestation stages and barely detectable post-natally. Real time qrt-pcr revealed a significant down-regulation
More informationIKK-dependent activation of NF-κB contributes to myeloid and lymphoid leukemogenesis by BCR-ABL1
Supplemental Figures BLOOD/2014/547943 IKK-dependent activation of NF-κB contributes to myeloid and lymphoid leukemogenesis by BCR-ABL1 Hsieh M-Y and Van Etten RA Supplemental Figure S1. Titers of retroviral
More informationComparison and Evaluation of Mitotic Figures in Oral Epithelial Dysplasia using Crystal Violet and Feulgen Stain
Comparison and Evaluation of Mitotic Figures in Oral Epithelial Dysplasia using 10.5005/jp-journals-10024-1527 Crystal Violet and Feulgen Stain Original research Comparison and Evaluation of Mitotic Figures
More informationCHAPTER IV RESULT 5.1 RESULT OF LIVER TISSUE DAMAGE FROM H&E STAINING. Tissue damage were observed from H&E staining examination by Olympus PX51
CHAPTER IV RESULT 5.1 RESULT OF LIVER TISSUE DAMAGE FROM H&E STAINING. Tissue damage were observed from H&E staining examination by Olympus PX51 light microscope with ocular lens 10 and objective lens
More informationHistopathology: healing
Histopathology: healing These presentations are to help you identify, and to test yourself on identifying, basic histopathological features. They do not contain the additional factual information that
More informationEDUCATIONAL COMMENTARY DIFFERENTIATING IMMATURE PERIPHERAL BLOOD CELLS
Educational commentary is provided through our affiliation with the American Society for Clinical Pathology (ASCP). To obtain FREE CME/CMLE credits click on Continuing Education on the left side of the
More informationProbe. Hind III Q,!?R'!! /0!!!!D1"?R'! vector. Homologous recombination
Supple-Zhang Page 1 Wild-type locus Targeting construct Targeted allele Exon Exon3 Exon Probe P1 P P3 FRT FRT loxp loxp neo vector amh I Homologous recombination neo P1 P P3 FLPe recombination Q,!?R'!!
More informationTitle. Author(s)BRAGA, Ignacia S.III; TANAKA, Satoshi; OCHIAI, Kenji. CitationJapanese Journal of Veterinary Research, 43(2): 99-1
Title SUSPECTED NUTRITIONAL MYOPATHY IN TWO CAPTIVE BENNET RUFOGRISEUS) Author(s)BRAGA, Ignacia S.III; TANAKA, Satoshi; OCHIAI, Kenji CitationJapanese Journal of Veterinary Research, 43(2): 99-1 Issue
More informationPATHOPHYSIOLOGY. DEFINED Involves the study of function that results from disease processes.
DEFINED Involves the study of function that results from disease processes. What is pathology? Pathology is the branch of medical sciences that treats the essential nature of disease, especially the changes
More informationSupplementary Figure 1. ETBF activate Stat3 in B6 and Min mice colons
Supplementary Figure 1 ETBF activate Stat3 in B6 and Min mice colons a pstat3 controls Pos Neg ETBF 1 2 3 4 b pstat1 pstat2 pstat3 pstat4 pstat5 pstat6 Actin Figure Legend: (a) ETBF induce predominantly
More informationTo determine the effect of over-expression and/or ligand activation of. PPAR / on cell cycle, cell lines were cultured as described above until ~80%
Supplementary Materials and Methods Cell cycle analysis To determine the effect of over-expression and/or ligand activation of PPAR / on cell cycle, cell lines were cultured as described above until ~80%
More informationNature Immunology: doi: /ni eee Supplementary Figure 1
eee Supplementary Figure 1 Hyphae induce NET release, but yeast do not. (a) NET release by human peripheral neutrophils stimulated with a hgc1 yeast-locked C. albicans mutant (yeast) or pre-formed WT C.
More informationAs outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the
3 RESULTS As outlined under External contributions (see appendix 7.1), the group of Prof. Gröne at the DKFZ in Heidelberg (Dept. of Cellular and Molecular pathology) contributed to this work by performing
More informationnumber Done by Corrected by Doctor Heyam Awad
number 4 Done by Waseem Abu Obeida Corrected by Saad Al-Hayek Doctor Heyam Awad Cell injury -in the previous lectures we talked about the causes (etiology) and the mechanism (pathogenesis) of cell injury.
More informationCanadian Scientific Journal. Histochemical polymorphism of keratin pearls in squamous cell carcinoma of the lung
Canadian Scientific Journal 2 (2014) Contents lists available at Canadian Scientific Journal Canadian Scientific Journal journal homepage: Histochemical polymorphism of keratin pearls in squamous cell
More informationA Histological Autopsy Study of the Thyroid gland in HIV infected Adults at the University Teaching Hospital in Lusaka, Zambia
Original Article A Histological Autopsy Study of the Thyroid gland in HIV infected Adults at the University Teaching Hospital in Lusaka, Zambia 1 1 2 S. Muwowo, V. Mudenda, C. Marimo 1 Department of Pathology
More informationSupplementary Figure 1. Nature Neuroscience: doi: /nn.4547
Supplementary Figure 1 Characterization of the Microfetti mouse model. (a) Gating strategy for 8-color flow analysis of peripheral Ly-6C + monocytes from Microfetti mice 5-7 days after TAM treatment. Living
More informationPresented by: Dr. Giuseppe Molinaro Dr. Davide De Biase
Presented by: Dr. Giuseppe Molinaro Dr. Davide De Biase Dog Spayed Female LABRADOR RETRIEVER 3 Years old VACCINATIONS ANTIPARASITIC COMMERCIAL DIET VOMITING FOR A MONTH DULLNESS WEIGHT LOSS INAPPETANCE
More information2015 Descriptive Vet Path Course. Histo Exam #3 KEY
2015 Descriptive Vet Path Course Histo Exam #3 KEY Test 3, Slide 1 Tissue from a guinea pig. MORPHOLOGIC DIAGNOSIS: Heart: Multifocally and randomly (1 pt), within the left and right ventricular myocardium
More informationPREPARED BY P.DHARANI PRASAD II YEAR B.PHARM II SEM SUB:PATHOPHYSIOLOGY
CELL INJURY UNIT I PREPARED BY P.DHARANI PRASAD II YEAR B.PHARM II SEM SUB:PATHOPHYSIOLOGY DETECTION OF CELLULAR CHANGES AFTER INJURY BY: LIGHT MICROSCOPY OR GROSS EXAMINATION DETECT CHANGES HOURS TO DAYS
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More informationSupplementary Figure 1.
Supplementary Figure 1. Transduction of adipocytes after intra-ewat administration of AAV vectors. A: Immunostaining against GFP (green) in sections of ewat two weeks after the intra-ewat administration
More informationMedical Biology. Dr. Khalida Ibrahim
Dr. Khalida Ibrahim Medical Biology MUSCLE TISSUE 1. Muscle tissue is characterized by its well-developed properties of contraction. 2. Muscle is responsible for the movements of the body and the various
More informationSupporting Information. Calculation of the relative contributions of myocyte proliferation, stem cell. Supporting Information Fig 1 (page 9)
Supporting Information Table of contents Calculation of the relative contributions of myocyte proliferation, stem cell differentiation and cardioprotection (page 2) Supporting Information Fig 1 (page 9)
More informationAPPENDIX 1 ETHICAL CLEARANCE
APPENDIX 1 ETHICAL CLEARANCE 75 APPENDIX 2 76 PROCEDURE FOR PREPARING OF LIVER HISTOLOGY SLIDES Overview: Histology involves the use of a set of techniques to examine the morphology, architecture and composition
More informationLongitudinal Validation Study: Streptozotocin-Induced Diabetes as a Model of Diabetic Retinopathy in Brown Norway Rats
Longitudinal Validation Study: Streptozotocin-Induced Diabetes as a Model of Diabetic Retinopathy in Brown Norway Rats Robin Dean, Robert Sukhu, Leslie Nemeth, Qin Zhang, Isaac Hakim, Ali Ebramhimnejad,
More informationSUPPLEMENTAL INFORMATION FOR. PAX7 expression defines germline stem cells in the adult testis
SUPPLEMENTAL INFORMATION FOR PAX7 expression defines germline stem cells in the adult testis Gina M. Aloisio, Yuji Nakada, Hatice D. Saatcioglu, Christopher G. Peña, Michael D. Baker, Edward D. Tarnawa,
More informationDiplomate of the American Board of Pathology in Anatomic and Clinical Pathology
A 33-year-old male with a left lower leg mass. Contributed by Shaoxiong Chen, MD, PhD Assistant Professor Indiana University School of Medicine/ IU Health Partners Department of Pathology and Laboratory
More informationNeutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury
Neutrophils contribute to fracture healing by synthesizing fibronectin+ extracellular matrix rapidly after injury Bastian OW, Koenderman L, Alblas J, Leenen LPH, Blokhuis TJ. Neutrophils contribute to
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 Characterization of stable expression of GlucB and sshbira in the CT26 cell line (a) Live cell imaging of stable CT26 cells expressing green fluorescent protein
More informationVENTANA MMR IHC Panel Interpretation Guide for Staining of Colorectal Tissue
VENTANA MMR IHC Panel Interpretation Guide for Staining of Colorectal Tissue VENTANA anti-mlh1 (M1) Mouse Monoclonal Primary Antibody VENTANA anti-pms2 (A16-4) Mouse Monoclonal Primary Antibody VENTANA
More informationFigure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B)
Figure S1 Generation of γ-gt DTR transgenic mice. (A) Schematic construct of the transgene. (B) PCR identified expected hhb-egf band (left panel) and HA tag band (right) in kidneys of transgenic (TG) mice
More informationAlmost any suspected tumor can be aspirated easily and safely. Some masses are more risky to aspirate including:
DOES THIS PATIENT HAVE CANCER? USING IN-HOUSE CYTOLOGY TO HELP YOU MAKE THIS DIAGNOSIS. Joyce Obradovich, DVM, Diplomate, ACVIM (Oncology) Animal Cancer & Imaging Center, Canton, Michigan Almost every
More informationIKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung
IKKα Causes Chromatin Modification on Pro-Inflammatory Genes by Cigarette Smoke in Mouse Lung Se-Ran Yang, Samantha Valvo, Hongwei Yao, Aruna Kode, Saravanan Rajendrasozhan, Indika Edirisinghe, Samuel
More informationExplain the laboratory diagnosis of Rabies?
Explain the laboratory diagnosis of Rabies? The standard test for rabies testing is dfa. This test has been thoroughly evaluated for more than 40 years, and is recognized as the most rapid and reliable
More informationSupplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO
Supplementary Figure S1. Effect of Glucose on Energy Balance in WT and KHK A/C KO Mice. WT mice and KHK-A/C KO mice were provided drinking water containing 10% glucose or tap water with normal chow ad
More informationSupplemental Table 1: Demographics and characteristics of study participants. Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± ± 9.
SUPPLEMENTAL DATA Supplemental Table 1: Demographics and characteristics of study participants Lean (n=15) Obese (n=12) Male, n (%) 3 (20%) 6 (50%) Age, years [mean ± SD] 33.3 ± 9.5 44.8 ± 9.1 White, n
More informationLec. 11 & 12 Dr. Ali H. Murad Dental pulp 1- Coronal pulp
Lec. 11 & 12 Dr. Ali H. Murad Dental pulp Is the soft connective tissue located in the central portion of each tooth. All pulps have similar morphologic characteristic, such as a soft, gelatinous consistency
More information20 2 Stomach Fig. 2.1 An illustration showing different patterns of the myenteric plexus peculiar to the regions in the guinea-pig stomach stained wit
Stomach 2 The stomach is unique in that ICC have a different distribution in proximal and distal regions of the same organ. ICC-CM and ICC-LM are densely distributed throughout the thick circular and longitudinal
More informationDr/ Sherein Saeid AbdElgayed, ph.d
هللامسب Dr/ Sherein Saeid AbdElgayed, ph.d Professor of Veterinary Pathology, Cairo University, Giza, Egypt. Chairman of the Editorial Board of Arab Journal of Science & Research Publishing (AJSRP) http://www.ajsrp.com
More informationCINtec p16 INK4a Staining Atlas
CINtec p16 INK4a Staining Atlas Rating Rating Positive The rating positive will be assigned if the p16 INK4a -stained slide shows a continuous staining of cells of the basal and parabasal cell layers of
More informationSalvinOss Xenograft Bone Graft Material In Vivo Testing Summary
SalvinOss Xenograft Bone Graft Material In Vivo Testing Summary Summary of In Vivo Use Of Bioresorbable Xenograft Bone Graft Materials In The Treatment Of One-Walled Intrabony Defects In A Canine Model
More informationHistopathology: Cell necrosis and cytoplasmic accumulations
Histopathology: Cell necrosis and cytoplasmic accumulations These presentations are to help you identify basic histopathological features. They do not contain the additional factual information that you
More informationAtlas of Stains. Special Stains on Artisan Link Pro
Atlas of Stains Special Stains on Artisan Link Pro Intended use Routinely processed samples (paraffin-embedded) may be used. The preferred fixative is neutral buffered formalin. The clinical interpretation
More informationhemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and
More informationA Report of a Rare Case of Anaplastic Large Cell Lymphoma of the Oral Cavity
AJMS Al Ameen J Med Sci (2 0 1 2 )5 (1 ):9 8-1 0 2 (A US National Library of Medicine enlisted journal) I S S N 0 9 7 4-1 1 4 3 C O D E N : A A J M B G CASE REPORT A Report of a Rare Case of Anaplastic
More informationSupplemental Data. Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in. Hermansky-Pudlak Syndrome
Page 1 Supplemental Data Epithelial-Macrophage Interactions Determine Pulmonary Fibrosis Susceptibility in Hermansky-Pudlak Syndrome Lisa R. Young, Peter M. Gulleman, Chelsi W. Short, Harikrishna Tanjore,
More informationSUPPLEMENTARY FIGURE 1
SUPPLEMENTARY FIGURE 1 A LN Cell count (1 ) 1 3 1 CD+ 1 1 CDL lo CD hi 1 CD+FoxP3+ 1 1 1 7 3 3 3 % of cells 9 7 7 % of cells CD+ 3 1 % of cells CDL lo CD hi 1 1 % of CD+ cells CD+FoxP3+ 3 1 % of CD+ T
More informationHistopathogenesis of intestinal metaplasia: minute
J Clin Pathol 1987;40:13-18 Histopathogenesis of intestinal metaplasia: minute lesions of intestinal metaplasia in ulcerated stomachs K MUKAWA, T NAKAMURA, G NAKANO, Y NAGAMACHI From the First Department
More informationNyamdolgor.U, Usuhgerel.S, Baatarjargal.P, others, Journal of agricultural sciences 15 (02): 51-55, 2015
51 HISTOPATHOLOGICAL STUDY FOR USING OF POX INACTIVATED VACCINE IN GOATS Nyamdolgor.U 1*, Usuhgerel.S 2, Baatarjargal.P 1, Altanchimeg.A 1, Odbileg.R 1 1-Institute of Veterinary Medicine, MULS, Mongolia
More information<20 <20 <20 < <20 <20 <20 <20. Mock
Cross-Lineage Neutralization PRNT 80 Titers Asian Asian West African Indian Ocean Group NHP Strain 181/25 Strain 99659 Strain 37997 Strain LR 142590 80 80 20 40 EILV/CHIKV 150844 640 640 160 320 Mock 150849
More informationAcute lung injury in children : from viral infection and mechanical ventilation to inflammation and apoptosis Bern, R.A.
UvA-DARE (Digital Academic Repository) Acute lung injury in children : from viral infection and mechanical ventilation to inflammation and apoptosis Bern, R.A. Link to publication Citation for published
More informationSupplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at
Supplementary Figure 1. EC-specific Deletion of Snail1 Does Not Affect EC Apoptosis. (a,b) Cryo-sections of WT (a) and Snail1 LOF (b) embryos at E10.5 were double-stained for TUNEL (red) and PECAM-1 (green).
More informationa 10 4 Link et al. Supplementary Figure 1 Nature Immunology: doi: /ni.1842 Cells per mouse ( 10 5 ) TRPV2KO anti-gr1 anti-gr anti-f4/80
a 10 4 WT 10 4 TRPV2KO 10 3 10 3 anti-gr1 10 2 10 1 anti-gr1 10 2 10 1 10 0 10 0 10 1 10 2 10 3 10 4 anti-f4/80 42.3 45.2 10 0 10 0 10 1 10 2 10 3 10 4 anti-f4/80 10 4 10 4 40 42.5 anti-cd11b 10 3 10 2
More informationAppendix 1. A. Procedure for preparing histopathology slides. The liver removed and stored immediately in buffered formalin 10 % for
Appendix 1 A. Procedure for preparing histopathology slides. The liver removed and stored immediately in buffered formalin 10 % for histopathological examination. The tissue fixed for at least 48 hours
More informationADVANCED HAEMATOLOGY BATTLE OF THE BANDS. Dennis B. DeNicola, DVM, PhD, DACVP IDEXX Laboratories, Inc. Westbrook, Maine, USA BACKGROUND
ADVANCED HAEMATOLOGY BATTLE OF THE BANDS Dennis B. DeNicola, DVM, PhD, DACVP IDEXX Laboratories, Inc. Westbrook, Maine, USA BACKGROUND The identification of immature neutrophils (bands, metamyelocytes,
More informationSupplementary Figure 1
Supplementary Figure 1 Genetic labeling of microglia Male and female 2-3 month-old CreERT2;R26-tdTomato mice or CreERT2;R26-tdTomato;Iba1-eGFP transgenic mice were treated with 1x, 2x (48 h apart), or
More informationLIST OF ORGANS FOR HISTOPATHOLOGICAL ANALYSIS:!! Neural!!!!!!Respiratory:! Brain : Cerebrum,!!! Lungs and trachea! Olfactory, Cerebellum!!!!Other:!
LIST OF ORGANS FOR HISTOPATHOLOGICAL ANALYSIS:!! Neural!!!!!!Respiratory:! Brain : Cerebrum,!!! Lungs and trachea! Olfactory, Cerebellum!!!!Other:! Spinal cord and peripheral nerves! Eyes, Inner ear, nasal
More informationThe Endocrine System Pituitary
The Endocrine System Pituitary Look at your slide of the human pituitary with your naked eye. You should see a cellular region and a more fibrous region. Then view each region with your microscope under
More informationSupplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.
Supplementary Information Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion. Various concentrations of Ent, DHBA or ABAH were pre-incubated for 10 min with LPO (50
More informationInflammation Is Present In De Quervain s Disease- a Correlation Study Between Biochemical And Histopathological Evaluation
Inflammation Is Present In De Quervain s Disease- a Correlation Study Between Biochemical And Histopathological Evaluation Hsu Kai-Lan 1, KUO YAO-LUNG 2, WU PO-TING 1, JOU I-MING 1. 1 National Cheng Kung
More informationEuropean Respiratory Society Annual Congress. Presented at: of new drugs for respiratory diseases. Barcelona, Spain, September 7-11, 2013 Page 1
PBI-4050, a novel first-in-class anti-fibrotic compound, reduces lung fibrosis in the bleomycin-induced lung fibrosis model: a comparative study with pirfenidone Presented at: Thematic Poster Session:
More informationSupplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
More informationAtg5 flox/flox ; CAG-Cre, 19M brain heart lung. spleen stomach colon. Takamura_Fig. S1
Takamura_Fig. S1 brain heart lung spleen stomach colon kidney SM Supplemental Figure 1 Histological findings of tg5 flox/flox ;CG-Cre mouse tissues. H&E staining of the brain, heart, lung, spleen, stomach,
More informationPreface 1. Fixation and Processing 1
Contents Preface xi 1. Fixation and Processing 1 Fixation 1 Processing 2 What Should Be Seen in a Well-Fixed, Well-Processed Specimen Stained with Hematoxylin and Eosin 3 Problems Encountered With Fixation
More informationSupplemental Methods: Histopathology scoring of individual components of Valentino
Supplementary Materials Online: Supplemental Methods: Histopathology scoring of individual components of Valentino synovitis grade and Mankin cartilage pathology scale Hemophilic synovitis was graded 0-10
More informationA. One to three months of age. Anterior Lens (Mean ± SEM) Posterior Lens (Mean ± SEM) Mid Lens (Mean ± SEM) Cornea (Mean ± SEM) Genotype
Supplementary Table 1. Location of lens opacification in Aldh1a1(-/-), Aldh3a1(-/-) single and Aldh1a1(-/-)/Aldh3a1(-/-) double knockout mice (DKO) at different ages. A. One to three months of age Genotype
More informationPapillary Lesions of the Breast A Practical Approach to Diagnosis. (Arch Pathol Lab Med. 2016;140: ; doi: /arpa.
Papillary Lesions of the Breast A Practical Approach to Diagnosis (Arch Pathol Lab Med. 2016;140:1052 1059; doi: 10.5858/arpa.2016-0219-RA) Papillary lesions of the breast Span the spectrum of benign,
More informationSupplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each
Supplementary Figure 1 The ability to regenerate an ear hole is discontinuous with wound healing. Ear-hole closure at D85 for each sex within each species observed. Data show a binary response to a 4 mm
More informationCase 3. Ann T. Moriarty,MD
Case 3 Ann T. Moriarty,MD Case 3 59 year old male with asymptomatic cervical lymphadenopathy. These images are from a fine needle biopsy of a left cervical lymph node. Image 1 Papanicolaou Stained smear,100x.
More informationSupplementary Figure 1
Supplementary Figure 1 YAP negatively regulates IFN- signaling. (a) Immunoblot analysis of Yap knockdown efficiency with sh-yap (#1 to #4 independent constructs) in Raw264.7 cells. (b) IFN- -Luc and PRDs
More informationSUPPLEMENTARY INFORMATION
b 350 300 250 200 150 100 50 0 E0 E10 E50 E0 E10 E50 E0 E10 E50 E0 E10 E50 Number of organoids per well 350 300 250 200 150 100 50 0 R0 R50 R100 R500 1st 2nd 3rd Noggin 100 ng/ml Noggin 10 ng/ml Noggin
More informationPRO-STIM Injectable Inductive Graft TECHNICAL MONOGRAPH
PRO-STIM Injectable Inductive Graft TECHNICAL MONOGRAPH PRO-STIM Injectable Inductive Graft TECHNICAL MONOGRAPH Headline Contents Headline Appendix 4 5 7 8 13 14 Clinical Benefits Self-Forming Porous Scaffold
More informationPart 1. Slides 1-38, Rita Alaggio Soft tissue tumors Trondheim 14. mars 2013
Part 1 Slides 1-38, Rita Alaggio Soft tissue tumors Trondheim 14. mars 2013 Pediatric Pathology Soft Tissue Tumors AN UPDATE Rita Alaggio Azienda Ospedaliera Università di Padova Soft Tissue Tumors More
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 Quantification of myelin fragments in the aging brain (a) Electron microscopy on corpus callosum is shown for a 18-month-old wild type mice. Myelin fragments (arrows) were detected
More informationSupporting Information
Supporting Information Desnues et al. 10.1073/pnas.1314121111 SI Materials and Methods Mice. Toll-like receptor (TLR)8 / and TLR9 / mice were generated as described previously (1, 2). TLR9 / mice were
More informationpplementary Figur Supplementary Figure 1. a.
pplementary Figur Supplementary Figure 1. a. Quantification by RT-qPCR of YFV-17D and YFV-17D pol- (+) RNA in the supernatant of cultured Huh7.5 cells following viral RNA electroporation of respective
More informationSupplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses
Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses using an anti-cre antibody; testes at 1 week (left panel),
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/375/ra41/dc1 Supplementary Materials for Actin cytoskeletal remodeling with protrusion formation is essential for heart regeneration in Hippo-deficient mice
More informationCONTRIBUTION TO THE HISTOPATHOLOGY OF FILARIASIS
CONTRIBUTION TO THE HISTOPATHOLOGY OF FILARIASIS PHILIP H. HARTZ Public Health Service, Curacao, N.W.I. The histologic changes caused by filariasis (Wucheria Bancrofti) are considered to be non-specific
More informationBy Dr. Mohamed Saad Daoud
By Dr. Mohamed Saad Daoud Part I Introduction Types of White Blood Cells Genesis of the White Blood Cells Life Span of the White Blood Cells Dr. Mohamed Saad Daoud 2 Leucocytes Introduction: Infectious
More informationSupporting Information
Supporting Information Plikus et al. 10.1073/pnas.1215935110 SI Text Movies S1, S2, S3, and S4 are time-lapse recordings from individually cultured Period2 Luc vibrissa follicles show that circadian cycles
More information