CBL and EZH2 as new molecular markers in MPN
|
|
- Chester Ellis
- 5 years ago
- Views:
Transcription
1 CBL and EZH2 as new molecular markers in MPN Andy Chase University of Southampton and Wessex Regional Genetics Laboratory Salisbury, UK Munich 2011
2 * Myeloproliferative neoplasms MDS/MPN Myelodysplastic syndrome CML PV ET PMF CNL CEL Mastocytosis MPN-U CMML acml (BCR-ABL neg) JMML MDS/MPN-U RA RARS RCMD RCMD-RS RAEB MDS del(5q) MDS-U
3 * Cytogenetics of MPN & MDS/MPN ~ 99% normal karyotype or non-specific changes eg +8 ~ 1% translocations creating tyrosine kinase fusion genes FGFR1 JAK2 PDGFRA PDGFRB 8p11 9p24 4q12 5q33
4 SNP 6.0 data analyzed by AsCNAR software Normal Amplification Deletion aupd Yamamoto et al., Am J Hum Genet 2007
5 aupd>20 Mb (n=148 MDS/MPN patients)
6 11q aupd is associated with CBL mutations Dunbar et. al. 2008, Cancer Res. 68: Grand FH et. al. 2009, Blood, 113: Sanada et. al. 2009, Nature, 460:
7 * CBL is an E3 ubiquitin ligase ubiquitin conjugating enzyme E2 ub ubiquitin ligase CBL E3 ub ub ub ub P P KIT FLT3 etc. ub CBL E3 P P E1 ubiquitin activating enzyme multiple signals PI3K MAPK SRC proteasomal degradation
8 CBL tyrosine kinase binding (TKB) RING proline rich Y Y Y UBA N- -C GRB2, SRC, CRKL, PI3K. binds substrate binds E2 CBL is a multifunctional 120 kd protein: E3 ubiquitin ligase that targets substrates for proteasomal degradation acts as a scaffold for multiple signalling molecules eg PI3K, GRB2, SRC, CRKL Two mammalian homologs: CBLB and CBLC All have TKB, linker and RING domains CBLB, but not CBLC, has C-terminal signalling molecule binding domains A viral homolog, v-cbl, causes Casitas B-lineage lymphoma in mice v-cbl only retains the TKB domain
9 * CBL disease incidence CMML 5-22% (overall 13%) JMML 7-19% (overall 14%) acml 8% RARS-T 0/19 (0%) PMF 6% no mutations in PV or ET AML <1% higher in CBF subtypes MDS 2.5% higher in RAEB2, secondary MDS (CBLB and CBLC mutations reported with low incidence)
10 CBL and prognosis Kohlmann, 2010, J Clin Oncol: No association with survival in CMML Survival in CMML Survival in CMML 19 months 14 months P=0.05 CMML, acml, MF (mutated = 19, non-mutated = 87) Jankowska et al. Blood 2010 Grand F H et al. Blood 2009;113:
11 * CBL: position of mutations binds substrate binds E2 GRB2, SRC, PI3K, CRKL WRGL Gelsi Boyer 2010 Kohlmann 2010 Exon 8 Exon 9 PTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV X X X X XX XX X X XX X X XXXXX X X X X XX X X X X X X X X X X X 4 x deletions / splice site mutations Adapted from Dunbar et al 2009
12 * CBL is an E3 ubiquitin ligase ubiquitin conjugating enzyme E2 ub ubiquitin ligase CBL E3 ub ub ub ub P P KIT FLT3 etc. ub CBL E3 P P E1 ubiquitin activating enzyme multiple signals PI3K MAPK SRC proteasomal degradation
13 * CBL is an E3 ubiquitin ligase ubiquitin conjugating enzyme ub E2 ub ubiquitin ligase CBL E3 X ub ub ub ub CBL E3 P P P P KIT FLT3 etc. E1 ubiquitin activating enzyme multiple signals PI3K MAPK SRC X proteasomal degradation
14 Transforming ability is associated with loss of E3 ubiquitin ligase activity Wt-CBL N454D S376F H398Y P417A R420Q Proliferation of 32D-FLT3 + CBL WP: FLT3 IP: FLT3 WB: HA-Ub WB: CBL
15 * Gain-of-function CBL mutants Sanada et al, 2009 (Nature) Mutant CBL NIH-3T3 Transformation Mutant CBL CBL -/- mouse background Transformation
16 * Juvenile Myelomonocytic Leukemia (JMML) Rare, aggressive, MDS/MPN of childhood Overall incidence of CBL mutation: 14% All CBL mutations germline 2/3 with developmental abnormalities: dev. delay, cardiomyopathy, cryptorchidism, growth delay High rate of spontaneous remission but with vasculopathies in later life Exon 8 Exon 9 PTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV X X X X XX XX X X XX X X XXXXX X X X X XX X X X X X X X X X X X CMML/aCML JMML Exon 8 Exon 9 Perez 2010 Loh 2009 Exon 8 4 x deletions / splice site mutations PTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV X XX X X X X X XXX XXX XXX XXXXXX Exon 9 5 x deletions / splice site mutations
17 * RASopathies Chan et al, 2009b, Loh, 2011
18 CBL - summary CBL mutations are associated with 11q UPD and are nearly always homozygous Highest incidence in MDS/MPN and PMF Most mutations in linker and RING domain (exons 8 and 9) and result in loss of ubiquination activity CBL mutations have both tumour suppressive and gain-offunction properties CBL mutations in JMML are constitutional with a high rate of spontaneous remission and can be associated with developmental abnormalities
19 aupd>20 Mb (n=148 MDS/MPN patients)
20 7q36.1 Chr aupd samples 52 Mb, >400 genes Tyrosine kinases excluded Sequenced 15 candidate genes C7orf33 CUL1 EZH2 7q UPD SNP 6.0 acgh
21 7q aupd is associated with EZH2 mutations Premature STOP codon Missense mutation Nonsense mutation C>T R207X C>G C576W del A K685fsX Ernst et al, 2010, Nature Genetics, 42:722. Nikoloski et al, 2010, Nature Genetics, 42: 665
22 EZH2 and cancer EZH2 can act as an oncogene by overexpression Upregulated in advanced aggressive cancers e.g. prostate cancer, breast cancer and AML EZH2 can transform normal cells in vitro and in vivo EZH2 inhibition can inhibit the growth of AML and breast cancer cells A single recurrent gain-of-function EZH2 mutation (Tyr 641) identified in lymphomas of germinal-centre origin (Morin et al., Nat Genet 2010)
23 EZH2 function EZH2 is a polycomb gene that modifies chromatin - methylates lysine 27 of histone H3 (H3K27me) - associated with transcriptional repression EZH2, SUZ12 and EED are the core components of the polycomb repressive complex PRC2 PRC2 EED SUZ12 EZH2 RBBP4/7 SIRT1 JARID2 PHF1 Histone H3K27 methylation is opposed by H3K4 methylation catalysed by MLL PRC2 targets: developmental, cell cycle and differentiation
24 * H3K27 and H3K4 methylation marks developmental regulators: bivalent model Stem cell H3K27me3 H3K4me3 Activation of tissue-specific and lineage-specific genes Repression of self-renewal and non lineage-specific genes Mature cells
25 * EZH2 disease incidence CMML 6-13% (overall 10%) acml 13% MDS/MPN-U 10% PMF 4-13% (overall 6%) PV/ET - MF 0-5 (overall 4%) PV 1/30 (3%) ET 1/30 (3%) CML-BC 0/40 AML <1% -7/7q- 0/54 MDS % (overall 8%)
26 Location of mutations within EZH2 Nonsense and premature stop codon mutations Missense mutations N- -C E D I D II CXC SET 18% 77% 62% 75% 88% EED SUZ12 Methyltransferase activity
27 % survival % survival EZH2 mutation is associated with a poor prognosis unmutated MDS/MPN (n=115) mutated MDS/MPN (n=19) mutation negative (n=182) heterozygous mutation (n=22) homozygous mutation (n=10) P= P=0.089 (het vs hom) months after diagnosis months after diagnosis Survival in CMML Alive at 3 years: 33.3 vs 69.9% Alive at 3 years: 33.9 vs 49.7 vs 89.8% Grossmann, 2011, Leukemia, 25:877
28 * EZH2 mutation is associated with a poor prognosis P<.001 EZH2 mut EZH2 WT P=.032 EZH2 mut EZH2 WT Guglielmelli et al. EHA 2011 EZH2 mutations in 22/370 (6%) PMF Median survival 31.6 months vs 137 mos Survival in MDS Bejar, 2011, NEJM HR for death = 2.13
29 * Mutation of other H3K27me proteins in MDS/MPN 1-2% 8% of CMML 1% EED SUZ12 UTX 12% EZH2 me me K27 me EED: 1/87 MDS/MPN (not with 11q UPD) SUZ12: 4 cases with mutation (1-2%) 1 of 2 cases with 17q aupd and 2 of 2 cases with focal 17q11.2 deletions (one with an NF1 mutation) Jankowska, Blood, 2011: UTX mutations in (4/52) 8% of CMML
30 EZH2 - a paradox? Loss-of-function mutations in MDS/MPN But overexpression in AML and solid tumours Inactivating mutations of both EZH2 and UTX in CMML
31 Polycomb Group Genes and Cancer +/- +/ /- Polycomb Stem cell loss Tumour Normal Stem cells Tumour Sauvageau, 2008, PLoS Biology
32 Summary - Molecular pathogenesis of MPN & MDS/MPN Epigenetic regulation TET2 IDH1/2 ASXL1 EZH2 SUZ12 EED DNMT3 UTX Notch pathway NOTCH NCSTRN Splicing machinery SRSF2 U2AF35 PRPF40B ZRSR2 SF3B1 SF1 Unknown? Tyrosine kinase signalling TK fusions CBL RAS JAK2 KIT NF1 SH2B3 PTPN11 Transcription factors RUNX1 WT1 CEBPA
33 Acknowledgements Wessex Regional Genetics Laboratory (Salisbury, UK) Collaborators Katerina Zoi (Athens, Greece) Andreas Hochhaus (Jena, Germany) Andreas Reiter (Mannheim, Germany) Hans Drexler (Braunschweig, Germany) Andrew Duncombe (Southampton, UK) Francisco Cervantes (Barcelona, Spain) David Oscier (Bournemouth, UK) Jacqueline Boultwood (Oxford, UK)
Myeloproliferative neoplasms: recent advances in pathogenesis
Myeloproliferative neoplasms: recent advances in pathogenesis Andy Chase University of Southampton and Wessex Regional Genetics Laboratory Salisbury, UK Uppsala 2010 Myeloproliferative neoplasms MDS/MN
More informationSUPPLEMENTARY INFORMATION
Supplementary Information S1 Frequency of DNMT3A mutations in hematologic disorders and their associated clinical phenotypes. Disease Patient population Frequency (%) Associated Clinical Characteristics
More informationGenetic complexity in MPN, MDS/MPN and MDS
Genetic complexity in MPN, MDS/MPN and MDS Nick Cross Wessex Regional Genetics Laboratory, Salisbury Faculty of Medicine, University of Southampton Genetic complexity in chronic myeloid neoplasms Classes
More informationNext Generation Sequencing in Haematological Malignancy: A European Perspective. Wolfgang Kern, Munich Leukemia Laboratory
Next Generation Sequencing in Haematological Malignancy: A European Perspective Wolfgang Kern, Munich Leukemia Laboratory Diagnostic Methods Cytomorphology Cytogenetics Immunophenotype Histology FISH Molecular
More informationPathogenesis and management of CMML
Pathogenesis and management of CMML Raphaël Itzykson, Hôpital Saint-Louis, Paris International Conference of the Korean Society of Hematology March 29th 2018 대한혈액학회 Korean Society of Hematology COI disclosure
More informationJuvenile and Chronic Myelo-Monocytic Leukemia
Juvenile and Chronic Myelo-Monocytic Leukemia Haematopoietic stem cell Lympho-myeloid progenitor cell MEP CFU-GM lymphoid progenitor cell BFU-E CFU-MK CFU-E erythro CFU-M CFU-G CFU-T CFU-B MGK red blood
More informationMolecular Markers in Acute Leukemia. Dr Muhd Zanapiah Zakaria Hospital Ampang
Molecular Markers in Acute Leukemia Dr Muhd Zanapiah Zakaria Hospital Ampang Molecular Markers Useful at diagnosis Classify groups and prognosis Development of more specific therapies Application of risk-adjusted
More informationAcute leukemia and myelodysplastic syndromes
11/01/2012 Post-ASH meeting 1 Acute leukemia and myelodysplastic syndromes Peter Vandenberghe Centrum Menselijke Erfelijkheid & Afdeling Hematologie, UZ Leuven 11/01/2012 Post-ASH meeting 2 1. Acute myeloid
More informationOpportunities for Optimal Testing in the Myeloproliferative Neoplasms. Curtis A. Hanson, MD
Opportunities for Optimal Testing in the Myeloproliferative Neoplasms Curtis A. Hanson, MD 2013 MFMER slide-1 DISCLOSURES: Relevant Financial Relationship(s) None Off Label Usage None 2013 MFMER slide-2
More informationOut-Patient Billing CPT Codes
Out-Patient Billing CPT Codes Updated Date: August 3, 08 Client Billed Molecular Tests HPV DNA Tissue Testing 8764 No Medicare Billed - Molecular Tests NeoARRAY NeoARRAY SNP/Cytogenetic No 89 NeoLAB NeoLAB
More informationPublished Ahead of Print on June 24, 2012, as doi: /haematol Copyright 2012 Ferrata Storti Foundation.
Published Ahead of Print on June 24, 2012, as doi:10.3324/haematol.2012.065375. Copyright 2012 Ferrata Storti Foundation. Early Release Paper Use of CBL exon 8 and 9 mutations in diagnosis of myeloproliferative
More informationBlastic Plasmacytoid Dendritic Cell Neoplasm with DNMT3A and TET2 mutations (SH )
Blastic Plasmacytoid Dendritic Cell Neoplasm with DNMT3A and TET2 mutations (SH2017-0314) Habibe Kurt, Joseph D. Khoury, Carlos E. Bueso-Ramos, Jeffrey L. Jorgensen, Guilin Tang, L. Jeffrey Medeiros, and
More informationIllumina Trusight Myeloid Panel validation A R FHAN R A FIQ
Illumina Trusight Myeloid Panel validation A R FHAN R A FIQ G E NETIC T E CHNOLOGIST MEDICAL G E NETICS, CARDIFF To Cover Background to the project Choice of panel Validation process Genes on panel, Protocol
More informationMolecular. Oncology & Pathology. Diagnostic, Prognostic, Therapeutic, and Predisposition Tests in Precision Medicine. Liquid Biopsy.
Molecular Oncology & Pathology Hereditary Cancer Somatic Cancer Liquid Biopsy Next-Gen Sequencing qpcr Sanger Sequencing Diagnostic, Prognostic, Therapeutic, and Predisposition Tests in Precision Medicine
More informationSusanne Schnittger. Workflow of molecular investigations in JAK2-negative MPNs - the Munich experience
Susanne Schnittger Workflow of molecular investigations in JAK2negative MPNs the Munich experience Cohort single centre experience to apply new markers in a daily diagnostic work flow total: 20,547 cases
More informationDisclosures for Ayalew Tefferi
Disclosures for Ayalew Tefferi Principal investigator role Employee Consultant Major Stockholder Speakers Bureau Scientific Advisory Board Janssen, Geron, Celgene, Sanofi-Aventis, Gilead Sciences, Incyte
More informationSession 4: Summary and Conclusions
Session 4: Summary and Conclusions Total cases in Session 4 Myeloproliferative neoplasms 16 cases Oral #300 (CEL, NOS) Mastocytosis 2 cases Oral #156 (SM-AHN) Myeloid/lymphoid neoplasms with eosinophilia
More informationPRC2 crystal clear. Matthieu Schapira
PRC2 crystal clear Matthieu Schapira Epigenetic mechanisms control the combination of genes that are switched on and off in any given cell. In turn, this combination, called the transcriptional program,
More informationDisclosure: Objectives/Outline. Leukemia: Genealogy of Pathology Practice: Old Diseases New Expectations. Nothing to disclose.
RC1 Leukemia: Genealogy of Pathology Practice: Old Diseases New Expectations RC2 Disclosure: Nothing to disclose Henry Moon Lecture: UCSF Annual Conference Kathryn Foucar, MD kfoucar@salud.unm.edu May
More informationMyelodysplastic syndrome is a highly heterogeneous hematopoietic
SHORT COMMUNICATION Clinical Characteristics and Prognosis of 48 Patients with Mutations in Myelodysplastic Syndrome Yulu Tian #, Ruijuan Zhang #, Linhua Yang* Yang L. Clinical Characteristics and Prognosis
More informationConcomitant WT1 mutations predicted poor prognosis in CEBPA double-mutated acute myeloid leukemia
Concomitant WT1 mutations predicted poor prognosis in CEBPA double-mutated acute myeloid leukemia Feng-Ming Tien, Hsin-An Hou, Jih-Luh Tang, Yuan-Yeh Kuo, Chien-Yuan Chen, Cheng-Hong Tsai, Ming Yao, Chi-Cheng
More informationAcute Myeloid Leukemia with RUNX1 and Several Co-mutations
Case SH2017-0281 Acute Myeloid Leukemia with RUNX1 and Several Co-mutations James Bauer, MD, PhD David Yang, MD Erik Ranheim, MD, PhD Catherine Leith, MB, Bchir Clinical History Chief Complaint: 72 year
More informationMyelodysplastic syndromes and the new WHO 2016 classification
Myelodysplastic syndromes and the new WHO 2016 classification 32nd General Annual Meeting of the Belgian Hematology Society 10-11 February 2017 Gregor Verhoef, Departement of Hematology, University Hospital
More informationDisclosures for Ayalew Tefferi
Disclosures for Ayalew Tefferi Principal investigator role Employee Consultant Major Stockholder Speakers Bureau Scientific Advisory Board Janssen, Geron, Celgene, Sanofi-Aventis, Gilead Sciences, Incyte
More informationWHO Classification of Myeloid Neoplasms with Defined Molecular Abnormalities
WHO Classification of Myeloid Neoplasms with Defined Molecular Abnormalities Robert W. McKenna, M.D. 1/2009 WHO Classification of Myeloid Neoplasms (4th Edition)--2008 Incorporates new information that
More informationEpigene.cs: What is it and how it effects our health? Overview. Dr. Bill Stanford, PhD OFawa Hospital Research Ins.tute University of OFawa
Epigene.cs: What is it and how it effects our health? Dr. Bill Stanford, PhD OFawa Hospital Research Ins.tute University of OFawa Overview Basic Background Epigene.cs in general Epigene.cs in cancer Epigene.cs
More informationApproaching myeloid neoplasms: diagnostic algorithms
Approaching myeloid neoplasms: diagnostic algorithms Alexandar Tzankov Histopathology Pathology Content Integration of clinical and laboratory data Bone marrow evaluation approaching Myeloproliferative
More informationFOLLICULAR LYMPHOMA- ILLUMINA METHYLATION. Jude Fitzgibbon
FOLLICULAR LYMPHOMA- ILLUMINA METHYLATION Jude Fitzgibbon j.fitzgibbon@qmul.ac.uk Molecular Predictors of Clinical outcome Responders Alive Non-responders Dead TUMOUR GENETICS Targeted therapy, Prognostic
More informationNeoTYPE Cancer Profiles
NeoTYPE Cancer Profiles Multimethod Analysis of 25+ Hematologic Diseases and Solid Tumors Anatomic Pathology FISH Molecular The next generation of diagnostic, prognostic, and therapeutic assessment NeoTYPE
More informationManagement of Myelodysplastic Syndromes
Management of Myelodysplastic Syndromes Peter L. Greenberg, MD Stanford Cancer Institute Myelodysplastic Syndromes: Clinical & Molecular Advances for Disease Classification and Prognostication MDSs: A
More informationMyelodysplastic syndromes Impact of Biology. Lionel Adès Hopital Saint Louis Groupe Francophone des SMD. Épidémiologie
Myelodysplastic syndromes Impact of Biology Lionel Adès Hopital Saint Louis Groupe Francophone des SMD Épidémiologie Incidence : 3 à 6 / 100 000 hab. / An Prédomine chez les sujets âgés Augmentation de
More informationPDF hosted at the Radboud Repository of the Radboud University Nijmegen
PDF hosted at the Radboud Repository of the Radboud University Nijmegen The following full text is a publisher's version. For additional information about this publication click this link. http://hdl.handle.net/2066/157683
More informationDiagnostic Molecular Pathology of Myeloid Neoplasms
Diagnostic Molecular Pathology of Myeloid Neoplasms Beirut, Lebanon Tuesday November 29, 2011: Pre-congress workshop Adam Bagg University of Pennsylvania Philadelphia, USA Myeloid neoplasms Myeloproliferative
More informationSupplemental Material. The new provisional WHO entity RUNX1 mutated AML shows specific genetics without prognostic influence of dysplasia
Supplemental Material The new provisional WHO entity RUNX1 mutated AML shows specific genetics without prognostic influence of dysplasia Torsten Haferlach, 1 Anna Stengel, 1 Sandra Eckstein, 1 Karolína
More informationPublished Ahead of Print on April 14, 2016, as doi: /haematol Copyright 2016 Ferrata Storti Foundation.
Published Ahead of Print on April 14, 2016, as doi:10.3324/haematol.2016.143214. Copyright 2016 Ferrata Storti Foundation. Immunohistochemical pattern of p53 is a measure of TP53 mutation burden and adverse
More informationUnraveling the Molecular Pathophysiology of Myelodysplastic Syndromes Rafael Bejar, Ross Levine, and Benjamin L. Ebert
VOLUME 29 NUMBER 5 FEBRUARY 10 2011 JOURNAL OF CLINICAL ONCOLOGY R E V I E W A R T I C L E Unraveling the Molecular Pathophysiology of Myelodysplastic Syndromes Rafael Bejar, Ross Levine, and Benjamin
More informationMyeloproliferative Neoplasms
Myeloproliferative Neoplasms (MPN and MDS/MPN) Attilio Orazi, MD, FRCPath Weill Cornell Medical College/ NY Presbyterian Hospital, New York, NY USA EAHP EDUCATIONAL SESSION: Updated WHO classification
More informationReview Article The Epigenetic Landscape of Acute Myeloid Leukemia
Advances in Hematology, Article ID 103175, 15 pages http://dx.doi.org/10.1155/2014/103175 Review Article The Epigenetic Landscape of Acute Myeloid Leukemia Emma Conway O Brien, Steven Prideaux, and Timothy
More informationWinship Cancer Institute of Emory University New Determinants and Approaches for MPN
Winship Cancer Institute of Emory University New Determinants and Approaches for MPN Elliott F. Winton August 8, 2014 Sea Island, Georgia Outline: MPN Determinants, Approaches Diagnosis Prognosis Treatment
More informationWelcome to Master Class for Oncologists. Session 3: 9:15 AM - 10:00 AM
Welcome to Master Class for Oncologists Session 3: 9:15 AM - 10:00 AM Miami, FL December 18, 2009 Myeloproliferative Neoplasms: Bringing Order to Complexity and Achieving Optimal Outcomes Speaker: Andrew
More informationLaboratory Service Report
Specimen Type Peripheral blood CR PDF Report available at: https://test.mmlaccess.com/reports/c7028846-ih2xuglwpq.ashx Indication for Test DS CR Pathogenic utations Detected CR 1. JAK2: c.1849g>t;p.val617phe
More informationPrecision Medicine and Molecular Testing.
Precision Medicine and Molecular Testing. David A. Sallman, MD Assistant Member Department of Malignant Hematology Moffitt Cancer Center david.sallman@moffitt.org Disclosures Research funding for Celgene
More informationJuan Ma 1, Jennifer Dunlap 2, Lisong Shen 1, Guang Fan 2 1
Juan Ma 1, Jennifer Dunlap 2, Lisong Shen 1, Guang Fan 2 1 Xin Hua Hospital, Shanghai, China 2 Oregon Health & Science University, Portland, OR, United States AML is a hematopoietic neoplasms characterized
More informationMyeloid malignancies: mutations, models and management
Murati et al. BMC Cancer 2012, 12:304 REVIEW Myeloid malignancies: mutations, models and management Anne Murati, Mandy Brecqueville, Raynier Devillier, Marie-Joelle Mozziconacci, Véronique Gelsi-Boyer
More informationMyelodysplastic syndromes: revised WHO classification and distinction from non-neoplastic conditions
Myelodysplastic syndromes: revised WHO classification and distinction from non-neoplastic conditions Robert P Hasserjian, MD Associate Professor Massachusetts General Hospital and Harvard Medical School
More informationExamining Genetics and Genomics of Acute Myeloid Leukemia in 2017
Examining Genetics and Genomics of Acute Myeloid Leukemia in 2017 Elli Papaemmanuil, PhD Memorial Sloan Kettering Cancer Center New York, New York, United States Today s Talk Cancer genome introduction
More informationAugust 17, Dear Valued Client:
August 7, 08 Re: CMS Announces 6-Month Period of Enforcement Discretion for Laboratory Date of Service Exception Policy Under the Medicare Clinical Laboratory Fee Schedule (the 4 Day Rule ) Dear Valued
More informationEditorial Process: Submission:11/21/2017 Acceptance:06/19/2018
DOI:10.22034/APJCP.2018.19.7.1825 RESEARCH ARTICLE Editorial Process: Submission:11/21/2017 Acceptance:06/19/2018 The Frequency of SF3B1 Mutations in Thai Patients with Myelodysplastic Syndrome Punchita
More informationNext generation sequencing analysis - A UK perspective. Nicholas Lea
Next generation sequencing analysis - A UK perspective Nicholas Lea King s HMDC LMH is part of an integrated pathology service at King s Haematological Malignancy Diagnostic Centre (HMDC) HMDC serves population
More informationYue Wei 1, Rui Chen 2, Carlos E. Bueso-Ramos 3, Hui Yang 1, and Guillermo Garcia-Manero 1
Genome-wide CHIP-Seq Analysis of Histone Methylation Reveals Modulators of NF- B Signaling And the Histone Demethylase JMJD3 Implicated in Myelodysplastic Syndrome Yue Wei 1, Rui Chen 2, Carlos E. Bueso-Ramos
More informationMolecular Markers. Marcie Riches, MD, MS Associate Professor University of North Carolina Scientific Director, Infection and Immune Reconstitution WC
Molecular Markers Marcie Riches, MD, MS Associate Professor University of North Carolina Scientific Director, Infection and Immune Reconstitution WC Overview Testing methods Rationale for molecular testing
More informationChanging AML Outcomes via Personalized Medicine: Transforming Cancer Management with Genetic Insight
Changing AML Outcomes via Personalized Medicine: Transforming Cancer Management with Genetic Insight Co-Moderators: Rick Winneker, PhD, Senior Vice President, Research, Leukemia & Lymphoma Society Mike
More informationMyelodysplastic Syndromes: Hematopathology. Analysis of SHIP1 as a potential biomarker of Disease Progression
Myelodysplastic Syndromes: Hematopathology. Analysis of SHIP1 as a potential biomarker of Disease Progression Carlos E. Bueso-Ramos, M.D., Ph.D Department of Hematopathology The University of Texas M.
More informationMeccanismi molecolari di progressione di mala0a nelle neoplasie mieloprolifera2ve croniche PAOLA GUGLIELMELLI
Meccanismi molecolari di progressione di mala0a nelle neoplasie mieloprolifera2ve croniche PAOLA GUGLIELMELLI Sez. di Ematologia Università di Firenze Leukemic Transforma2on in MPN MPN subtype Essen2al
More informationIntroduction of an NGS gene panel into the Haemato-Oncology MPN service
Introduction of an NGS gene panel into the Haemato-Oncology MPN service Dr. Anna Skowronska, Dr Jane Bryon, Dr Samuel Clokie, Dr Yvonne Wallis and Professor Mike Griffiths West Midlands Regional Genetics
More informationSupporting Information
Supporting Information Rampal et al. 10.1073/pnas.1407792111 Fig. S1. Genetic events in leukemic transformation of chronic-phase MPNs. (A) Survival of post-mpn AML patients according to mutational status
More informationMyelodysplastic/Myeloproliferative Neoplasms (MDS/MPN) Updated
Myelodysplastic/Myeloproliferative Neoplasms (MDS/MPN) Updated Attilio Orazi, MD, FRCPath. (Engl.) Professor of Pathology and Laboratory Medicine Weill Cornell Medical College/NYP Hospital New York, NY
More informationCGC myeloid malignancy working group updates. Xinjie Xu & Rashmi Kanagal-Shamanna
CGC myeloid malignancy working group updates Xinjie Xu & Rashmi Kanagal-Shamanna 8-9-2016 Group members Gordana Raca Children's Hospital Los Angeles Xinjie Xu University of Utah ARUP Laboratories Rashmi
More informationSpectrum of somatically acquired mutations identified by combining WES and genome-wide DNA array analysis in the discovery cohort of 30 JMML cases.
Supplementary Figure 1 Spectrum of somatically acquired mutations identified by combining WES and genome-wide DNA array analysis in the discovery cohort of 30 JMML cases. A total of 85 somatically acquired
More informationShould Mutational Status in Primary Myelofibrosis (PMF) Guide Therapy..YES!!!
Should Mutational Status in Primary Myelofibrosis (PMF) Guide Therapy..YES!!! Lindsay Anne Magura Rein, MD Division of Hematologic Malignancies and Cellular Therapy/BMT A Little Bit of History.. 1665 Advanced
More informationPresenter Disclosure Information
Welcome to Master Class for Oncologists Session 3: 2: PM 3:3 PM Pasadena, CA May 1, 21 Myeloproliferative Neoplasms 21 Speaker: Ayalew Tefferi Mayo Clinic, Rochester, MN Presenter Disclosure Information
More informationDisclosures for Ayalew Tefferi
Disclosures for Ayalew Tefferi Principal investigator role Employee Consultant Major Stockholder Speakers Bureau Scientific Advisory Board Janssen, Geron, Celgene, Sanofi-Aventis, Gilead Sciences, Incyte
More informationLeukemia and subsequent solid tumors among patients with myeloproliferative neoplasms
Leukemia and subsequent solid tumors among patients with myeloproliferative neoplasms Tiziano Barbui (tbarbui@asst-pg23.it Hematology and Research Foundation,Ospedale Papa Giovanni XXIII, Bergamo Italy
More informationHeme 9 Myeloid neoplasms
Heme 9 Myeloid neoplasms The minimum number of blasts to diagnose acute myeloid leukemia is 5% 10% 20% 50% 80% AML with the best prognosis is AML with recurrent cytogenetic abnormality AML with myelodysplasia
More informationNeoTYPE Cancer Profiles
NeoTYPE Cancer Profiles 30+ Multimethod Assays for Hematologic Diseases and Solid Tumors Molecular FISH Anatomic Pathology The next generation of diagnostic, prognostic, and therapeutic assessment What
More informationMyelodysplastic syndromes
Myelodysplastic syndromes Robert P Hasserjian Massachusetts General Hospital, Boston, MA Disclosure of Relevant Financial Relationships Dr. Hasserjian declares he has no conflict(s) of interest to disclose.
More informationThe Center for PERSONALIZED DIAGNOSTICS
The Center for PERSONALIZED DIAGNOSTICS Precision Diagnostics for Personalized Medicine A joint initiative between The Department of Pathology and Laboratory Medicine & The Abramson Cancer Center The (CPD)
More informationStructure and Function of Fusion Gene Products in. Childhood Acute Leukemia
Structure and Function of Fusion Gene Products in Childhood Acute Leukemia Chromosomal Translocations Chr. 12 Chr. 21 der(12) der(21) A.T. Look, Science 278 (1997) Distribution Childhood ALL TEL-AML1 t(12;21)
More informationASBMT MDS/MPN Update Sunil Abhyankar, MD
ASBMT MDS/MPN Update Sunil Abhyankar, MD Professor of Medicine Medical Director, Pheresis and Cell Processing Division of Hematologic Malignancies and Cellular Therapeutics Department of Internal Medicine
More informationDisclosures. I do not have anything to disclose. Shared Features of MPNs. Overview. Diagnosis and Molecular Monitoring in the
Myeloproliferative Neoplasms: Diagnosis and Molecular Monitoring in the Target Therapy Era C. Cameron Yin, M.D., Ph.D. Department of Hematopathology UT MD Anderson Cancer Center Disclosures I do not have
More informationGenetic and epigenetic alterations of myeloproliferative disorders
Int J Hematol (2013) 97:183 197 DOI 10.1007/s12185-012-5-2 PROGRESS IN HEMATOLOGY Genetic and epigenetic alterations in hematopoietic malignancies Genetic and epigenetic alterations of myeloproliferative
More informationWHO Classification 7/2/2009
Least Malignant Myeloproliferative Disorders Myelodysplastic Syndromes Most Malignant Acute Leukemia Classifying Hematopoietic Disorders French-American-British (FAB) World Health Organization (WHO) Thanks
More informationMyeloproliferative Neoplasms: Diagnosis and Molecular Monitoring in the Era of Target Therapy
Myeloproliferative Neoplasms: Diagnosis and Molecular Monitoring in the Era of Target Therapy C. Cameron Yin, M.D., Ph.D. Department of Hematopathology UT MD Anderson Cancer Center Disclosures I do not
More informationNew drugs in Acute Leukemia. Cristina Papayannidis, MD, PhD University of Bologna
New drugs in Acute Leukemia Cristina Papayannidis, MD, PhD University of Bologna Challenges to targeted therapy in AML Multiple subtypes based upon mutations/cytogenetic aberrations No known uniform genomic
More informationPlease Silence Your Cell Phones. Thank You
Please Silence Your Cell Phones Thank You Utility of NGS and Comprehensive Genomic Profiling in Hematopathology Practice Maria E. Arcila M.D. Memorial Sloan Kettering Cancer Center New York, NY Disclosure
More informationThe Challenges of Precision Medicine: New Advances in Molecular Diagnostic Testing- Impact for Healthcare
The Challenges of Precision Medicine: New Advances in Molecular Diagnostic Testing- Impact for Healthcare Jessica Wang-Rodriguez, MD Chief, VISN22 Consolidated Pathology and Laboratory Medicine Services
More information9/25/2017. Disclosure. I have nothing to disclose. Young S. Kim MD Dept. of Pathology
Disclosure MAST CELLNEOPLASM I have nothing to disclose. Young S. Kim MD Dept. of Pathology 1 Objectives What is mast cell lineage? Changes in updated WHO 2016 mastocytosis Issues of Mastocytosis CD30
More informationDiagnostic Approach for Eosinophilia and Mastocytosis. Curtis A. Hanson, M.D.
Diagnostic Approach for Eosinophilia and Mastocytosis Curtis A. Hanson, M.D. 2014 MFMER slide-1 DISCLOSURES: Relevant Financial Relationship(s) None Off Label Usage None 2014 MFMER slide-2 Molecular Classification
More informationMutation Patterns of 16 Genes in Primary and Secondary Acute Myeloid Leukemia (AML) with Normal Cytogenetics
Mutation Patterns of 16 Genes in Primary and Secondary Acute Myeloid Leukemia (AML) with Normal Cytogenetics Marta Fernandez-Mercado 1, Bon Ham Yip 1, Andrea Pellagatti 1, Carwyn Davies 1, María José Larrayoz
More informationThe role of mutations in epigenetic regulators in myeloid malignancies
Brittany A. Woods Ross L. Levine The role of mutations in epigenetic regulators in myeloid malignancies Authors addresses Brittany A. Woods 1,2, Ross L. Levine 1,2,3 1 Louis V. Gerstner Sloan Kettering
More informationJAK2 V617F analysis. Indication: monitoring of therapy
JAK2 V617F analysis BCR-ABL genotyping The exact chromosomal defect in Philadelphia chromosome is a translocation. Parts of two chromosomes, 9 and 22, switch places. The result is a fusion gene, created
More informationMDS/MPN: What it is and How it Should be Treated?
MDS/MPN: What it is and How it Should be Treated? MDS MPN Rachel Salit, MD Assistant Member Fred Hutchinson Cancer Research Center rsalit@fredhutch.org MDS Founda>on Pa>ent & Family Forum: May 20, 2017
More informationTreatments and Current Research in Leukemia. Richard A. Larson, MD University of Chicago
Treatments and Current Research in Leukemia Richard A. Larson, MD University of Chicago 2 Acute (rapid progression) Myeloid Acute myeloid leukemia (AML) Acute promyelocytic leukemia (APL) Lymphoid Acute
More informationMRD in CML (BCR-ABL1)
MRD in CML (BCR-ABL1) Moleculaire Biologie en Cytometrie cursus Barbara Denys LAbo Hematologie UZ Gent 6 mei 2011 2008 Universitair Ziekenhuis Gent 1 Myeloproliferative Neoplasms o WHO classification 2008:
More informationBCR ABL1 like ALL: molekuliniai mechanizmai ir klinikinė reikšmė. IKAROS delecija: molekulinė biologija, prognostinė reikšmė. ASH 2015 naujienos
BCR ABL1 like ALL: molekuliniai mechanizmai ir klinikinė reikšmė. IKAROS delecija: molekulinė biologija, prognostinė reikšmė. ASH 2015 naujienos Ph like ALL BCR ABL1 like acute lymphoblastic leukemia (ALL)
More informationGenomic Methods in Cancer Epigenetic Dysregulation
Genomic Methods in Cancer Epigenetic Dysregulation Clara, Lyon 2018 Jacek Majewski, Associate Professor Department of Human Genetics, McGill University Montreal, Canada A few words about my lab Genomics
More informationCase #16: Diagnosis. T-Lymphoblastic lymphoma. But wait, there s more... A few weeks later the cytogenetics came back...
Case #16: Diagnosis T-Lymphoblastic lymphoma But wait, there s more... A few weeks later the cytogenetics came back... 46,XY t(8;13)(p12;q12)[12] Image courtesy of Dr. Xinyan Lu Further Studies RT-PCR
More informationMyelodysplastic Syndromes. Post-ASH meeting 2014 Marie-Christiane Vekemans
Myelodysplastic Syndromes Post-ASH meeting 2014 Marie-Christiane Vekemans Agenda New biological developments Risk assessment and prognostic factors New therapeutic options Agenda New biological developments
More informationMethylation status of SOCS1 and SOCS3 in BCR-ABL negative and. JAK2V617F negative chronic myeloproliferative disorders.
Methylation status of SOCS1 and SOCS3 in BCR-ABL negative and JAK2V617F negative chronic myeloproliferative disorders. To the Editor BCR-ABL negative Chronic Myeloproliferative Disorders (s) are a heterogeneous
More informationObjectives. Morphology and IHC. Flow and Cyto FISH. Testing for Heme Malignancies 3/20/2013
Molecular Markers in Hematologic Malignancy: Ways to locate the needle in the haystack. Objectives Review the types of testing for hematologic malignancies Understand rationale for molecular testing Marcie
More informationCharacterization of MPL-mutated myeloid neoplasms: a review of 224 MPL+ cases
Article Characterization of MPL-mutated myeloid neoplasms: a review of 224 MPL+ cases Keming Lin 1,*, Gang Xu 1, Jie-Gen Jiang 1, Mayuko Imai 1, Zhao Wu 1, Paris Petersen 1, Kim Janatpour 1, and Bashar
More informationMolecular profiling in confirming the diagnosis of early myelodysplastic syndrome
Molecular profiling of early MDS Hematopathology - March 2016 Article Molecular profiling in confirming the diagnosis of early myelodysplastic syndrome Maya Thangavelu 1,*, Ryan Olson 2, Li Li 2, Wanlong
More informationRUNX1 and FPD/AML Translational Research. The Leukemia and Lymphoma Society / Babich Family Foundation Partnership. September 2016
www.lls.org www.runx1.com RUNX1 and FPD/AML Translational Research The Leukemia and Lymphoma Society / Babich Family Foundation Partnership September 2016 Prepared by L. Greenberger, PhD Chief Scientific
More informationSH A CASE OF PERSISTANT NEUTROPHILIA: BCR-ABL
SH2017-0124 A CASE OF PERSISTANT NEUTROPHILIA: BCR-ABL NEGATIVE John R Goodlad 1, Pedro Martin-Cabrera 2, Catherine Cargo 2 1. Department of Pathology, NHS Greater Glasgow & Clyde, QEUH, Glasgow 2. Haematological
More informationReview Article Myeloid Neoplasias: What Molecular Analyses Are Telling Us
International Scholarly Research Network ISRN Oncology Volume 2012, Article ID 321246, 7 pages doi:10.5402/2012/321246 Review Article Myeloid Neoplasias: What Molecular Analyses Are Telling Us Luciana
More informationAllogeneic Hematopoietic Stem-Cell Transplantation for Myelodysplastic Syndromes and Myeloproliferative Neoplasms. Policy Specific Section:
Medical Policy Allogeneic Hematopoietic Stem-Cell Transplantation for Myelodysplastic Syndromes and Myeloproliferative Type: Medical Necessity and Investigational / Experimental Policy Specific Section:
More informationTest Name Results Units Bio. Ref. Interval. Positive
LL - LL-ROHINI (NATIONAL REFERENCE 135091534 Age 36 Years Gender Female 1/9/2017 120000AM 1/9/2017 105316AM 2/9/2017 104147AM Ref By Final LEUKEMIA GENETIC ROFILE ANY SIX MARKERS, CR QUALITATIVE AML ETO
More informationChronic Myelomonocytic Leukemia with molecular abnormalities SH
Chronic Myelomonocytic Leukemia with molecular abnormalities SH2017-0351 Madhu P. Menon MD,PhD, Juan Gomez MD, Kedar V. Inamdar MD,PhD and Kristin Karner MD Madhu P Menon, MD, PhD Henry Ford Hospital Patient
More information