Sex, viruses, and the statistical physics of evolution

Size: px
Start display at page:

Download "Sex, viruses, and the statistical physics of evolution"

Transcription

1 Sex, viruses, and the statistical physics of evolution

2 Cartoon of Evolution A TC G Selection Genotypes Mutation & Recombination Mutation...ATACG... Sex & Recombination Selection...ATGCG... Richard Neher 2

3 Tree of Life - billions of years source: tree of life, tolweb.org 4 billion years Richard Neher 3

4 Phylogenetic tree of Fruitflies - millions of years ~40 Millions of years image from: insects.eugenes.org/species/ Richard Neher 4

5 Evolution of Influenza A - few years PB2 Influenza A global epidemic aa # aa # aa # A/Weiss/43 A/AA/Huston/1945 A/AA/Marton/1943 A/Iowa/1943 A 3 aa 98 # aa #5 A/Bel/42 A/Alaska/1935 A/PR/8/34 A/Henry/1936 A/Phila/1935 A/Melbourne/35 A/WSN/1933 A/Brevig Mission/1/ A/Chile/1/83 A/Memphis/39/1983 A/Christs Hospital/157/1982 A/Memphis/1/1984 A/Tonga/14/1984 A/New Zealand/7/1983 A/India/6263/1980 A/Memphis/7/1980 A/Baylor/4052/1981 A/Brazil/11/1978 A/Hong Kong/117/77 A/Lackland/3/1978 A/Memphis/10/1978 A/USSR/90/1977 A/Arizona/14/1978 A/Tientsin/78/1977 A/Roma/1949 A/Albany/4835/1948 A/Albany/4836/1950 A/Albany/12/1951 A/Denver/57 A/Fort Worth/50 A/Malaysia/54 A/FORT MONMOUTH/1/47 A/Cam/46 A/Hickox/1940 B I C aa #7 100 D A/Texas/36/91 F A/Memphis/12/1986 A/Memphis/3/1987 A/New York/2924-1/1986 A/Taiwan/01/1986 A/Texas/2922-3/1986 A/Singapore/6/1986 A/Baylor/11515/82 V E II 1 aa # III IV 100 A/Canterbury/01/2001 A/Canterbury/106/2004 A/Memphis/5/2003 A/New York/8/ A/Otago/5/2005 J A/New York/223/2003 A/New York/291/2002 A/Wellington/1/2001 A/Memphis/1/2001 A/New York/239/2001 A/New Caledonia/20/1999 A/New South Wales/24/1999 A/TW/4845/99 A/New York/233/2000 A/Hong Kong/470/97 A/TW/3355/97 A/Nanchang/13/1996 A/Charlottesville/31/95 A/Memphis/6/1996 A/New York/653/1996 A/TW/130/96 A/New York/694/1995 G A/Hong Kong/427/98 A/South A/New Australia/44/2000 York/146/ H VI I IX VIII Evolution as cause of epidemics Nelson et al., 2008 Richard Neher 5

6 Human immunodeficiency virus (HIV) 100nm HIV budding from an immune cell Rapid evolution is a hallmark of HIV infections Richard Neher 6

7 HIV Richard Neher 7

8 HIV Virus escapes the immune system by continuous evolution Richard Neher 7

9 Evolution in a single patient (blood samples every 6 month) ~ 8% divergence in 10 years == many millions of years in Drosophila Time (years since seroconversion) Lemey et al., 2006, Shankarappa et al Richard Neher 8

10 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Richard Neher 9

11 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site Richard Neher 9

12 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site Large population: N=10 10 viruses Richard Neher 9

13 Evolution of HIV The virus has to change: Escape the immune system and drug resistance Resistance to drugs (protease inhibitors): Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF High mutation rate: μ=3x10-5 /generation and site human immune cell Large population: N=10 10 viruses Viral sex Richard Neher 9

14 Recombination in viruses - Influenza 100nm 11 genes on 8 segments 16 H (hemagglutinin) subtypes 9 N (neuraminidase) subtypes H1N1, H2N2, H3N2, H5N1 are common Richard Neher 10

15 Recombination in viruses - Influenza 100nm 11 genes on 8 segments 16 H (hemagglutinin) subtypes 9 N (neuraminidase) subtypes H1N1, H2N2, H3N2, H5N1 are common Pandemics often follow reassortments, e.g. pandemics 1957 (H2N2) and 1968 (H3N2) Reassortment is frequent in waterfowl and swine, where many subtypes circulate. Richard Neher 10

16 Population Spreading of beneficial mutations Mutant individuals reproduce faster (Drug resistant strain) Time Fixation probability: ~s Sweep time: ~ ln(ns) / s Richard Neher 11

17 Evolution in asexual and sexual organisms Small Population Time Sequential innovations: rate ~ N Richard Neher 12

18 Evolution in asexual and sexual organisms Small Population Large Population Time Sequential innovations: rate ~ N Many concurrent mutations: rate ~ log N Most good mutations are wasted! Time Richard Neher 12

19 Evolution in asexual and sexual organisms Small Population E V O L U T I O N IN S E X U A L A N D A S E X U A L POPUL.AT1ONS Time POPULATION E V O L U T I O N IN S E X U A L A N D A S E X U A L POPUL.AT1ONS SMALL Large Population Sequential innovations: rate ~ N Many concurrent mutations: a n d rate ~ log N FIGURE 1. Evolution i n s e x u a l and a s e x u a l populations. The hatched shaded a r e a s show the i n c r e a s e d number of mutant individuals following t h e occurrence of a favorable mutation. T h e a b s c i s s a I s time. Modified from Muller (1932). Most good mutations are wasted! s i s small, and therefore that p changes very slowly s o t h a t i t i s appropriate to replace addition by integration. T h i s l e a d s to LARGE POPULATION LARGE POPULATION Time In the a b s e n c e of recombination, p follows the logistic curve Conventional wisdom: rate ~ N RA Fisher (1930), H Muller (1932), M Kimura and J Crow (1965) Time Richard Neher 12

20 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations Resistance mutations Richard Neher 13

21 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations Drug resistance increases due to selection on existing mutations Resistance mutations Richard Neher 13

22 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations novel mutation Drug resistance increases due to selection on existing mutations Novel mutations keep the wave going Resistance mutations Richard Neher 13

23 Quantifying the benefits of recombination [for the virus] Example: drug resistance of HIV Drug sensitive: PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF Drug resistant: PQITLWQRPLVTIKVGGQLTEALLDTGADDTILEDMTLPGRWKPKIVGGIGGFIKVRQYDQVPIEICGHKVISTVLIGPTPCNIIGRNLMTQIGLTLNF Hypothetical distribution of drug resistance mutations novel mutation recombination Drug resistance increases due to selection on existing mutations Novel mutations keep the wave going Resistance mutations Via recombination mutations can keep up with the wave and make it Richard Neher 13

24 Surfing of beneficial mutations ! Richard Neher 14

25 Surfing of beneficial mutations ! Richard Neher 14

26 Evolutionary benefits of recombination Conventional wisdom: rate of evolution ~ N holds only for very frequent recombination Realistic recombination: rate of evolution ~ r 2 log N To slow down evolution, one has to target recombination rather than the population size!! Richard Neher 15

27 The more recombination, the better? Is there a cost to recombination? Richard Neher 16

28 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17

29 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17

30 Genetic interactions So far: Fitness = # beneficial mutations BUT: An organism is more than the sum of its parts Richard Neher 17

31 The cost of recombination A recombined soccer team is worse than the parents. Richard Neher 18

32 The cost of recombination A recombined soccer team is worse than the parents. Relay racing teams don t have that problem! Richard Neher 18

33 Genetic interaction and recombination Different reassortments of Influenza A: Recombination explores -- selection amplifies the best Richard Neher 19

34 Genetic interaction and recombination Different reassortments of Influenza A: Recombination explores -- selection amplifies the best no recombination moderate recombination frequent recombination Richard Neher 19

35 Allele vs genotype selection Strength of Interaction Rel. epistasis Genotype selection Clonal Competition (CC) Quasi Linkage Equilibrium (QLE) Allele selection Recombination rate/selection Mating freq./selection Richard Neher 20

36 The success of selection 0.4 Selection on the properties of the parts. All Stars team F final 0.3 Selection on the combinations the best clubs recombination Richard Neher 21

37 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Richard Neher 22

38 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Do such observations, together with theoretical insight, explain the differences between drugs and patients? Richard Neher 22

39 Connecting theory and observations Large data bases of HIV sequences and drug resistance allow us to study: The recombination rate in HIV Selection strength of HIV evolution without drugs Drug resistance mutations: team players or independent? Does recombination vary from patient to patient? Does it vary at different stages of the disease? With modern sequencing technology we can soon monitor viral populations at unprecedented resolution. Do such observations, together with theoretical insight, explain the differences between drugs and patients? What can we learn about the evolutionary process in general? Richard Neher 22

40 Sequencing Costs per Base Cost per base [$] 10!1 10!2 10!3 10!4 Data Exponential decay:! = 2.5 years 10! year Richard Neher 23

41 Experiment & Theory Darwin s Theory Observations: Paleontology Diversity of species Richard Neher 24

42 Experiment & Theory Darwin s Theory Quantitative Theory Dynamics Experiments in the Lab Bacteria or viruses Sequencing and Phenotyping Observations: Paleontology Diversity of species Richard Neher 24

43 Collaborators Boris Shraiman, KITP Daniel Fisher, Stanford Thomas Leitner, LANL Richard Neher 25

Identification of novel influenza A viruses in Australian swine

Identification of novel influenza A viruses in Australian swine Identification of novel influenza A viruses in Australian swine OFFLU SIV Group Annual Meeting, Rome, 16-17 April 2013 Frank Wong 1, Ian Barr 2, David Smith 3, David Williams 1, Kelly Davies 1, Vicky Stevens

More information

The Influenza A (H1N1

The Influenza A (H1N1 The Influenza A (H1N1 Human Swine) Pandemic North America (A/Mexico/ /2009 [H1N1]), Influenza A virus, April 2009: - H1N1 & H3N2 viruses are endemic among pig populations in many countries - Reassortment

More information

Evolution of influenza

Evolution of influenza Evolution of influenza Today: 1. Global health impact of flu - why should we care? 2. - what are the components of the virus and how do they change? 3. Where does influenza come from? - are there animal

More information

Lecture 19 Evolution and human health

Lecture 19 Evolution and human health Lecture 19 Evolution and human health The evolution of flu viruses The evolution of flu viruses Google Flu Trends data US data Check out: http://www.google.org/flutrends/ The evolution of flu viruses the

More information

Nature Immunology: doi: /ni Supplementary Figure 1. Infection strategy.

Nature Immunology: doi: /ni Supplementary Figure 1. Infection strategy. Supplementary Figure 1 Infection strategy. To test the antibody responses against influenza viruses, animals were sequentially infected with two divergent strains of the same subtype. For H1N1 infections,

More information

The "Flu" a case of low fever and sniffles that keeps you home in bed for a day a gastrointestinal upset ("stomach flu")

The Flu a case of low fever and sniffles that keeps you home in bed for a day a gastrointestinal upset (stomach flu) The "Flu" Influenza is a viral infection of the lungs characterized by fever, cough, and severe muscle aches. In the elderly and infirm, it is a major cause of disability and death (often as a result of

More information

Before and during influenza pandemics

Before and during influenza pandemics before and during influenza pandemics Klaus Stöhr Department for Communicable Diseases Surveillance and Response Before and during influenza pandemics Before pandemics: interpandemic period New human influenza

More information

Mapping the Antigenic and Genetic Evolution of Influenza Virus

Mapping the Antigenic and Genetic Evolution of Influenza Virus Mapping the Antigenic and Genetic Evolution of Influenza Virus Derek J. Smith, Alan S. Lapedes, Jan C. de Jong, Theo M. Bestebroer, Guus F. Rimmelzwaan, Albert D. M. E. Osterhaus, Ron A. M. Fouchier Science

More information

SEX. Genetic Variation: The genetic substrate for natural selection. Sex: Sources of Genotypic Variation. Genetic Variation

SEX. Genetic Variation: The genetic substrate for natural selection. Sex: Sources of Genotypic Variation. Genetic Variation Genetic Variation: The genetic substrate for natural selection Sex: Sources of Genotypic Variation Dr. Carol E. Lee, University of Wisconsin Genetic Variation If there is no genetic variation, neither

More information

Modeling the Antigenic Evolution of Influenza Viruses from Sequences

Modeling the Antigenic Evolution of Influenza Viruses from Sequences Modeling the Antigenic Evolution of Influenza Viruses from Sequences Taijiao Jiang Center of Systems Medicine, Chinese Academy of Medical Sciences Suzhou Institute of Systems Medicine October 8-10, 2015.

More information

Influenza surveillance and pandemic preparedness - a global challenge Anne Kelso

Influenza surveillance and pandemic preparedness - a global challenge Anne Kelso Influenza surveillance and pandemic preparedness - a global challenge Anne Kelso WHO Collaborating Centre for Reference and Research on Influenza Melbourne, Australia Three global health challenges 243

More information

J. A. Sands, 21 October 2013 Lehigh University

J. A. Sands, 21 October 2013 Lehigh University J. A. Sands, 21 October 2013 Lehigh University Cryptococcus, Candidiasis, Aspergillosis Tuberculosis Cholera Plague Bact. Meningitis Salmonella Listeria Leptospirosis Staph. (MRSA) E. coli Clostridium

More information

Lecture 18 Evolution and human health

Lecture 18 Evolution and human health Lecture 18 Evolution and human health Evolution and human health 1. Genetic factors 2. Infectious diseases Evolution and human health 1. Genetic factors Evolution and human health 1. Genetic factors P

More information

An epitope of limited variability as a novel influenza vaccine target

An epitope of limited variability as a novel influenza vaccine target An epitope of limited variability as a novel influenza vaccine target Craig P Thompson 1,2*, José Lourenço 1, Adam A Walters 2, Uri Obolski 1, Matthew Edmans 1,2, Duncan S Palmer 1, Kreepa Kooblall 3,

More information

Current Vaccines: Progress & Challenges. Influenza Vaccine what are the challenges?

Current Vaccines: Progress & Challenges. Influenza Vaccine what are the challenges? Current Vaccines: Progress & Challenges Influenza Vaccine what are the challenges? Professor John S. Tam The Hong Kong Polytechnic University Asia-Pacific Alliance for the Control of Influenza (APACI)

More information

Phylogenetic Methods

Phylogenetic Methods Phylogenetic Methods Multiple Sequence lignment Pairwise distance matrix lustering algorithms: NJ, UPM - guide trees Phylogenetic trees Nucleotide vs. amino acid sequences for phylogenies ) Nucleotides:

More information

Existence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan

Existence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan International Congress Series 1263 (2004) 749 753 Existence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan Shin ichi Shimada a, *, Takayasu Ohtsuka b, Masayuki Tanaka b, Munehito

More information

Pandemic Influenza influenza epidemic: realization of a worst-case scenario

Pandemic Influenza influenza epidemic: realization of a worst-case scenario Pandemic Influenza October 9, 2006 1918 influenza epidemic: realization of a worst-case scenario First case: Albert Mitchell, Camp Funston, KS, March 11, 1918 Up to 20% of all humans infected 20-50 million

More information

Building complexity Unit 04 Population Dynamics

Building complexity Unit 04 Population Dynamics Building complexity Unit 04 Population Dynamics HIV and humans From a single cell to a population Single Cells Population of viruses Population of humans Single Cells How matter flows from cells through

More information

Predicting the future

Predicting the future Swine influenza A viruses: a more global picture Predicting the future Dr Nicola S. Lewis BSc BVetMed PhD MRCVS Dr Nicola S. Lewis BSc BVetMed PhD MRCVS Centre for for Pathogen Evolution and WHO Collaborating

More information

INFLUENZA EVOLUTION: Challenges for diagnosis

INFLUENZA EVOLUTION: Challenges for diagnosis INFLUENZA EVOLUTION: Challenges for diagnosis Jairo A. Méndez-Rico Influenza Team PAHO/WHO, Washington, DC Overview Every year, influenza infects up to one in five people around the world, and causes up

More information

NASDAQ:NVAX Novavax, Inc. All rights reserved.

NASDAQ:NVAX Novavax, Inc. All rights reserved. Novavax vaccine induced improved immune responses against homologous and drifted A(H3N2) viruses in older adults compared to egg-based, high-dose, influenza vaccine World Vaccine Congress April 4, 2018

More information

A secret about creationism

A secret about creationism A secret about creationism Even among ardent creationists, most believe in evolution Why? Natural selection is a provable biological process. Selection causes evolution critical in medicine, agriculture

More information

An Evolutionary Story about HIV

An Evolutionary Story about HIV An Evolutionary Story about HIV Charles Goodnight University of Vermont Based on Freeman and Herron Evolutionary Analysis The Aids Epidemic HIV has infected 60 million people. 1/3 have died so far Worst

More information

Patterns of hemagglutinin evolution and the epidemiology of influenza

Patterns of hemagglutinin evolution and the epidemiology of influenza 2 8 US Annual Mortality Rate All causes Infectious Disease Patterns of hemagglutinin evolution and the epidemiology of influenza DIMACS Working Group on Genetics and Evolution of Pathogens, 25 Nov 3 Deaths

More information

LECTURE OUTLINE. B. AGENT: Varicella-zoster virus. Human herpes virus 3. DNA virus.

LECTURE OUTLINE. B. AGENT: Varicella-zoster virus. Human herpes virus 3. DNA virus. Viral Vaccines II LECTURE OUTLINE 5/24/04 I. CASE HISTORY A 5-year old comes home from school with a red skin rash on his chest that spreads to over 300 itchy blisters that spread further to his face,

More information

Biology 350: Microbial Diversity

Biology 350: Microbial Diversity Biology 350: Microbial Diversity Strange Invaders: Viruses, viroids, and prions. Lecture #27 7 November 2007-1- Notice handouts and announcements for today: Outline and study questions A 1999 paper discussing

More information

HS-LS4-4 Construct an explanation based on evidence for how natural selection leads to adaptation of populations.

HS-LS4-4 Construct an explanation based on evidence for how natural selection leads to adaptation of populations. Unit 2, Lesson 2: Teacher s Edition 1 Unit 2: Lesson 2 Influenza and HIV Lesson Questions: o What steps are involved in viral infection and replication? o Why are some kinds of influenza virus more deadly

More information

Influenza: The past, the present, the (future) pandemic

Influenza: The past, the present, the (future) pandemic Influenza: The past, the present, the (future) pandemic Kristin Butler, MLS (ASCP) cm Department of Clinical Laboratory Sciences Louisiana Health Sciences Center - Shreveport Fall 2017 Objectives 1) Detail

More information

November 9, 2009 Bioe 109 Fall 2009 Lecture 19 Evolution and human health. The evolution of flu viruses

November 9, 2009 Bioe 109 Fall 2009 Lecture 19 Evolution and human health. The evolution of flu viruses November 9, 2009 Bioe 109 Fall 2009 Lecture 19 Evolution and human health The evolution of flu viruses - the potential harm of disease epidemics in human populations has received considerable attention

More information

Update on SIV activity - Australia and Asia-Pacific

Update on SIV activity - Australia and Asia-Pacific Update on SIV activity - Australia and Asia-Pacific OFFLU Swine Influenza group technical meeting 27 March 2012, OIE Paris CSIRO Australian Animal Health Laboratory CSIRO ANIMAL, FOOD AND HEALTH SCIENCE

More information

Planning for Pandemic Influenza

Planning for Pandemic Influenza Planning for Pandemic Influenza John Kobayashi Faculty, Northwest Center for Public Health Practice, Foreign Advisor with the Field Epidemiology Training Program in Japan Pandemic Influenza as a Paradigm

More information

Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics

Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics Eili Y. Klein, Ph.D. Assistant Professor, Department of Emergency Medicine & Fellow, Center for Disease

More information

Chapter 19: The Genetics of Viruses and Bacteria

Chapter 19: The Genetics of Viruses and Bacteria Chapter 19: The Genetics of Viruses and Bacteria What is Microbiology? Microbiology is the science that studies microorganisms = living things that are too small to be seen with the naked eye Microorganisms

More information

Influenza. Paul K. S. Chan Department of Microbiology The Chinese University of Hong Kong

Influenza. Paul K. S. Chan Department of Microbiology The Chinese University of Hong Kong Influenza Paul K. S. Chan Department of Microbiology The Chinese University of Hong Kong Classification & Nomenclature Influenza virus A, B & C Influenza A : Haemagglutinin (H 1-16), neuraminidase (N1-9)

More information

EVOLUTION. Reading. Research in my Lab. Who am I? The Unifying Concept in Biology. Professor Carol Lee. On your Notecards please write the following:

EVOLUTION. Reading. Research in my Lab. Who am I? The Unifying Concept in Biology. Professor Carol Lee. On your Notecards please write the following: Evolution 410 9/5/18 On your Notecards please write the following: EVOLUTION (1) Name (2) Year (3) Major (4) Courses taken in Biology (4) Career goals (5) Email address (6) Why am I taking this class?

More information

TSE M1 Semester 1 October 2018 Paul Seabright. Evolution of Economic Behavior Week 7: Natural, sexual and cultural selection

TSE M1 Semester 1 October 2018 Paul Seabright. Evolution of Economic Behavior Week 7: Natural, sexual and cultural selection TSE M1 Semester 1 October 2018 Paul Seabright Evolution of Economic Behavior Week 7: Natural, sexual and cultural selection Natural, sexual and cultural selection: outline The basic features of natural

More information

Origins and evolutionary genomics of the novel avian-origin H7N9 influenza A virus in China: Early findings

Origins and evolutionary genomics of the novel avian-origin H7N9 influenza A virus in China: Early findings Origins and evolutionary genomics of the novel 2013 avian-origin H7N9 influenza A virus in : Early findings Jiankui He*, Luwen Ning, Yin Tong Department of Biology, South University of Science and Technology

More information

Influenza viruses. Virion. Genome. Genes and proteins. Viruses and hosts. Diseases. Distinctive characteristics

Influenza viruses. Virion. Genome. Genes and proteins. Viruses and hosts. Diseases. Distinctive characteristics Influenza viruses Virion Genome Genes and proteins Viruses and hosts Diseases Distinctive characteristics Virion Enveloped particles, quasi-spherical or filamentous Diameter 80-120 nm Envelope is derived

More information

An automated global clade classification tool for H1 hemagglutinin genes from swine influenza A viruses

An automated global clade classification tool for H1 hemagglutinin genes from swine influenza A viruses An automated global clade classification tool for H1 hemagglutinin genes from swine influenza A viruses Yun Zhang J. Craig Venter Institute June 25, 2017 Outline A web-based, automated H1 clade classification

More information

Modeling the Effects of HIV on the Evolution of Diseases

Modeling the Effects of HIV on the Evolution of Diseases 1/20 the Evolution of Mentor: Nina Fefferman DIMACS REU July 14, 2011 2/20 Motivating Questions How does the presence of HIV in the body changes the evolution of pathogens in the human body? How do different

More information

Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice October 26, 2012

Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice October 26, 2012 Emerging Diseases Biosciences in the 21 st Century Dr. Amber Rice October 26, 2012 Outline Disease emergence: a case study Introduction to phylogenetic trees Introduction to natural selection How do pathogens

More information

Introduction to Avian Influenza

Introduction to Avian Influenza Introduction to Avian Influenza David L. Suarez D.V.M., Ph.D. Research Leader Exotic and Emerging Avian Viral Disease Research Unit Agricultural Research Service United States Department of Agriculture

More information

EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS. R. Burke Squires

EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS. R. Burke Squires EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS R. Burke Squires Pandemic H1N1 2009 Origin? April / May 2009 Cases of an Influenza-like Illness (ILI) occurred in California, Texas and Mexico New

More information

Influenza: The Threat of a Pandemic

Influenza: The Threat of a Pandemic April, 2009 Definitions Epidemic: An increase in disease above what you what would normally expect. Pandemic: A worldwide epidemic 2 What is Influenza? Also called Flu, it is a contagious respiratory illness

More information

Novel H1N1 Influenza. It s the flu after all! William Muth M.D. Samaritan Health Services 9 November 2009

Novel H1N1 Influenza. It s the flu after all! William Muth M.D. Samaritan Health Services 9 November 2009 Novel H1N1 Influenza It s the flu after all! William Muth M.D. Samaritan Health Services 9 November 2009 Influenza A Primer.. What is the flu? How do you get it? What s a virus anyhow? Can the flu be prevented,

More information

Reassortment of influenza A virus genes linked to PB1 polymerase gene

Reassortment of influenza A virus genes linked to PB1 polymerase gene International Congress Series 1263 (2004) 714 718 Reassortment of influenza A virus genes linked to PB1 polymerase gene Jean C. Downie* www.ics-elsevier.com Centre for Infectious Diseases and Microbiology,

More information

TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important?

TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important? TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important? AUTHORS: Joshua G. Petrie 1, Adam S. Lauring 2,3 AFFILIATIONS: 1 Department of Epidemiology, University of

More information

An Exploration to Determine if Fab Molecules are Efficacious in Neutralizing Influenza H1 and H3 Subtypes. Nick Poulton June September 2012

An Exploration to Determine if Fab Molecules are Efficacious in Neutralizing Influenza H1 and H3 Subtypes. Nick Poulton June September 2012 An Exploration to Determine if Fab Molecules are Efficacious in Neutralizing Influenza H1 and H3 Subtypes Nick Poulton June 2012- September 2012 Epidemiology of Influenza Infection Causes between 250,000

More information

INFLUENZA A VIRUS. Structure of the influenza A virus particle.

INFLUENZA A VIRUS. Structure of the influenza A virus particle. INFLUENZA INFLUENZA A VIRUS Structure of the influenza A virus particle. TYPE A VIRUS HAS TWO TYPES OF SPIKES, THE HEMAGGLUTININ (H) AND THE NEURAMINIDASE (N), PROTRUDING FROM THE VIRAL ENVELOPE THE HEMAGGLUTININ

More information

Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza

Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza The origin of H1N1pdm constitutes an unresolved mystery, as its most recently observed ancestors were isolated in pigs

More information

bs148h 6 September 2007 Read: Text pgs , ch 22 & 23

bs148h 6 September 2007 Read: Text pgs , ch 22 & 23 bs148h 6 September 2007 Read: Text pgs 436-437, ch 22 & 23 phenotypic variation selection within generations heritability across generations phenotypic response across generations partitioning variance:

More information

Pandemic Influenza Preparedness

Pandemic Influenza Preparedness Pandemic Influenza Preparedness Of the many health threats that we are preparing for, this is the one that we know will happen. Bruce G. Gellin, MD, MPH Director, National Vaccine Program Office Department

More information

Ebola Virus. Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017

Ebola Virus. Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017 Ebola Virus Emerging Diseases Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017 Outline Disease emergence: a case study How do pathogens shift hosts? Evolution within hosts: The evolution

More information

Todd Davis Influenza Division Centers for Disease Control and Prevention Atlanta, GA USA

Todd Davis Influenza Division Centers for Disease Control and Prevention Atlanta, GA USA OFFLU influenza virus meeting 27 28 March 2017 FAO Headquarters, Rome, Italy Todd Davis Influenza Division Centers for Disease Control and Prevention Atlanta, GA USA Strains of concerns Influenza A(H3N2)v

More information

Mapping Evolutionary Pathways of HIV-1 Drug Resistance. Christopher Lee, UCLA Dept. of Chemistry & Biochemistry

Mapping Evolutionary Pathways of HIV-1 Drug Resistance. Christopher Lee, UCLA Dept. of Chemistry & Biochemistry Mapping Evolutionary Pathways of HIV-1 Drug Resistance Christopher Lee, UCLA Dept. of Chemistry & Biochemistry Stalemate: We React to them, They React to Us E.g. a virus attacks us, so we develop a drug,

More information

Incorporating virologic data into seasonal and pandemic influenza vaccines

Incorporating virologic data into seasonal and pandemic influenza vaccines Incorporating virologic data into seasonal and pandemic influenza vaccines Kanta Subbarao WHO Collaborating Centre for Reference and Research on Influenza & Department of Microbiology and Immunology, University

More information

Lesson 20 Study Guide: Medical Biotechnology Pandemic Flu & Emergent Disease

Lesson 20 Study Guide: Medical Biotechnology Pandemic Flu & Emergent Disease URI CMB 190 Issues in Biotechnology Lesson 20 Study Guide: Medical Biotechnology Pandemic Flu & Emergent Disease 1. The film Contagion: (A) entirely depicts a situation that could never possibly happen

More information

Originally published as:

Originally published as: Originally published as: Ratsch, B.A., Bock, C.-T. Viral evolution in chronic hepatitis B: A branched way to HBeAg seroconversion and disease progression? (2013) Gut, 62 (9), pp. 1242-1243. DOI: 10.1136/gutjnl-2012-303681

More information

Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS

Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS 1 Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS What steps are involved in viral infection and replication? Why are some kinds of influenza virus more deadly than others? How do flu

More information

What is Influenza? Patricia Daly MD, FRCPC Medical Health Officer and Medical Director of Communicable Disease Control

What is Influenza? Patricia Daly MD, FRCPC Medical Health Officer and Medical Director of Communicable Disease Control Vancouver Coastal Health & The Vancouver Coastal Health Research Institute presents: On Call with VGH Experts Lecture Series The Flu and You What is Influenza? Patricia Daly MD, FRCPC Medical Health Officer

More information

Chinese Influenza Weekly Report

Chinese Influenza Weekly Report National Institute for Viral Disease Control and Prevention, China CDC Chinese Weekly Report (All data are preliminary and may change as more reports are received) Summary During week 17, influenza activity

More information

Pandemic H1N Dr. Maria Neira Global Influenza Programme WHO, Geneva

Pandemic H1N Dr. Maria Neira Global Influenza Programme WHO, Geneva Pandemic H1N1 2010 Dr. Maria Neira Global Influenza Programme WHO, Geneva WHO Role during pandemic (H1N1) 2009 Under the International Health Regulations (2005) Detect event (notification by Member States

More information

Development of safe and immunogenic reassortant viruses with 5:3 genotype for live attenuated influenza vaccine

Development of safe and immunogenic reassortant viruses with 5:3 genotype for live attenuated influenza vaccine Development of safe and immunogenic reassortant viruses with 5:3 genotype for live attenuated influenza vaccine Irina Isakova-Sivak, PhD Institute of Experimental Medicine, Saint Petersburg, Russia The

More information

The selfish gene. mitochondrium

The selfish gene. mitochondrium The selfish gene selection acts mostly for the benefit of the individual sometimes selection may act for the benefit of relatives rarely, selection acts for the benefit of the group mitochondrium in asexual

More information

INFLUENZA WEEKLY UPDATE

INFLUENZA WEEKLY UPDATE INFLUENZA WEEKLY UPDATE 29/28: 6-12 July 29 The national influenza surveillance system in New Zealand is an essential public health component for assessing and implementing strategies to control influenza.

More information

WHO Response to Influenza A (H1N1) CAPSCA December, 2011 Dr. Nasr Eltantawy Medical epidemiologist WHO/Egypt

WHO Response to Influenza A (H1N1) CAPSCA December, 2011 Dr. Nasr Eltantawy Medical epidemiologist WHO/Egypt WHO Response to Influenza A (H1N1) 2009 CAPSCA 11-14 December, 2011 Dr. Nasr Eltantawy Medical epidemiologist WHO/Egypt Outline Background. Preparedness planning. Evolution of the pandemic. WHO and other

More information

In April 2009, a new strain of

In April 2009, a new strain of managing and reducing Uncertainty in an Emerging Influenza Pandemic 2. Brundage JF, Shanks GD. Deaths from bacterial pneumonia during 1918 19 influenza pandemic. Emerg Infect Dis 2008;14:1193-9. 3. Update:

More information

Grade Level: Grades 9-12 Estimated Time Allotment Part 1: One 50- minute class period Part 2: One 50- minute class period

Grade Level: Grades 9-12 Estimated Time Allotment Part 1: One 50- minute class period Part 2: One 50- minute class period The History of Vaccines Lesson Plan: Viruses and Evolution Overview and Purpose: The purpose of this lesson is to prepare students for exploring the biological basis of vaccines. Students will explore

More information

Influenza A virus subtype H5N1

Influenza A virus subtype H5N1 Influenza A virus subtype H5N1 Influenza A virus subtype H5N1, also known as A(H5N1) or simply H5N1, is a subtype of the Influenza A virus which can cause illness in humans and many other animal species.

More information

Mapping evolutionary pathways of HIV-1 drug resistance using conditional selection pressure. Christopher Lee, UCLA

Mapping evolutionary pathways of HIV-1 drug resistance using conditional selection pressure. Christopher Lee, UCLA Mapping evolutionary pathways of HIV-1 drug resistance using conditional selection pressure Christopher Lee, UCLA HIV-1 Protease and RT: anti-retroviral drug targets protease RT Protease: responsible for

More information

Emerging Infections: Pandemic Influenza. W. Paul Glezen

Emerging Infections: Pandemic Influenza. W. Paul Glezen Emerging Infections: Pandemic Influenza W. Paul Glezen Challenges The trends of modern society tend to facilitate spread and increase morbidity Travel, urbanization morbidity vs. mortality The cost of

More information

Strategies for containing an emerging influenza pandemic in South East Asia 1

Strategies for containing an emerging influenza pandemic in South East Asia 1 Strategies for containing an emerging influenza pandemic in South East Asia 1 Modeling pandemic spread and possible control plans of avian flu H5N1 BBSI, Nicole Kennerly, Shlomo Ta asan 1 Nature. 2005

More information

Where Health Care Meets Policy. with Dr. Mike Magee

Where Health Care Meets Policy. with Dr. Mike Magee Where Health Care Meets Policy with Dr. Mike Magee The Threat of Bird Flu Understanding Bird Flu and the Influenza Virus 3 types of the influenza virus: A, B and C reflect differences in the M protein

More information

Ralph KY Lee Honorary Secretary HKIOEH

Ralph KY Lee Honorary Secretary HKIOEH HKIOEH Round Table: Updates on Human Swine Influenza Facts and Strategies on Disease Control & Prevention in Occupational Hygiene Perspectives 9 July 2009 Ralph KY Lee Honorary Secretary HKIOEH 1 Influenza

More information

Update on Swine Influenza Virus Surveillance in Vietnam

Update on Swine Influenza Virus Surveillance in Vietnam Update on Swine Influenza Virus Surveillance in Vietnam OFFLU SIV Group technical meeting, 3 4 Dec 2015 OIE Headquarters, Paris Tung Nguyen, DAH-Vietnam Swine Influenza surveillance activities in Vietnam

More information

Preparing for the Fall Flu Season. Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP

Preparing for the Fall Flu Season. Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP Preparing for the Fall Flu Season Laboratory Perspective Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP September 21, 2009 Objectives 1. Review the emergence of Novel Influenza A

More information

Prepare to Care Pandemic Planning at Fraser Health

Prepare to Care Pandemic Planning at Fraser Health Prepare to Care Pandemic Planning at Fraser Health Pandemic Influenza Planning December 10, 2009 Facilitator: Lisa Zetes-Zanatta 7 Prepare to Care: Introductions FHA Pandemic Lady Lisa Zetes-Zanatta Roundtable

More information

VIROLOGY OF INFLUENZA. Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks

VIROLOGY OF INFLUENZA. Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks INFLUENZA VIROLOGY OF INFLUENZA Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks PATHOGENICITY High pathogenicity avian influenza (HPAI) Causes severe disease in poultry

More information

Feasibility of Production of Human AI Vaccine in AI vaccine Manufacturers in China. Gu Hong Ministry of Agriculture of P. R. China

Feasibility of Production of Human AI Vaccine in AI vaccine Manufacturers in China. Gu Hong Ministry of Agriculture of P. R. China Feasibility of Production of Human AI Vaccine in AI vaccine Manufacturers in China Gu Hong Ministry of Agriculture of P. R. China AI -- common challenge to the all countries Global cooperation in control

More information

HIV Drug Resistance. Together, we can change the course of the HIV epidemic one woman at a time.

HIV Drug Resistance. Together, we can change the course of the HIV epidemic one woman at a time. HIV Drug Resistance Together, we can change the course of the HIV epidemic one woman at a time. #onewomanatatime #thewellproject What Is Resistance? HIV drugs are designed to keep the amount of HIV virus

More information

The Dynamics of HIV-1 Adaptation in Early Infection

The Dynamics of HIV-1 Adaptation in Early Infection Genetics: Published Articles Ahead of Print, published on December 29, 2011 as 10.1534/genetics.111.136366 The Dynamics of HIV-1 Adaptation in Early Infection Jack da Silva School of Molecular and Biomedical

More information

Lecture 11. Immunology and disease: parasite antigenic diversity

Lecture 11. Immunology and disease: parasite antigenic diversity Lecture 11 Immunology and disease: parasite antigenic diversity RNAi interference video and tutorial (you are responsible for this material, so check it out.) http://www.pbs.org/wgbh/nova/sciencenow/3210/02.html

More information

Bioinformation Volume 5

Bioinformation Volume 5 Identification of sequence mutations affecting hemagglutinin specificity to sialic acid receptor in influenza A virus subtypes Usman Sumo Friend Tambunan*, Ramdhan Department of Chemistry, Faculty of Mathematics

More information

The Evolution of Sex. Or, why do we even need males?

The Evolution of Sex. Or, why do we even need males? The Evolution of Sex Or, why do we even need males? Sexual VS Asexual reproduction Sexual Fewer offspring/individual Only half of genes passed on Good genotypes are lost Offspring are variable Asexual

More information

Clinical Trials of Pandemic Vaccines: Key Issues. John Treanor University of Rochester Rochester, NY

Clinical Trials of Pandemic Vaccines: Key Issues. John Treanor University of Rochester Rochester, NY Clinical Trials of Pandemic Vaccines: Key Issues John Treanor University of Rochester Rochester, NY Inactivated vaccine approach Proven technology Used successfully in 1957 and 1968 Abundant efficacy data

More information

A new look at an old virus: patterns of mutation accumulation in the human H1N1 influenza virus since 1918

A new look at an old virus: patterns of mutation accumulation in the human H1N1 influenza virus since 1918 Carter and Sanford Theoretical Biology and Medical Modelling 2012, 9:42 RESEARCH Open Access A new look at an old virus: patterns of mutation accumulation in the human H1N1 influenza virus since 1918 Robert

More information

Current CEIRS Program

Current CEIRS Program History The influenza program at St. Jude has a long, distinguished history as a world-class leader in the study of the origins, evolution, and pathogenesis of influenza viruses. Based on this expertise,

More information

In the mid-20th century the structure of DNA was discovered. What is a section of DNA which codes for one specific protein called?

In the mid-20th century the structure of DNA was discovered. What is a section of DNA which codes for one specific protein called? Q1.Our understanding of genetics and inheritance has improved due to the work of many scientists. (a) Draw one line from each scientist to the description of their significant work. Scientist Description

More information

Chinese Influenza Weekly Report

Chinese Influenza Weekly Report Chinese Influenza Weekly Report (All data are preliminary and may change as more reports are received) Summary During week 13, influenza activity was still a little high in mainland China, and it was increasing

More information

Influenza Updates Reflection on 2017: thank you and happy holidays

Influenza Updates Reflection on 2017: thank you and happy holidays Influenza Updates The newsletter of the WHO Collaborating Centre for Reference and Research on Influenza in Melbourne Volume 6, Issue 3, November 2017 Reflection on 2017: thank you and happy holidays As

More information

4/28/2013. The Ever-Evolving Flu p The 1918 Flu p. 617

4/28/2013. The Ever-Evolving Flu p The 1918 Flu p. 617 The Ever-Evolving Flu p. 615 1. Influenza (Fig 18.10) rapidly evolves each year, and processes such as reassortment give rise to new genotypes. 2. Flu virus evolves rapidly to evade our immune system (Fig

More information

Influenza A Virus PB1-F2 Gene in Recent Taiwanese Isolates

Influenza A Virus PB1-F2 Gene in Recent Taiwanese Isolates Influenza A Virus PB1-F2 Gene in Recent Taiwanese Isolates Guang-Wu Chen,* Ching-Chun Yang, Kuo-Chien Tsao, Chung-Guei Huang, Li-Ang Lee, Wen-Zhi Yang, Ya-Ling Huang, Tzou-Yien Lin, and Shin-Ru Shih Influenza

More information

WHO biosafety risk assessment and guidelines for the production and quality control of human influenza pandemic vaccines: Update

WHO biosafety risk assessment and guidelines for the production and quality control of human influenza pandemic vaccines: Update WHO biosafety risk assessment and guidelines for the production and quality control of human influenza pandemic vaccines: Update 23 July 2009 Introduction This document updates guidance 1 from the World

More information

Global Pandemic Preparedness Research Efforts. Klaus Stöhr. WHO Global Influenza Programme. Today

Global Pandemic Preparedness Research Efforts. Klaus Stöhr. WHO Global Influenza Programme. Today Global Pandemic Preparedness Research Efforts Klaus Stöhr 3 Today Medium-term applied research linked to medical and public health interventions addressing the current pandemic situation in Asia Natural

More information

Received 21 December 2010/Returned for modification 4 February 2011/Accepted 29 March 2011

Received 21 December 2010/Returned for modification 4 February 2011/Accepted 29 March 2011 JOURNAL OF CLINICAL MICROBIOLOGY, June 2011, p. 2216 2221 Vol. 49, No. 6 0095-1137/11/$12.00 doi:10.1128/jcm.02567-10 Copyright 2011, American Society for Microbiology. All Rights Reserved. Rapid Differentiation

More information

ELIMINATION OF MUTANT TYPES IN SELECTION EXPERIMENT BETWEEN WILD TYPE AND MUTANT EYE COLOUR IN DROSOPHILA ANANASSAE

ELIMINATION OF MUTANT TYPES IN SELECTION EXPERIMENT BETWEEN WILD TYPE AND MUTANT EYE COLOUR IN DROSOPHILA ANANASSAE 73 Journal of Scientific Research Banaras Hindu University, Varanasi Vol. 56, 2012 : 73-79 ISSN : 0447-9483 ELIMINATION OF MUTANT TYPES IN SELECTION EXPERIMENT BETWEEN WILD TYPE AND MUTANT EYE COLOUR IN

More information

Incidence of Seasonal Influenza

Incidence of Seasonal Influenza What Is All the Fuss? A Just-in in-time Primer on H1N1 Influenza A and Pandemic Influenza provided by the National Association of State EMS Officials May 1, 2009 Disclaimer This self-learning learning

More information

Avian influenza Avian influenza ("bird flu") and the significance of its transmission to humans

Avian influenza Avian influenza (bird flu) and the significance of its transmission to humans 15 January 2004 Avian influenza Avian influenza ("bird flu") and the significance of its transmission to humans The disease in birds: impact and control measures Avian influenza is an infectious disease

More information

abcdefghijklmnopqrstu

abcdefghijklmnopqrstu abcdefghijklmnopqrstu Swine Flu UK Planning Assumptions Issued 3 September 2009 Planning Assumptions for the current A(H1N1) Influenza Pandemic 3 September 2009 Purpose These planning assumptions relate

More information