Sex, viruses, and the statistical physics of evolution
|
|
- Karin Powers
- 6 years ago
- Views:
Transcription
1 Sex, viruses, and the statistical physics of evolution
2 Cartoon of Evolution A TC G Selection Genotypes Mutation & Recombination Mutation...ATACG... Sex & Recombination Selection...ATGCG... Richard Neher 2
3 Tree of Life - billions of years source: tree of life, tolweb.org 4 billion years Richard Neher 3
4 Phylogenetic tree of Fruitflies - millions of years ~40 Millions of years image from: insects.eugenes.org/species/ Richard Neher 4
5 Evolution of Influenza A - few years PB2 Influenza A global epidemic aa # aa # aa # A/Weiss/43 A/AA/Huston/1945 A/AA/Marton/1943 A/Iowa/1943 A 3 aa 98 # aa #5 A/Bel/42 A/Alaska/1935 A/PR/8/34 A/Henry/1936 A/Phila/1935 A/Melbourne/35 A/WSN/1933 A/Brevig Mission/1/ A/Chile/1/83 A/Memphis/39/1983 A/Christs Hospital/157/1982 A/Memphis/1/1984 A/Tonga/14/1984 A/New Zealand/7/1983 A/India/6263/1980 A/Memphis/7/1980 A/Baylor/4052/1981 A/Brazil/11/1978 A/Hong Kong/117/77 A/Lackland/3/1978 A/Memphis/10/1978 A/USSR/90/1977 A/Arizona/14/1978 A/Tientsin/78/1977 A/Roma/1949 A/Albany/4835/1948 A/Albany/4836/1950 A/Albany/12/1951 A/Denver/57 A/Fort Worth/50 A/Malaysia/54 A/FORT MONMOUTH/1/47 A/Cam/46 A/Hickox/1940 B I C aa #7 100 D A/Texas/36/91 F A/Memphis/12/1986 A/Memphis/3/1987 A/New York/2924-1/1986 A/Taiwan/01/1986 A/Texas/2922-3/1986 A/Singapore/6/1986 A/Baylor/11515/82 V E II 1 aa # III IV 100 A/Canterbury/01/2001 A/Canterbury/106/2004 A/Memphis/5/2003 A/New York/8/ A/Otago/5/2005 J A/New York/223/2003 A/New York/291/2002 A/Wellington/1/2001 A/Memphis/1/2001 A/New York/239/2001 A/New Caledonia/20/1999 A/New South Wales/24/1999 A/TW/4845/99 A/New York/233/2000 A/Hong Kong/470/97 A/TW/3355/97 A/Nanchang/13/1996 A/Charlottesville/31/95 A/Memphis/6/1996 A/New York/653/1996 A/TW/130/96 A/New York/694/1995 G A/Hong Kong/427/98 A/South A/New Australia/44/2000 York/146/ H VI I IX VIII Evolution as cause of epidemics Nelson et al., 2008 Richard Neher 5
6 Human immunodeficiency virus (HIV) 100nm HIV budding from an immune cell Rapid evolution is a hallmark of HIV infections Richard Neher 6
7 HIV Richard Neher 7
8 HIV Virus escapes the immune system by continuous evolution Richard Neher 7
9 Evolution in a single patient (blood samples every 6 month) ~ 8% divergence in 10 years == many millions of years in Drosophila Time (years since seroconversion) Lemey et al., 2006, Shankarappa et al Richard Neher 8
10 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Richard Neher 9
11 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site Richard Neher 9
12 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site Large population: N=10 10 viruses Richard Neher 9
13 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site human immune cell Large population: N=10 10 viruses Viral sex Richard Neher 9
14 Recombination in viruses - Influenza 100nm 11 genes on 8 segments 16 H (hemagglutinin) subtypes 9 N (neuraminidase) subtypes H1N1, H2N2, H3N2, H5N1 are common Richard Neher 10
15 Recombination in viruses - Influenza 100nm 11 genes on 8 segments 16 H (hemagglutinin) subtypes 9 N (neuraminidase) subtypes H1N1, H2N2, H3N2, H5N1 are common Pandemics often follow reassortments, e.g. pandemics 1957 (H2N2) and 1968 (H3N2) Reassortment is frequent in waterfowl and swine, where many subtypes circulate. Richard Neher 10
16 Population Spreading of beneficial mutations Mutant individuals reproduce faster (Drug resistant strain) Time Fixation probability: ~s Sweep time: ~ ln(ns) / s Richard Neher 11
17 Evolution in asexual and sexual organisms Small Population Time Sequential innovations: rate ~ N Richard Neher 12
18 Evolution in asexual and sexual organisms Small Population Large Population Time Sequential innovations: rate ~ N Many concurrent mutations: rate ~ log N Most good mutations are wasted! Time Richard Neher 12
19 Evolution in asexual and sexual organisms Small Population E V O L U T I O N IN S E X U A L A N D A S E X U A L POPUL.AT1ONS Time POPULATION E V O L U T I O N IN S E X U A L A N D A S E X U A L POPUL.AT1ONS SMALL Large Population Sequential innovations: rate ~ N Many concurrent mutations: a n d rate ~ log N FIGURE 1. Evolution i n s e x u a l and a s e x u a l populations. The hatched shaded a r e a s show the i n c r e a s e d number of mutant individuals following t h e occurrence of a favorable mutation. T h e a b s c i s s a I s time. Modified from Muller (1932). Most good mutations are wasted! s i s small, and therefore that p changes very slowly s o t h a t i t i s appropriate to replace addition by integration. T h i s l e a d s to LARGE POPULATION LARGE POPULATION Time In the a b s e n c e of recombination, p follows the logistic curve Conventional wisdom: rate ~ N RA Fisher (1930), H Muller (1932), M Kimura and J Crow (1965) Time Richard Neher 12
20 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations Resistance mutations Richard Neher 13
21 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations Drug resistance increases due to selection on existing mutations Resistance mutations Richard Neher 13
22 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations novel mutation Drug resistance increases due to selection on existing mutations Novel mutations keep the wave going Resistance mutations Richard Neher 13
23 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations novel mutation recombination Drug resistance increases due to selection on existing mutations Novel mutations keep the wave going Resistance mutations Via recombination mutations can keep up with the wave and make it Richard Neher 13
24 Surfing of beneficial mutations ! Richard Neher 14
25 Surfing of beneficial mutations ! Richard Neher 14
26 Evolutionary benefits of recombination Conventional wisdom: rate of evolution ~ N holds only for very frequent recombination Realistic recombination: rate of evolution ~ r 2 log N To slow down evolution, one has to target recombination rather than the population size!! Richard Neher 15
27 The more recombination, the better? Is there a cost to recombination? Richard Neher 16
28 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17
29 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17
30 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17
31 The cost of recombination A recombined soccer team is worse than the parents. Richard Neher 18
32 The cost of recombination A recombined soccer team is worse than the parents. Relay racing teams don t have that problem! Richard Neher 18
33 Genetic interaction and recombination Different reassortments of Influenza A: Recombination explores -- selection amplifies the best Richard Neher 19
34 Genetic interaction and recombination Different reassortments of Influenza A: Recombination explores -- selection amplifies the best no recombination moderate recombination frequent recombination Richard Neher 19
35 Allele vs genotype selection Strength of Interaction Rel. epistasis Genotype selection Clonal Competition (CC) Quasi Linkage Equilibrium (QLE) Allele selection Recombination rate/selection Mating freq./selection Richard Neher 20
36 The success of selection 0.4 Selection on the properties of the parts. All Stars team F final 0.3 Selection on the combinations the best clubs recombination Richard Neher 21
37 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Richard Neher 22
38 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Do such observations, together with theoretical insight, explain the differences between drugs and patients? Richard Neher 22
39 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Do such observations, together with theoretical insight, explain the differences between drugs and patients? What can we learn about the evolutionary process in general? Richard Neher 22
40 Sequencing Costs per Base Cost per base [$] 10!1 10!2 10!3 10!4 Data Exponential decay:! = 2.5 years 10! year Richard Neher 23
41 Experiment & Theory Darwin s Theory Observations: Paleontology Diversity of species Richard Neher 24
42 Experiment & Theory Darwin s Theory Quantitative Theory Dynamics Experiments in the Lab Bacteria or viruses Sequencing and Phenotyping Observations: Paleontology Diversity of species Richard Neher 24
43 Collaborators Boris Shraiman, KITP Daniel Fisher, Stanford Thomas Leitner, LANL Richard Neher 25
Identification of novel influenza A viruses in Australian swine
Identification of novel influenza A viruses in Australian swine OFFLU SIV Group Annual Meeting, Rome, 16-17 April 2013 Frank Wong 1, Ian Barr 2, David Smith 3, David Williams 1, Kelly Davies 1, Vicky Stevens
More informationThe Influenza A (H1N1
The Influenza A (H1N1 Human Swine) Pandemic North America (A/Mexico/ /2009 [H1N1]), Influenza A virus, April 2009: - H1N1 & H3N2 viruses are endemic among pig populations in many countries - Reassortment
More informationEvolution of influenza
Evolution of influenza Today: 1. Global health impact of flu - why should we care? 2. - what are the components of the virus and how do they change? 3. Where does influenza come from? - are there animal
More informationLecture 19 Evolution and human health
Lecture 19 Evolution and human health The evolution of flu viruses The evolution of flu viruses Google Flu Trends data US data Check out: http://www.google.org/flutrends/ The evolution of flu viruses the
More informationNature Immunology: doi: /ni Supplementary Figure 1. Infection strategy.
Supplementary Figure 1 Infection strategy. To test the antibody responses against influenza viruses, animals were sequentially infected with two divergent strains of the same subtype. For H1N1 infections,
More informationThe "Flu" a case of low fever and sniffles that keeps you home in bed for a day a gastrointestinal upset ("stomach flu")
The "Flu" Influenza is a viral infection of the lungs characterized by fever, cough, and severe muscle aches. In the elderly and infirm, it is a major cause of disability and death (often as a result of
More informationBefore and during influenza pandemics
before and during influenza pandemics Klaus Stöhr Department for Communicable Diseases Surveillance and Response Before and during influenza pandemics Before pandemics: interpandemic period New human influenza
More informationMapping the Antigenic and Genetic Evolution of Influenza Virus
Mapping the Antigenic and Genetic Evolution of Influenza Virus Derek J. Smith, Alan S. Lapedes, Jan C. de Jong, Theo M. Bestebroer, Guus F. Rimmelzwaan, Albert D. M. E. Osterhaus, Ron A. M. Fouchier Science
More informationSEX. Genetic Variation: The genetic substrate for natural selection. Sex: Sources of Genotypic Variation. Genetic Variation
Genetic Variation: The genetic substrate for natural selection Sex: Sources of Genotypic Variation Dr. Carol E. Lee, University of Wisconsin Genetic Variation If there is no genetic variation, neither
More informationModeling the Antigenic Evolution of Influenza Viruses from Sequences
Modeling the Antigenic Evolution of Influenza Viruses from Sequences Taijiao Jiang Center of Systems Medicine, Chinese Academy of Medical Sciences Suzhou Institute of Systems Medicine October 8-10, 2015.
More informationInfluenza surveillance and pandemic preparedness - a global challenge Anne Kelso
Influenza surveillance and pandemic preparedness - a global challenge Anne Kelso WHO Collaborating Centre for Reference and Research on Influenza Melbourne, Australia Three global health challenges 243
More informationJ. A. Sands, 21 October 2013 Lehigh University
J. A. Sands, 21 October 2013 Lehigh University Cryptococcus, Candidiasis, Aspergillosis Tuberculosis Cholera Plague Bact. Meningitis Salmonella Listeria Leptospirosis Staph. (MRSA) E. coli Clostridium
More informationLecture 18 Evolution and human health
Lecture 18 Evolution and human health Evolution and human health 1. Genetic factors 2. Infectious diseases Evolution and human health 1. Genetic factors Evolution and human health 1. Genetic factors P
More informationAn epitope of limited variability as a novel influenza vaccine target
An epitope of limited variability as a novel influenza vaccine target Craig P Thompson 1,2*, José Lourenço 1, Adam A Walters 2, Uri Obolski 1, Matthew Edmans 1,2, Duncan S Palmer 1, Kreepa Kooblall 3,
More informationCurrent Vaccines: Progress & Challenges. Influenza Vaccine what are the challenges?
Current Vaccines: Progress & Challenges Influenza Vaccine what are the challenges? Professor John S. Tam The Hong Kong Polytechnic University Asia-Pacific Alliance for the Control of Influenza (APACI)
More informationPhylogenetic Methods
Phylogenetic Methods Multiple Sequence lignment Pairwise distance matrix lustering algorithms: NJ, UPM - guide trees Phylogenetic trees Nucleotide vs. amino acid sequences for phylogenies ) Nucleotides:
More informationExistence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan
International Congress Series 1263 (2004) 749 753 Existence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan Shin ichi Shimada a, *, Takayasu Ohtsuka b, Masayuki Tanaka b, Munehito
More informationPandemic Influenza influenza epidemic: realization of a worst-case scenario
Pandemic Influenza October 9, 2006 1918 influenza epidemic: realization of a worst-case scenario First case: Albert Mitchell, Camp Funston, KS, March 11, 1918 Up to 20% of all humans infected 20-50 million
More informationBuilding complexity Unit 04 Population Dynamics
Building complexity Unit 04 Population Dynamics HIV and humans From a single cell to a population Single Cells Population of viruses Population of humans Single Cells How matter flows from cells through
More informationPredicting the future
Swine influenza A viruses: a more global picture Predicting the future Dr Nicola S. Lewis BSc BVetMed PhD MRCVS Dr Nicola S. Lewis BSc BVetMed PhD MRCVS Centre for for Pathogen Evolution and WHO Collaborating
More informationINFLUENZA EVOLUTION: Challenges for diagnosis
INFLUENZA EVOLUTION: Challenges for diagnosis Jairo A. Méndez-Rico Influenza Team PAHO/WHO, Washington, DC Overview Every year, influenza infects up to one in five people around the world, and causes up
More informationNASDAQ:NVAX Novavax, Inc. All rights reserved.
Novavax vaccine induced improved immune responses against homologous and drifted A(H3N2) viruses in older adults compared to egg-based, high-dose, influenza vaccine World Vaccine Congress April 4, 2018
More informationA secret about creationism
A secret about creationism Even among ardent creationists, most believe in evolution Why? Natural selection is a provable biological process. Selection causes evolution critical in medicine, agriculture
More informationAn Evolutionary Story about HIV
An Evolutionary Story about HIV Charles Goodnight University of Vermont Based on Freeman and Herron Evolutionary Analysis The Aids Epidemic HIV has infected 60 million people. 1/3 have died so far Worst
More informationPatterns of hemagglutinin evolution and the epidemiology of influenza
2 8 US Annual Mortality Rate All causes Infectious Disease Patterns of hemagglutinin evolution and the epidemiology of influenza DIMACS Working Group on Genetics and Evolution of Pathogens, 25 Nov 3 Deaths
More informationLECTURE OUTLINE. B. AGENT: Varicella-zoster virus. Human herpes virus 3. DNA virus.
Viral Vaccines II LECTURE OUTLINE 5/24/04 I. CASE HISTORY A 5-year old comes home from school with a red skin rash on his chest that spreads to over 300 itchy blisters that spread further to his face,
More informationBiology 350: Microbial Diversity
Biology 350: Microbial Diversity Strange Invaders: Viruses, viroids, and prions. Lecture #27 7 November 2007-1- Notice handouts and announcements for today: Outline and study questions A 1999 paper discussing
More informationHS-LS4-4 Construct an explanation based on evidence for how natural selection leads to adaptation of populations.
Unit 2, Lesson 2: Teacher s Edition 1 Unit 2: Lesson 2 Influenza and HIV Lesson Questions: o What steps are involved in viral infection and replication? o Why are some kinds of influenza virus more deadly
More informationInfluenza: The past, the present, the (future) pandemic
Influenza: The past, the present, the (future) pandemic Kristin Butler, MLS (ASCP) cm Department of Clinical Laboratory Sciences Louisiana Health Sciences Center - Shreveport Fall 2017 Objectives 1) Detail
More informationNovember 9, 2009 Bioe 109 Fall 2009 Lecture 19 Evolution and human health. The evolution of flu viruses
November 9, 2009 Bioe 109 Fall 2009 Lecture 19 Evolution and human health The evolution of flu viruses - the potential harm of disease epidemics in human populations has received considerable attention
More informationUpdate on SIV activity - Australia and Asia-Pacific
Update on SIV activity - Australia and Asia-Pacific OFFLU Swine Influenza group technical meeting 27 March 2012, OIE Paris CSIRO Australian Animal Health Laboratory CSIRO ANIMAL, FOOD AND HEALTH SCIENCE
More informationPlanning for Pandemic Influenza
Planning for Pandemic Influenza John Kobayashi Faculty, Northwest Center for Public Health Practice, Foreign Advisor with the Field Epidemiology Training Program in Japan Pandemic Influenza as a Paradigm
More informationInfluenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics
Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics Eili Y. Klein, Ph.D. Assistant Professor, Department of Emergency Medicine & Fellow, Center for Disease
More informationChapter 19: The Genetics of Viruses and Bacteria
Chapter 19: The Genetics of Viruses and Bacteria What is Microbiology? Microbiology is the science that studies microorganisms = living things that are too small to be seen with the naked eye Microorganisms
More informationInfluenza. Paul K. S. Chan Department of Microbiology The Chinese University of Hong Kong
Influenza Paul K. S. Chan Department of Microbiology The Chinese University of Hong Kong Classification & Nomenclature Influenza virus A, B & C Influenza A : Haemagglutinin (H 1-16), neuraminidase (N1-9)
More informationEVOLUTION. Reading. Research in my Lab. Who am I? The Unifying Concept in Biology. Professor Carol Lee. On your Notecards please write the following:
Evolution 410 9/5/18 On your Notecards please write the following: EVOLUTION (1) Name (2) Year (3) Major (4) Courses taken in Biology (4) Career goals (5) Email address (6) Why am I taking this class?
More informationTSE M1 Semester 1 October 2018 Paul Seabright. Evolution of Economic Behavior Week 7: Natural, sexual and cultural selection
TSE M1 Semester 1 October 2018 Paul Seabright Evolution of Economic Behavior Week 7: Natural, sexual and cultural selection Natural, sexual and cultural selection: outline The basic features of natural
More informationOrigins and evolutionary genomics of the novel avian-origin H7N9 influenza A virus in China: Early findings
Origins and evolutionary genomics of the novel 2013 avian-origin H7N9 influenza A virus in : Early findings Jiankui He*, Luwen Ning, Yin Tong Department of Biology, South University of Science and Technology
More informationInfluenza viruses. Virion. Genome. Genes and proteins. Viruses and hosts. Diseases. Distinctive characteristics
Influenza viruses Virion Genome Genes and proteins Viruses and hosts Diseases Distinctive characteristics Virion Enveloped particles, quasi-spherical or filamentous Diameter 80-120 nm Envelope is derived
More informationAn automated global clade classification tool for H1 hemagglutinin genes from swine influenza A viruses
An automated global clade classification tool for H1 hemagglutinin genes from swine influenza A viruses Yun Zhang J. Craig Venter Institute June 25, 2017 Outline A web-based, automated H1 clade classification
More informationModeling the Effects of HIV on the Evolution of Diseases
1/20 the Evolution of Mentor: Nina Fefferman DIMACS REU July 14, 2011 2/20 Motivating Questions How does the presence of HIV in the body changes the evolution of pathogens in the human body? How do different
More informationEmerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice October 26, 2012
Emerging Diseases Biosciences in the 21 st Century Dr. Amber Rice October 26, 2012 Outline Disease emergence: a case study Introduction to phylogenetic trees Introduction to natural selection How do pathogens
More informationIntroduction to Avian Influenza
Introduction to Avian Influenza David L. Suarez D.V.M., Ph.D. Research Leader Exotic and Emerging Avian Viral Disease Research Unit Agricultural Research Service United States Department of Agriculture
More informationEVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS. R. Burke Squires
EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS R. Burke Squires Pandemic H1N1 2009 Origin? April / May 2009 Cases of an Influenza-like Illness (ILI) occurred in California, Texas and Mexico New
More informationInfluenza: The Threat of a Pandemic
April, 2009 Definitions Epidemic: An increase in disease above what you what would normally expect. Pandemic: A worldwide epidemic 2 What is Influenza? Also called Flu, it is a contagious respiratory illness
More informationNovel H1N1 Influenza. It s the flu after all! William Muth M.D. Samaritan Health Services 9 November 2009
Novel H1N1 Influenza It s the flu after all! William Muth M.D. Samaritan Health Services 9 November 2009 Influenza A Primer.. What is the flu? How do you get it? What s a virus anyhow? Can the flu be prevented,
More informationReassortment of influenza A virus genes linked to PB1 polymerase gene
International Congress Series 1263 (2004) 714 718 Reassortment of influenza A virus genes linked to PB1 polymerase gene Jean C. Downie* www.ics-elsevier.com Centre for Infectious Diseases and Microbiology,
More informationTITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important?
TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important? AUTHORS: Joshua G. Petrie 1, Adam S. Lauring 2,3 AFFILIATIONS: 1 Department of Epidemiology, University of
More informationAn Exploration to Determine if Fab Molecules are Efficacious in Neutralizing Influenza H1 and H3 Subtypes. Nick Poulton June September 2012
An Exploration to Determine if Fab Molecules are Efficacious in Neutralizing Influenza H1 and H3 Subtypes Nick Poulton June 2012- September 2012 Epidemiology of Influenza Infection Causes between 250,000
More informationINFLUENZA A VIRUS. Structure of the influenza A virus particle.
INFLUENZA INFLUENZA A VIRUS Structure of the influenza A virus particle. TYPE A VIRUS HAS TWO TYPES OF SPIKES, THE HEMAGGLUTININ (H) AND THE NEURAMINIDASE (N), PROTRUDING FROM THE VIRAL ENVELOPE THE HEMAGGLUTININ
More informationHost Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza
Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza The origin of H1N1pdm constitutes an unresolved mystery, as its most recently observed ancestors were isolated in pigs
More informationbs148h 6 September 2007 Read: Text pgs , ch 22 & 23
bs148h 6 September 2007 Read: Text pgs 436-437, ch 22 & 23 phenotypic variation selection within generations heritability across generations phenotypic response across generations partitioning variance:
More informationPandemic Influenza Preparedness
Pandemic Influenza Preparedness Of the many health threats that we are preparing for, this is the one that we know will happen. Bruce G. Gellin, MD, MPH Director, National Vaccine Program Office Department
More informationEbola Virus. Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017
Ebola Virus Emerging Diseases Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017 Outline Disease emergence: a case study How do pathogens shift hosts? Evolution within hosts: The evolution
More informationTodd Davis Influenza Division Centers for Disease Control and Prevention Atlanta, GA USA
OFFLU influenza virus meeting 27 28 March 2017 FAO Headquarters, Rome, Italy Todd Davis Influenza Division Centers for Disease Control and Prevention Atlanta, GA USA Strains of concerns Influenza A(H3N2)v
More informationMapping Evolutionary Pathways of HIV-1 Drug Resistance. Christopher Lee, UCLA Dept. of Chemistry & Biochemistry
Mapping Evolutionary Pathways of HIV-1 Drug Resistance Christopher Lee, UCLA Dept. of Chemistry & Biochemistry Stalemate: We React to them, They React to Us E.g. a virus attacks us, so we develop a drug,
More informationIncorporating virologic data into seasonal and pandemic influenza vaccines
Incorporating virologic data into seasonal and pandemic influenza vaccines Kanta Subbarao WHO Collaborating Centre for Reference and Research on Influenza & Department of Microbiology and Immunology, University
More informationLesson 20 Study Guide: Medical Biotechnology Pandemic Flu & Emergent Disease
URI CMB 190 Issues in Biotechnology Lesson 20 Study Guide: Medical Biotechnology Pandemic Flu & Emergent Disease 1. The film Contagion: (A) entirely depicts a situation that could never possibly happen
More informationOriginally published as:
Originally published as: Ratsch, B.A., Bock, C.-T. Viral evolution in chronic hepatitis B: A branched way to HBeAg seroconversion and disease progression? (2013) Gut, 62 (9), pp. 1242-1243. DOI: 10.1136/gutjnl-2012-303681
More informationUnit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS
1 Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS What steps are involved in viral infection and replication? Why are some kinds of influenza virus more deadly than others? How do flu
More informationWhat is Influenza? Patricia Daly MD, FRCPC Medical Health Officer and Medical Director of Communicable Disease Control
Vancouver Coastal Health & The Vancouver Coastal Health Research Institute presents: On Call with VGH Experts Lecture Series The Flu and You What is Influenza? Patricia Daly MD, FRCPC Medical Health Officer
More informationChinese Influenza Weekly Report
National Institute for Viral Disease Control and Prevention, China CDC Chinese Weekly Report (All data are preliminary and may change as more reports are received) Summary During week 17, influenza activity
More informationPandemic H1N Dr. Maria Neira Global Influenza Programme WHO, Geneva
Pandemic H1N1 2010 Dr. Maria Neira Global Influenza Programme WHO, Geneva WHO Role during pandemic (H1N1) 2009 Under the International Health Regulations (2005) Detect event (notification by Member States
More informationDevelopment of safe and immunogenic reassortant viruses with 5:3 genotype for live attenuated influenza vaccine
Development of safe and immunogenic reassortant viruses with 5:3 genotype for live attenuated influenza vaccine Irina Isakova-Sivak, PhD Institute of Experimental Medicine, Saint Petersburg, Russia The
More informationThe selfish gene. mitochondrium
The selfish gene selection acts mostly for the benefit of the individual sometimes selection may act for the benefit of relatives rarely, selection acts for the benefit of the group mitochondrium in asexual
More informationINFLUENZA WEEKLY UPDATE
INFLUENZA WEEKLY UPDATE 29/28: 6-12 July 29 The national influenza surveillance system in New Zealand is an essential public health component for assessing and implementing strategies to control influenza.
More informationWHO Response to Influenza A (H1N1) CAPSCA December, 2011 Dr. Nasr Eltantawy Medical epidemiologist WHO/Egypt
WHO Response to Influenza A (H1N1) 2009 CAPSCA 11-14 December, 2011 Dr. Nasr Eltantawy Medical epidemiologist WHO/Egypt Outline Background. Preparedness planning. Evolution of the pandemic. WHO and other
More informationIn April 2009, a new strain of
managing and reducing Uncertainty in an Emerging Influenza Pandemic 2. Brundage JF, Shanks GD. Deaths from bacterial pneumonia during 1918 19 influenza pandemic. Emerg Infect Dis 2008;14:1193-9. 3. Update:
More informationGrade Level: Grades 9-12 Estimated Time Allotment Part 1: One 50- minute class period Part 2: One 50- minute class period
The History of Vaccines Lesson Plan: Viruses and Evolution Overview and Purpose: The purpose of this lesson is to prepare students for exploring the biological basis of vaccines. Students will explore
More informationInfluenza A virus subtype H5N1
Influenza A virus subtype H5N1 Influenza A virus subtype H5N1, also known as A(H5N1) or simply H5N1, is a subtype of the Influenza A virus which can cause illness in humans and many other animal species.
More informationMapping evolutionary pathways of HIV-1 drug resistance using conditional selection pressure. Christopher Lee, UCLA
Mapping evolutionary pathways of HIV-1 drug resistance using conditional selection pressure Christopher Lee, UCLA HIV-1 Protease and RT: anti-retroviral drug targets protease RT Protease: responsible for
More informationEmerging Infections: Pandemic Influenza. W. Paul Glezen
Emerging Infections: Pandemic Influenza W. Paul Glezen Challenges The trends of modern society tend to facilitate spread and increase morbidity Travel, urbanization morbidity vs. mortality The cost of
More informationStrategies for containing an emerging influenza pandemic in South East Asia 1
Strategies for containing an emerging influenza pandemic in South East Asia 1 Modeling pandemic spread and possible control plans of avian flu H5N1 BBSI, Nicole Kennerly, Shlomo Ta asan 1 Nature. 2005
More informationWhere Health Care Meets Policy. with Dr. Mike Magee
Where Health Care Meets Policy with Dr. Mike Magee The Threat of Bird Flu Understanding Bird Flu and the Influenza Virus 3 types of the influenza virus: A, B and C reflect differences in the M protein
More informationRalph KY Lee Honorary Secretary HKIOEH
HKIOEH Round Table: Updates on Human Swine Influenza Facts and Strategies on Disease Control & Prevention in Occupational Hygiene Perspectives 9 July 2009 Ralph KY Lee Honorary Secretary HKIOEH 1 Influenza
More informationUpdate on Swine Influenza Virus Surveillance in Vietnam
Update on Swine Influenza Virus Surveillance in Vietnam OFFLU SIV Group technical meeting, 3 4 Dec 2015 OIE Headquarters, Paris Tung Nguyen, DAH-Vietnam Swine Influenza surveillance activities in Vietnam
More informationPreparing for the Fall Flu Season. Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP
Preparing for the Fall Flu Season Laboratory Perspective Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP September 21, 2009 Objectives 1. Review the emergence of Novel Influenza A
More informationPrepare to Care Pandemic Planning at Fraser Health
Prepare to Care Pandemic Planning at Fraser Health Pandemic Influenza Planning December 10, 2009 Facilitator: Lisa Zetes-Zanatta 7 Prepare to Care: Introductions FHA Pandemic Lady Lisa Zetes-Zanatta Roundtable
More informationVIROLOGY OF INFLUENZA. Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks
INFLUENZA VIROLOGY OF INFLUENZA Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks PATHOGENICITY High pathogenicity avian influenza (HPAI) Causes severe disease in poultry
More informationFeasibility of Production of Human AI Vaccine in AI vaccine Manufacturers in China. Gu Hong Ministry of Agriculture of P. R. China
Feasibility of Production of Human AI Vaccine in AI vaccine Manufacturers in China Gu Hong Ministry of Agriculture of P. R. China AI -- common challenge to the all countries Global cooperation in control
More informationHIV Drug Resistance. Together, we can change the course of the HIV epidemic one woman at a time.
HIV Drug Resistance Together, we can change the course of the HIV epidemic one woman at a time. #onewomanatatime #thewellproject What Is Resistance? HIV drugs are designed to keep the amount of HIV virus
More informationThe Dynamics of HIV-1 Adaptation in Early Infection
Genetics: Published Articles Ahead of Print, published on December 29, 2011 as 10.1534/genetics.111.136366 The Dynamics of HIV-1 Adaptation in Early Infection Jack da Silva School of Molecular and Biomedical
More informationLecture 11. Immunology and disease: parasite antigenic diversity
Lecture 11 Immunology and disease: parasite antigenic diversity RNAi interference video and tutorial (you are responsible for this material, so check it out.) http://www.pbs.org/wgbh/nova/sciencenow/3210/02.html
More informationBioinformation Volume 5
Identification of sequence mutations affecting hemagglutinin specificity to sialic acid receptor in influenza A virus subtypes Usman Sumo Friend Tambunan*, Ramdhan Department of Chemistry, Faculty of Mathematics
More informationThe Evolution of Sex. Or, why do we even need males?
The Evolution of Sex Or, why do we even need males? Sexual VS Asexual reproduction Sexual Fewer offspring/individual Only half of genes passed on Good genotypes are lost Offspring are variable Asexual
More informationClinical Trials of Pandemic Vaccines: Key Issues. John Treanor University of Rochester Rochester, NY
Clinical Trials of Pandemic Vaccines: Key Issues John Treanor University of Rochester Rochester, NY Inactivated vaccine approach Proven technology Used successfully in 1957 and 1968 Abundant efficacy data
More informationA new look at an old virus: patterns of mutation accumulation in the human H1N1 influenza virus since 1918
Carter and Sanford Theoretical Biology and Medical Modelling 2012, 9:42 RESEARCH Open Access A new look at an old virus: patterns of mutation accumulation in the human H1N1 influenza virus since 1918 Robert
More informationCurrent CEIRS Program
History The influenza program at St. Jude has a long, distinguished history as a world-class leader in the study of the origins, evolution, and pathogenesis of influenza viruses. Based on this expertise,
More informationIn the mid-20th century the structure of DNA was discovered. What is a section of DNA which codes for one specific protein called?
Q1.Our understanding of genetics and inheritance has improved due to the work of many scientists. (a) Draw one line from each scientist to the description of their significant work. Scientist Description
More informationChinese Influenza Weekly Report
Chinese Influenza Weekly Report (All data are preliminary and may change as more reports are received) Summary During week 13, influenza activity was still a little high in mainland China, and it was increasing
More informationInfluenza Updates Reflection on 2017: thank you and happy holidays
Influenza Updates The newsletter of the WHO Collaborating Centre for Reference and Research on Influenza in Melbourne Volume 6, Issue 3, November 2017 Reflection on 2017: thank you and happy holidays As
More information4/28/2013. The Ever-Evolving Flu p The 1918 Flu p. 617
The Ever-Evolving Flu p. 615 1. Influenza (Fig 18.10) rapidly evolves each year, and processes such as reassortment give rise to new genotypes. 2. Flu virus evolves rapidly to evade our immune system (Fig
More informationInfluenza A Virus PB1-F2 Gene in Recent Taiwanese Isolates
Influenza A Virus PB1-F2 Gene in Recent Taiwanese Isolates Guang-Wu Chen,* Ching-Chun Yang, Kuo-Chien Tsao, Chung-Guei Huang, Li-Ang Lee, Wen-Zhi Yang, Ya-Ling Huang, Tzou-Yien Lin, and Shin-Ru Shih Influenza
More informationWHO biosafety risk assessment and guidelines for the production and quality control of human influenza pandemic vaccines: Update
WHO biosafety risk assessment and guidelines for the production and quality control of human influenza pandemic vaccines: Update 23 July 2009 Introduction This document updates guidance 1 from the World
More informationGlobal Pandemic Preparedness Research Efforts. Klaus Stöhr. WHO Global Influenza Programme. Today
Global Pandemic Preparedness Research Efforts Klaus Stöhr 3 Today Medium-term applied research linked to medical and public health interventions addressing the current pandemic situation in Asia Natural
More informationReceived 21 December 2010/Returned for modification 4 February 2011/Accepted 29 March 2011
JOURNAL OF CLINICAL MICROBIOLOGY, June 2011, p. 2216 2221 Vol. 49, No. 6 0095-1137/11/$12.00 doi:10.1128/jcm.02567-10 Copyright 2011, American Society for Microbiology. All Rights Reserved. Rapid Differentiation
More informationELIMINATION OF MUTANT TYPES IN SELECTION EXPERIMENT BETWEEN WILD TYPE AND MUTANT EYE COLOUR IN DROSOPHILA ANANASSAE
73 Journal of Scientific Research Banaras Hindu University, Varanasi Vol. 56, 2012 : 73-79 ISSN : 0447-9483 ELIMINATION OF MUTANT TYPES IN SELECTION EXPERIMENT BETWEEN WILD TYPE AND MUTANT EYE COLOUR IN
More informationIncidence of Seasonal Influenza
What Is All the Fuss? A Just-in in-time Primer on H1N1 Influenza A and Pandemic Influenza provided by the National Association of State EMS Officials May 1, 2009 Disclaimer This self-learning learning
More informationAvian influenza Avian influenza ("bird flu") and the significance of its transmission to humans
15 January 2004 Avian influenza Avian influenza ("bird flu") and the significance of its transmission to humans The disease in birds: impact and control measures Avian influenza is an infectious disease
More informationabcdefghijklmnopqrstu
abcdefghijklmnopqrstu Swine Flu UK Planning Assumptions Issued 3 September 2009 Planning Assumptions for the current A(H1N1) Influenza Pandemic 3 September 2009 Purpose These planning assumptions relate
More information