APOLs with low ph dependence can kill all African trypanosomes

Similar documents
Antigenic variation as adaptive process: the case of Trypanosoma brucei

T rypanosoma evansi is a widely distributed hemoflagellate parasite

Relative SOD1 activity. Relative SOD2 activity. Relative SOD activity (Infected:Mock) + CP + DDC

Nature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Generation and validation of mtef4-knockout mice.

Supplementary Figure 1. Normal T lymphocyte populations in Dapk -/- mice. (a) Normal thymic development in Dapk -/- mice. Thymocytes from WT and Dapk

SUPPLEMENTARY INFORMATION

Figure S1. PMVs from THP-1 cells expose phosphatidylserine and carry actin. A) Flow

Supplementary Figure 1.TRIM33 binds β-catenin in the nucleus. a & b, Co-IP of endogenous TRIM33 with β-catenin in HT-29 cells (a) and HEK 293T cells

SUPPLEMENTARY INFORMATION

Supplementary Figures

Nature Medicine: doi: /nm.4322

SD-1 SD-1: Cathepsin B levels in TNF treated hch

SUPPLEMENTARY INFORMATION

Supplementary Figure 1. AdipoR1 silencing and overexpression controls. (a) Representative blots (upper and lower panels) showing the AdipoR1 protein

a b G75 G60 Sw-2 Sw-1 Supplementary Figure 1. Structure predictions by I-TASSER Server.

Figure S1. (A) SDS-PAGE separation of GST-fusion proteins purified from E.coli BL21 strain is shown. An equal amount of GST-tag control, LRRK2 LRR

Prolonged mitotic arrest induces a caspase-dependent DNA damage

SUPPLEMENTARY INFORMATION

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial

SUPPLEMENTARY INFORMATION

Lack of cadherins Celsr2 and Celsr3 impairs ependymal ciliogenesis, leading to fatal

ERK1/2/MAPK pathway-dependent regulation of the telomeric factor TRF2

Supplementary Figure 1 Expression of Crb3 in mouse sciatic nerve: biochemical analysis (a) Schematic of Crb3 isoforms, ERLI and CLPI, indicating the

Supplementary Information. Tissue-wide immunity against Leishmania. through collective production of nitric oxide

Suppl. Figure 1. T 3 induces autophagic flux in hepatic cells. (A) RFP-GFP-LC3 transfected HepG2/TRα cells were visualized and cells were quantified

a surface permeabilized

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

Supplementary Figure 1. SC35M polymerase activity in the presence of Bat or SC35M NP encoded from the phw2000 rescue plasmid.

Supplementary Table 1. Metabolic parameters in GFP and OGT-treated mice

SUPPLEMENTARY FIGURES

Cellular and Molecular Remodeling of the Endocytic Pathway during Differentiation of Trypanosoma brucei Bloodstream Forms

Supplementary Information Titles Journal: Nature Medicine

SUPPLEMENTARY INFORMATION. Supplementary Figures S1-S9. Supplementary Methods

T H E J O U R N A L O F C E L L B I O L O G Y

TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer

Supplemental Figure 1. Western blot analysis indicated that MIF was detected in the fractions of

Supplemental Figure 1. (A) The localization of Cre DNA recombinase in the testis of Cyp19a1-Cre mice was detected by immunohistchemical analyses

Supplementary Figure 1. Ent inhibits LPO activity in a dose- and time-dependent fashion.

Supplementary Fig. 1 eif6 +/- mice show a reduction in white adipose tissue, blood lipids and normal glycogen synthesis. The cohort of the original

Mutual self-defence: the trypanolytic factor story

GPR120 *** * * Liver BAT iwat ewat mwat Ileum Colon. UCP1 mrna ***

Supplemental information

Supplementary Materials for

SUPPLEMENTARY INFORMATION

African Americans suffer from kidney failure

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Supplemental Table 1. Primers used for RT-PCR analysis of inflammatory cytokines Gene Primer Sequence

Supplemental information Acid-sensing ion channel 1a contributes to hippocampal LTP inducibility through multiple mechanisms

Supplementary Figure 1 Chemokine and chemokine receptor expression during muscle regeneration (a) Analysis of CR3CR1 mrna expression by real time-pcr

The development of new diagnostic tools for sleeping sickness

Supplementary Figure 1.

SUPPLEMENTARY FIGURES AND TABLE

Supplementary Figure 1. Prevalence of U539C and G540A nucleotide and E172K amino acid substitutions among H9N2 viruses. Full-length H9N2 NS

Luminescent Multiplex Viability Assay for T.b. gambiense

Nature Immunology: doi: /ni eee Supplementary Figure 1

Supplementary figure legends

p = formed with HCI-001 p = Relative # of blood vessels that formed with HCI-002 Control Bevacizumab + 17AAG Bevacizumab 17AAG

F-actin VWF Vinculin. F-actin. Vinculin VWF

B. SDS-PAGE. Western blot MW (kda) Supplementary Information. Supplementary Figure 1. MW (kda) Glutelin. Prolamin. 3 E.coli. 3 E.

Supplementary Figure S1. Distinct compartmentalization of proinsulin in obese db/db mouse islet ß- cells.

Supplementary Table 1. The primers used for quantitative RT-PCR. Gene name Forward (5 > 3 ) Reverse (5 > 3 )

Evaluation of an EDTA version of CATT/Trypanosoma brucei gambiense. Prince Leopold Institute of Tropical Medicine, Department of Parasitology,

Supplementary Information for. A cancer-associated BRCA2 mutation reveals masked nuclear. export signals controlling localization

Supplementary Figure 1

Supplementary Figure S I: Effects of D4F on body weight and serum lipids in apoe -/- mice.

SUPPLEMENTARY INFORMATION

Supplementary Figure 1. Gene expression analysis of GSNOR1 and NIA2 in genotypes with altered NO signalling. Relative expression of GSNOR1 in leaves

Supplementary Figure 1. Confocal immunofluorescence showing mitochondrial translocation of Drp1. Cardiomyocytes treated with H 2 O 2 were prestained

Study on endocytosis and hemoglobin uptake in different developmental stages of Trypanosoma congolense IL3000 strain

A. Generation and characterization of Ras-expressing autophagycompetent

SUPPORTING INFORMATION

Supplementary Figure 1: Digitoxin induces apoptosis in primary human melanoma cells but not in normal melanocytes, which express lower levels of the

nature methods Organelle-specific, rapid induction of molecular activities and membrane tethering

Aggregated neutrophil extracellular traps limit inflammation by degrading cytokines and chemokines

sequences of a styx mutant reveals a T to A transversion in the donor splice site of intron 5

Supplementary Table 1. Primer sequences for conventional RT-PCR on mouse islets

Supplemental Figure 1

Supplementary Fig. S1. Schematic diagram of minigenome segments.

Supplementary Figure S1. Venn diagram analysis of mrna microarray data and mirna target analysis. (a) Western blot analysis of T lymphoblasts (CLS)

on January 28, 2019 by guest

Figure S1A. Blood glucose levels in mice after glucose injection

Procaspase-3. Cleaved caspase-3. actin. Cytochrome C (10 M) Z-VAD-fmk. Procaspase-3. Cleaved caspase-3. actin. Z-VAD-fmk

Supplementary Figure 1. Supernatants electrophoresis from CD14+ and dendritic cells. Supernatants were resolved by SDS-PAGE and stained with

Luminescent platforms for monitoring changes in the solubility of amylin and huntingtin in living cells

LPS LPS P6 - + Supplementary Fig. 1.

Soluble ADAM33 initiates airway remodeling to promote susceptibility for. Elizabeth R. Davies, Joanne F.C. Kelly, Peter H. Howarth, David I Wilson,

Supplementary Figure 1 Transcription assay of nine ABA-responsive PP2C. Transcription assay of nine ABA-responsive PP2C genes. Total RNA was isolated

Supplementary material. Supplementary Figure legends

genome edited transient transfection, CMV promoter

Supplementary Figure 1. Properties of various IZUMO1 monoclonal antibodies and behavior of SPACA6. (a) (b) (c) (d) (e) (f) (g) .

Supplementary Figure 1. Characterization of basophils after reconstitution of SCID mice

fl/+ KRas;Atg5 fl/+ KRas;Atg5 fl/fl KRas;Atg5 fl/fl KRas;Atg5 Supplementary Figure 1. Gene set enrichment analyses. (a) (b)

SUPPLEMENTARY INFORMATION

marker. DAPI labels nuclei. Flies were 20 days old. Scale bar is 5 µm. Ctrl is

GFP/Iba1/GFAP. Brain. Liver. Kidney. Lung. Hoechst/Iba1/TLR9!

Supplementary Figure 1. Generation of knockin mice expressing L-selectinN138G. (a) Schematics of the Sellg allele (top), the targeting vector, the

Programmed necrosis, not apoptosis, is a key mediator of cell loss and DAMP-mediated inflammation in dsrna-induced retinal degeneration

Supplementary Figure 1: Co-localization of reconstituted L-PTC and dendritic cells

Kidney. Heart. Lung. Sirt1. Gapdh. Mouse IgG DAPI. Rabbit IgG DAPI

Zhu et al, page 1. Supplementary Figures

Transcription:

SUPPLEMENTARY INFORMATION Letters DOI: 1.138/s41564-17-34-1 In the format provided by the authors and unedited. APOLs with low ph dependence can kill all African trypanosomes Frédéric Fontaine 1, Laurence Lecordier 1, Gilles Vanwalleghem 1,5, Pierrick Uzureau 1,6, Nick Van Reet 2, Martina Fontaine 3, Patricia Tebabi 1, Benoit Vanhollebeke 1, Philippe Büscher 2, David Pérez-Morga 1,4 and Etienne Pays 1 * 1 Laboratory of Molecular Parasitology, IBMM, Université Libre de Bruxelles, 12, rue des Profs Jeener et Brachet, B-641 Gosselies, Belgium. 2 Unit of Parasite Diagnostics, Institute of Tropical Medicine, 155, Nationalestraat, B-2 Antwerpen, Belgium. 3 Laboratory of Immunobiology, IBMM, Université Libre de Bruxelles, 12, rue des Profs Jeener et Brachet, B-641 Gosselies, Belgium. 4 Center for Microscopy and Molecular Imaging (CMMI), Université Libre de Bruxelles, 12, rue des Profs Jeener et Brachet, B-641 Gosselies, Belgium. Present addresses: 5 School of Biomedical Sciences, The University of Queensland, St Lucia, QLD 472, Australia. 6 Laboratoire de Médecine Expérimentale (ULB222), Hôpital André Vésale, Université Libre de Bruxelles, 76, route de Gozée, B-611 Montigny le Tilleul, Belgium. Frédéric Fontaine and Laurence Lecordier contributed equally to this work. *e-mail: epays@ulb.ac.be Nature Microbiology www.nature.com/naturemicrobiology 217 Macmillan Publishers Limited, part of Springer Nature. All rights reserved.

Parasite density (x1 4 ml -1 ) kda 3 2 + Acetic acid + rapol1 1 + rapol2 + rapol3 + rapol6 2 4 6 8 Time (h) 6 4 2 + Acetic acid + rapol1 + rapol2 + rapol3 + rapol6 72 55 4 35 2 rppapol1 rapol1 rapol2 rapol3 rapol6 Suppl. Fig. 1 Supplementary Figure 1. In vitro trypanolytic potential of various human rapols. The effect of different rapols (1 µg ml -1 rapol1, 3 µg ml -1 rapol3, 5 µg ml -1 rapol2 and rapol6) on T.b. brucei 328-114 growth kinetics and 24 h survival was evaluated (error bars: s.e.m.; 3 technical replicates; n=1). The panel at the right shows the SDS-PAGE pattern of the rapols, as assessed by Coomassie blue staining.

APOL3 APOL1 PpAPOL1 APOL3 APOL1 PpAPOL1 APOL3 APOL1 PpAPOL1 APOL3 APOL1 PpAPOL1 MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFKRS --------MEGAALLRVSVLCIWMSAL-----FLGVGVRAEE-----AGARVQQNVPSGTDTGDPQSKPLGD --------MEGAALLRLFVLCIWTSGL-----FLGVGVRAEE-----AAARVQQNVPSGTDTGDPQ------ *.:.: : *. : * *:. *: * **::... :*.. Helix 2 Helix 3 FL------EKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIED WAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKD --------ESNVSLEDYLNYFQKNVSPQEMLLLLSDHKAWERVVATAELPRDEADELYKALNKLIRHMVMKD *.. *: :**.:.**. : :**::::**:.*::*****:*** * :**.:* ::* Helix 4 Helix 5+6 Helix 7+8 EYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAP KNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAP KNWLEEVQQHRKRFLEEFPRLERELQDKIRRLCDLAGQVQKVHKGATIANAFSSTLGVASGVLTFLGLGLAP : :: :*.*:.**:***.:: ::::.*.* **. :::**.* **:*..*.:. :**:::: *: *** BH3 Helix 9 FTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLN FTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAG FTAGSSLVLLEPVTGLGITAALTGITSGSVEYAKKRWAQAEAHELVNKSLDTVEEMNEFLYHNIPNFISLRV ** * **.*. ** ::*:****:. :::.. ::*:* *..*:* ::..*.:.*::** APOL3 APOL1 PpAPOL1 APOL3 APOL1 PpAPOL1 NYYEATQTIGSEIRAIRQARAR--------ARLPVTTWRISAGSGG------QAERTIAGTTRAVSRGARIL NTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGE------QVERVNEPSILEMSRGVKLT NLVKFTEDTGKAIRAIRQARANPHSVSHVPASLHRVTEPVSATSVEERARVVEMERVAESRTTEVIRGAKIV * : * *. ***:*.***. *.* :** * : **. : **..: C-terminal helix SATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH DVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL DKVFEGALFVLDVVGLVCQLKHLHEGAKSKTAEELKKVAQELEKKLNILNKKYETLRQEP--... ::.**** ** : ********* :****.. *****::* *.: *: *. Supplementary Figure 2. Sequence comparison between APOLs. Asterisks and dots respectively refer to identical and similar amino acids. The helices have been defined in 6. BH3 = Bcl2 homology domain 3.

a Tb gambiense b k - FMK + FMK rapol3 rat anti-apol3 TgsGP KO Tb gambiense n rapol1 25 µg ml -1 rapol1 5 µg ml -1 rapol3 25 µg ml -1 Supplementary Figure 3. Uptake of rapol3 in trypanosomes. (a) Immunodetection of rapol3 in T.b. gambiense LiTat 1.3 parasites incubated or not in the presence of the cathepsin inhibitor FMK-24. (scale bar=5 µm; n=nucleus and k=kinetoplast, both stained with DAPI). (b) Effect of temperature on trypanolysis of T.b. gambiense TgsGP KO LiTat 1.3 parasites by rapol1 or rapol3. Results are expressed as % control growth at each temperature (error bars: s.e.m.; 3 technical replicates; n=2 independent experiments).

Supplementary Figure 4. Doxycycline-mediated induction of TbKIFC1 RNAi. Western blot of induced (+Dox) and non-induced (-Dox) parasite extracts. See 7 for details.

Nucleus Mitochondrion + rapol3 M FP K FP M K M K FP K M M Scale = 5 nm Supplementary Figure 5. Mitochondrial and nuclear phenotype of rapol3-mediated trypanolysis. TEM micrographs of T.b. brucei 328-114 after 2 h incubation with 3 µg ml -1 rapol3 (FP; flagellar pocket; K=kinetoplast; M=mitochondrion; N=nucleus; arrows: heterochromatin patches).

rmut4 probability rmut3 probability rapol3 WT probability TMHMM ph 5.5 ph 7.5 T. b. brucei T. b. gambiense transmembrane inside outside 1.6.2 1-1 1-2 1-3 1-4 1-5 1-6 1-1 1-2 1-3 1-4 1-5 1-6 + 1% Glc + 75 M IPTG 1 5 + 2 mm NH 4 Cl 1 5 + 2 mm NH4 Cl 1 4 8 RGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSA 7 + 8 9 2 4 6 2 4 6 rapol3 (µg ml -1 ) rapol3 (µg ml -1 ) 1.6.2 1-1 1-2 1-3 1-4 1-5 1-6 1-1 1-2 1-3 1-4 1-5 1-6 + 1% Glc + 75 M IPTG 1 5 1 + 2 mm NH4 Cl + 2 mm NH4 Cl 5 1 4 8 RGCTISNVVSSSTGAASGIMSLAGLVLAPFTEGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSA 7 + 8 9 1 2 3 4 5 1 2 3 4 5 rmut3 (µg ml -1 ) rmut3 (µg ml -1 ) 1.6.2 1-1 1-2 1-3 1-4 1-5 1-6 1-1 1-2 1-3 1-4 1-5 1-6 + 1% Glc + 75 M IPTG 1 5 + 2 mm NH4 1 Cl + 2 mm NH4 Cl 5 1 4 8 RGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTEAGVELGAASAVTGITTSIVEHSYTSSA 7 + 8 9 1 2 3 4 5 1 2 3 4 5 rmut4 (µg ml -1 ) rmut4 (µg ml -1 ) Supplementary Figure 6. Relative activity of glutamic acid mutants in the helix 9 region of rapol3. In each row, the left panels show the predicted patterns of transmembrane spans (TMHMM program, Expasy) in the APOL sequences defined underneath (numbers refer to key helices in the pore-forming domain 6 ), followed by measurements of the colicin-like activity of the different rapols in E. coli as determined by scoring the plating efficiency after overnight incubation at 37 C, comparing induction of protein expression following IPTG addition with control following glucose (Glc) addition 16, and comparing the effect of ph. The right panels show the trypanolytic potential of the different rapols, as determined on T.b. brucei 328-114 and T.b. gambiense LiTat 1.3 after 24 h incubation in vitro with or without 2 mm NH 4 Cl (error bars: s.e.m.; 3 technical replicates; n=3 independent experiments).

Supplementary Figure 7. Trypanolytic activity of 1 µg ml -1 rapol1/apol3 chimaeras (a) or 1 µg ml -1 rapol1 mutants (b) on T.b. brucei 328-114 and T.b. gambiense LiTat 1.3 after 24 h incubation in vitro. The restriction endonuclease sites used to generate the constructs are indicated (italics: generated by site-directed mutagenesis without changing the amino acid code; underlined: inserted in the PCR primers used to generate the gene fragments). Panel (c) illustrates the activity measurements reported as positive in table a. C=chimaeras; M=mutants. (error bars: s.e.m.; 3 technical replicates; n=3 independent experiments).

Intensity value (A.U) Intensity value (A.U) kda 55 4 35 Non injected h 24h 48h rapol1 (1µg) 72h 96h kda 55 4 35 Non injected h 2h 6h rapol3 (1µg) 24h 4 25 3 2 1 R 2 =.9979 2 15 1 5 R 2 =.9584 5 1 Time (h) 5 1 15 2 25 Time (h) rapol1 half-life = ~5h rapol3 half-life = ~13h Supplementary Figure 8. Measurement of the rapol1 and rapol3 decay in mouse blood. Western blot detection in the blood of 6 weeks-old female BALB/c mice, of different rapols (1 µg) intravenously injected at t=. We used ImageJ to quantify the signal strength from Fig. 4a western blots images (middle panel). Using these values, we applied a linear regression to evaluate the recombinant proteins half-life in mice blood.

rmut-null probability rapol3 WT probability TMHMM ph 5.5 ph 7.5 T. b. brucei T. b. gambiense transmembrane inside outside 1.6.2 1-1 1-2 1-3 1-4 1-5 1-6 1-1 1-2 1-3 1-4 1-5 1-6 + 1% Glc + 75 M IPTG 1 5 + 2 mm NH 4 Cl 1 5 + 2 mm NH 4 Cl RGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSA 7 + 8 9 1.6.2 1 4 8 1 4 8 1-1 1-2 1-3 1-4 1-5 1-6 1-1 1-2 1-3 1-4 1-5 1-6 RGCTISNVVSSSTGAASGIMSLAGLVQSSFTASTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSA 7 + 8 9 + 1% Glc + 75 M IPTG 2 4 6 1 5 + 2 mm NH 4 Cl 1 2 3 4 5 2 4 6 rapol3 (µg ml -1 ) rapol3 (µg ml -1 ) 1 1 2 3 4 5 rmut-null (µg ml -1 ) rmut-null (µg ml -1 ) 5 + 2 mm NH 4 Cl Supplementary Figure 9. Lack of trypanolytic activity of rapol3 137 QQSFTAS 143 (rmut-null). In each row, the left panels show the predicted patterns of transmembrane spans (TMHMM program, Expasy) in the APOL sequences defined underneath (numbers refer to key helices in the pore-forming domain 6 ), followed by measurements of the colicinlike activity of the different rapols in E. coli as determined by scoring the plating efficiency after overnight incubation at 37 C, comparing induction of protein expression following IPTG addition with control following glucose (Glc) addition 16, and comparing the effect of ph. The right panels show the trypanolytic potential of the different rapols, as determined on T.b. brucei 328-114 and T.b. gambiense LiTat 1.3 after 24 h incubation in vitro with or without 2 mm NH 4 Cl (error bars: s.e.m.; 3 technical replicates; n=3 independent experiments).

Supplementary Figure 1. Trypanolysis differences between different T.b. gambiense populations: relative adaptation to in vitro growth conditions, influence of the type of VSG and TgsGP level. (a) Trypanolysis and growth curves of different cloned T.b. gambiense populations: in vitro adapted LiTat 1.3 clone from the ELIANE strain, LiTat 1.3 parasites freshly isolated from blood and bloodstream parasites from the MBA strain expressing the LiTat 1.3 isotype AnTat 11.8, or bloodstream parasites from the ELIANE strain expressing LiTat 1.2 (error bars: s.e.m.; 3 technical replicates; n=3 independent experiments). (b) Western blots of protein extracts from the different T.b. gambiense populations, incubated with anti-litat 1.3 VSG antibodies. (c) Expression levels of TgsGP in the different T.b. gambiense populations and in T.b. brucei negative control parasites, as measured by qrt- PCR.

Supplementary Figure 11. Selective precipitation of rapol3 in the trypanosome incubation medium. rapol1 and rapol3 (1 µg ml -1 each) were incubated for different periods at 37 C in the incubation medium, then the centrifugation supernatant was analyzed by Western blotting with anti-apol antibodies. =no protein.

From Fig. 4a From Suppl. Fig. 4 Supplementary Figure 12. Raw version of Western blots.

Supplementary Table Effect of intravenous injection of different rapols on mice health (3 mice per group; 1=no effect; 2=mobility reduced; 3=mobility reduced + fur bristling; 4=death).