Supporting Information
|
|
- Janice Taylor
- 5 years ago
- Views:
Transcription
1 Supporting Information Amide Synthesis via Aminolysis of Ester or Acid with an Intracellular Lipase Shichao Zeng, a Ji Liu, a Sampson Anankanbil, b Ming Chen, a Joseph P. Adams, c Radka Snajdrova c and Zhi Li *a a. Department of Chemical and Biomolecular Engineering, National University of Singapore, 4 Engineering Drive 4, Singapore b. Department of Engineering, Faculty of Science and Technology, Aarhus University, 8000 Aarhus, Denmark c. Chemical Sciences, GSK R&D Medicines Research Centre, Gunnelswood Road, Stevenage, SG1 2NY, UK The authors contributed equally to this work. * Corresponding author. chelz@nus.edu.sg S1
2 Table of Contents 1. Chemicals... S3 1.1 Chemicals for analysis... S3 1.2 Chemicals for the preparation of product standards and biotransformation... S3 1.3 Chemicals for strain screening... S4 1.4 Chemicals for protein purification... S4 2. Strains, plasmids and biochemicals... S4 3. HPLC analysis... S5 4. SDS-PAGE analysis... S6 5. Molecular weight determination of purified his-tagged SpL... S6 6. Preparation of product standards... S7 6.1 Preparation of N-benzylhexanamide 3a... S7 6.2 Preparation of N-benzylcyclohexanecarboxamide 3b... S8 6.3 Preparation of N-benzylbenzenepropanamide 3d... S8 6.4 Preparation of N-phenylbenzenepropanamide 3e... S8 6.5 Preparation of N-(2-phenylethyl)benzenepropanamide 3f... S9 6.6 Preparation of N-pentylbenzenepropanamide 3g... S9 6.7 Preparation of (rac)-α-hydroxy-n-(phenylmethyl)benzeneacetamide 3h... S9 6.8 Preparation of (rac)-n-(1-cyclohexylethyl)benzenepropanamide 3i... S Preparation of (rac)-n-(1-phenylethyl)benzenepropanamide 3j... S10 7. Determination of the activity of E. coli (SpL) cells for the hydrolysis of PNPB... S11 8. CALB-catalyzed aminolysis of ester in the presence of water... S12 9. General procedure for aminolysis of esters to give amides 3a-g and (R)-3h-j with free CALB... S NMR spectra... S HRMS spectra... S HPLC chromatograms... S26 S2
3 1. Chemicals All the following chemicals were obtained from commercial suppliers and used without further purification. 1.1 Chemicals for analysis 4-nitrophenyl butyrate (>98%), dipotassium phosphate (>98%), monopotassium phosphate (>99.0%), tert-butyl methyl ether (99.8%) and benzyl alcohol (>99.0%) were purchased from Sigma Aldrich. Acetonitrile (HPLC grade) and n-hexane (HPLC grade) were purchased from Tedia. Isopropanol (HPLC grade) and Chloroform (HPLC) were purchased from Fisher. 1.2 Chemicals for the preparation of product standards and biotransformation Methyl hexanoate 1a (>99%), methyl cyclohexanecarboxylate 1b (>98%), methyl benzoate 1c (99%), hexanoic acid 4b (>99.5%), octanoic acid 4c (>98%), decanoic acid 4d (>98%), oleic acid 4e (>99%), cyclopentanenoic acid 4f (>99%), cyclohexanecarboxylic acid 4g (>98%),, mandelic acid 4h (99%), (rac)-methyl mandelate 1e (97%), methyl (S)-(+)- mandelate (S)-1e (>99%), benzylamine 2a (99%), aniline 2b (>99.5%), phenethylamine 2c (>99%), amylamine 2d (99%), (R)-(-)-1-cyclohexylethylamine (R)-2e (98%), (S)-(+)-1- cyclohexylethylamine (S)-2e (98%), α-methylbenzylamine 2f (99%), (R)-(+)-αmethylbenzylamine (R)-2f (98%), N-benzylbenzamide 3c (98%), molecular sieve 4A (powder, 325 mesh), sodium sulfate (>99%), N-(3-Dimethylaminopropyl)-N - ethylcarbodiimide hydrochloride (EDC, >99%) and dichloromethane (>99.8%) were purchased from Sigma Aldrich. Methyl 3-phenylpropionate 1d (>98%) and 3- phenylpropionic acid 4a (>98.0%) were purchased from TCI. Ethyl acetate (HPLC grade) was purchased from Fisher. Novozyme 435 is a gift from Novozymes (Bagsvaerd, Denmark). S3
4 1.3 Chemicals for strain screening ctane (>99%), sodium phosphate dibasic heptahydrate (>99.99%), sodium chloride (>99.5%), ammonium chloride (>99.5%), magnesium sulfate (>99.5%) and calcium chloride dihydrate (>99%) were purchased from Sigma Aldrich. 1.4 Chemicals for protein purification Imidazole (>99%) and sodium phosphate monobasic monohydrate (>98%) were purchased from Sigma Aldrich. 2. Strains, plasmids and bio-reagents Escherichia coli T7 expression strain, restriction enzymes (NdeI, Bgl II, BamHI and XhoI) and T4 DNA quick ligase were purchased from New England Biolabs. Expression vector prsfduet-1 was acquired from Novagen. ligoes (primers), IPTG (>99%), agarose (molecular biology grade), and 10 TAE buffer (ultrapure grade) were purchased from 1st BASE, Singapore. Kanamycin (>99%) and glycerol (>99%) were purchased from Sigma Aldrich. Phusion DNA polymerase, plasmid miniprep kit, gel extraction kit and PCR purification kit were purchased from Thermo Scientific. DNeasy blood & tissue kit was bought from Qiagen. LB broth, LB agar, tryptone and yeast extract were purchased from Biomed Diagnostics. Free Candida antarctica lipase B (CALB) was bought from SPRIN technologies. 4% 12% NuPAGE Bis-Tris precast gel (in MES-SDS Running Buffer) was acquired from life technologies. DNA sequencing was carried out by 1st BASE, Singapore. S4
5 3. HPLC analysis N-pentylhexanamide was analyzed on an Agilent 7890A gas chromatography equipped with a HP-5 capillary column (30 m 322 µm 0.25 µm) with inlet temperature of 280 o C and detector temperature of 300 o C. The temperature program used was: 40 o C keep for 1 min, then increase to 120 o C at a rate of 5 o C/ minute, then increase to 250 o C at a rate of 10 o C/minute. The retention time for N-pentylhexanamide is min. 3a-3j were analyzed on a Shimadzu prominence HPLC system (LC-20AD, normal phase) equipped with a Diacel Chiralpak IA-3 column ( mm, 3 µm). The UV detection wavelength was set at 210 nm. ven temperature was set at 25 o C. The mobile phase consisted of a mixture of n-hexane and isopropanol at a flow rate of 1 ml/min. 3k-n were analyzed on a Shimadzu prominence HPLC system (LC-20AD, normal phase) equipped with an Agilent RX-SIL column ( mm). The UV detection wavelength was set at 210 nm. ven temperature was set at 25 o C. The mobile phase consisted of a mixture of n-hexane (with 0.1% triacetic acid) and isopropanol at a flow rate of 1 ml/min. Table S1. HPLC Analysis Conditions and the Retention Time for 3a-3j Product RT n-hexane: isopropanol 3a 7.9 min 90: 10 3b 9.1 min 90: 10 3c 16.1 min 90: 10 3d 11.2 min 90: 10 3e 11.3 min 90: 10 3f 9.8 min 90: 10 3g 7.0 min 90: 10 (R)-3h 13.8 min (S)-3h 20.4 min 90: 10 (R)-3i 11.1 min (S)-3i 13.5 min 95: 5 (R)-3j 8.4 min (S)-3j 10.6 min 90: 10 3a 3.1 min 90: 10 3k 2.9 min 90: 10 3l 2.8 min 90: 10 3m 4.0 min 95: 5 3n 3.1 min 90: 10 S5
6 4. SDS-PAGE analysis SDS-PAGE was used to analyze the protein expression level of E.coli (his-tagged SpL). The freshly harvested cells were suspended in DI water to an D 600 of 10. The cells were passed through a homogenizer (Stansted fluid power LTD) twice, followed by centrifugation to give the cell-free extract (CFE). The CFE was mixed with 2 SDS loading buffer at a volume ratio of 1:1, heated at 95 o C for 5 min and subjected to SDS-PAGE analysis according to the standard method. 5. Molecular weight determination of purified his-tagged SpL The molecular weight of the purified his-tagged SpL was determined by MALDI-TF-MS. The results are given below: Calculated mass (Da) for 6 his-tagged SpL is , based on the amino acid sequence: MGSSHHHHHHSQDPMTDSTTHYTRPDVAAFLAFLNAQEGPKMEEMPPAGAREMM RVMGQLADVPRGEIAKVEDRMIPGPDGDIPIRLYDNRPDREAGPVMVFYHGGGWVI GDLETHDPYCAEAARILPVIAIDYRLAPEHPFPAAPIDCEAATRWVADNIACTGLVLS GDSAGGNLTIVTALALRDEPAAKPVIAIHPIYPAVTTHNDWQSYRDFGEGHLLTEGS MTWFGNHYAADPADRRAAPIDFPADGLPTLITASLDPLRDQGRAYAAKLIEAGVPTT YREAKGTIHGYICLAQGIPSAKDDIRGALTVLKAIVAEATGAA Measured mass (Da) for 6 his-tagged SpL is The decrease of Da suggested the N-terminal des-met protein. S6
7 Figure S1. Mass spectrum of 6 his-tagged SpL 6. Preparation of product standards 6.1 Preparation of N-benzylhexanamide 3a Hexanoic acid 4b (239.3 mg, 2.06 mmol), benzylamine 2a (214.3 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards, the solvent was evaporated and the crude product was washed with 20% ethanol and water and then, dried in vacuum oven for overnight to give N-benzylhexanamide 3a as white solid at 60% isolated yield. 1 H NMR (400 MHz, CDCl 3 ) δ (m, 5H), (s, br, 1H), (d, 2H, J = 5.6 Hz), (t, 2H, J = 7.6 Hz), (m, 2H), (m, 4H), (t, 3H, J = 6.8 Hz); 13 C NMR: (100 MHz, CDCl 3 ) δ , , , , , 43.52, 36.70, 31.43, 25.40, 22.33, S7
8 6.2 Preparation of N-benzylcyclohexanecarboxamide 3b Cyclohexanecarboxylic acid 4g (264 mg, 2.06 mmol), benzylamine 2a (214.3 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. After reaction the solvent was evaporated. The crude product was washed with 20% ethanol and water and then, dried in vacuum oven for overnight to give N-benzylcyclohexanecarboxamide 3b as white solid at 71% isolated yield. 1 H NMR (400 MHz, CDCl 3 ) δ (m, 5H), (s, br, 1H), (d, 2H, J = 5.6 Hz), (tt, 1H, J=12.0, 3.6 Hz), (m, 4H), (m, 1H), (m, 2H), (m, 3H); 13 C NMR: (100 MHz, CDCl 3 ) δ , , , , , , , , Preparation of N-benzylbenzenepropanamide 3d 3-Phenylpropionic acid 4a (309.4 mg, 2.06 mmol), benzylamine 2a (214.3 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards, the solvent was evaporated and the crude product was washed with 20% ethanol and water and then, dried in vacuum oven for overnight to give N-benzylbenzenepropanamide 3d as white solid at 56% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 10H), (s, br, 1H), (d, 2H, J = 5.6 Hz), (t, 2H, J=7.6 Hz), (t, 2H, J = 7.6 Hz); 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , , , , , 43.54, 38.44, Preparation of N-phenylbenzenepropanamide 3e The reaction mixture contained 30 ml n-hexane, 2.4 ml water, 150 mg lyophilized SpL enzyme, methyl 3-phenylpropionate 1d (328 mg, 2 mmol) and aniline 2b (279 mg, 3 mmol). The mixture was incubated at 30 o C and stirred at 500 rpm for 2 h. The product was extracted using 50 ml dichloromethane. The resulting organic phase was taken and solvent was evaporated. The resulting content was purified using flash chromatography with n- S8
9 hexane:ethyl acetate (10:1) eluent to give N-phenylbenzenepropanamide 3e as white solid with 61% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 11H), (t, 2H, J = 7.6 Hz), (t, 2H, J = 7.6 Hz); 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , , , , , , IR (KBr): 3321, 1654 cm -1 ; ESI-MS m/z ([M+Na] + ); HRMS (ESI) for C 15 H 15 NNa +, calculated , found Preparation of N-(2-phenylethyl)benzenepropanamide 3f 3-Phenylpropionic acid 4a (309.4 mg, 2.06 mmol), phenethylamine 2c (243.6 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards the solvent was evaporated and the crude product was washed with 20% ethanol and water and then, dried in vacuum oven for overnight to give N-(2-phenylethyl)benzenepropanamide 3f as white solid at 77% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 10H), (s, br, 1H), (t, 2H, J=6.8 Hz), (t, 2H, J = 7.6 Hz), (t, 2H, J = 6.8 Hz), (t, 2H, J = 7.6 Hz); 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , , , , , 40.51, 38.47, 35.62, Preparation of N-pentylbenzenepropanamide 3g 3-Phenylpropionic acid 4a (309.4 mg, 2.06 mmol), amylamine 2d (174.3 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards, the solvent was evaporated and the crude product was washed with 20% ethanol and water and then, dried in vacuum oven for overnight to give N-pentylbenzenepropanamide 3g as white solid at 62% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 5H), (s, br, 1H), (t, 2H, J=7.2 Hz), (t, 2H, J = 7.6 Hz), (t, 2H, J = 7.6 Hz), (m, 2H), (m, 4H), (t, 3H, J = 7.2 Hz). 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , 39.46, 38.53, 31.76, 29.20, 28.93, 22.27, Preparation of (rac)-α-hydroxy-n-(phenylmethyl)benzeneacetamide 3h S9
10 Mandelic acid 4h (313.4 mg, 2.06 mmol), benzylamine 2a (214.3 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards the solvent was evaporated and the crude product was purified using flash chromatography (n-hexane:ethyl acetate=2:1) to give (rac)-α-hydroxy-n- (phenylmethyl)benzeneacetamide 3h as white solid at 37% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 10H), (s, br, 1H), (s, 1H), (m, 2H); 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , , , , , , 74.16, Preparation of (rac)-n-(1-cyclohexylethyl)benzenepropanamide 3i 3-phenylpropionic acid 4a (309.4 mg, 2.06 mmol), (rac)-1-cyclohexylethylamine 2e (254.5 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards the solvent was evaporated and the crude product was purified using flash chromatography (n-hexane:ethyl acetate=5:1) to give (rac)-n-(1-cyclohexylethyl) benzenepropanamide 3i as white solid at 11% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 5H), (s, br, 1H), (m, 1H), (t, 2H, J = 7.2 Hz), (t, 2H, J=6.8 Hz), (m, 5H), (m, 4H), (d, 3H, J = 6.8 Hz), (m, 2H). 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , 49.19, 42.91, 38.73, 31.81, 28.87, 28.82, 26.31, 26.11, 26.10, 17.79; IR (KBr): 3309, 1639 cm -1 ; ESI-MS m/z ([M+Na] + ); HRMS (ESI) for C 17 H 25 NNa +, calculated , found Preparation of (rac)-n-(1-phenylethyl)benzenepropanamide 3j 3-Phenylpropionic acid 4a (309.4 mg, 2.06 mmol), (rac)-α-methylbenzylamine 2f (242.4 mg, 2 mmol), EDC (479.3 mg, 2.5 mmol) and 10 ml dichloromethane were added into a 50 ml round bottom flask. The reaction was conducted at room temperature for 12 h. Afterwards the S10
11 solvent was evaporated and the crude product was purified using flash chromatography (nhexane:ethyl acetate=2:1) to give (rac)-n-(1-phenylethyl)benzenepropanamide 3j as white solid at 23% isolated yield. 1 H NMR (400 MHz, CDCl 3 ): δ (m, 10H), (s, br, 1H), (m, 1H), (t, 2H, J = 7.6 Hz), (t, 2H, J=8 Hz), (d, 3H, J=7.2 Hz); 13 C NMR (100 MHz, CDCl 3 ): δ , , , , , , , , , 48.57, 38.54, 31.69, Determination of the activity of E. coli (SpL) cells for the hydrolysis of PNPB Freshly prepared E. coli (SpL) cells were suspended in KP buffer (100 mm, ph 7.5) to 0.5 g cdw/l. The cell suspension was then passed through a cell homogenizer (Stansted fluid power LTD) twice, and cell-free extract (CFE) was obtained by removal of cell debris via centrifugation. The CFE was diluted with KP buffer (100 mm, ph 7.5) properly to a fixed protein concentration and 10 µl of the diluted cell-free extract was added to 990 µl of KP buffer (100 mm, ph 7.5). 10 µl of 50 mm PNPB acetonitrile solution was added and the absorption at 400 nm was monitored by a photometer. The specific activity was calculated based on the UV absorption, extinction coefficient of p-nitrophenol, pass length, reaction time, and protein concentration. df = Dilution factor = Micromolar extinction coefficient of p-nitrophenol at 400 nm 0.01 = Volume (in ml) of enzyme used S11
12 8. CALB-catalyzed aminolysis of ester in the presence of water A mixture consisting of 10 mm methyl hexanoate 1a, 20 mm benzylamine 2a, and 10 mg free CALB in 5 ml n-hexane containing 0-8% (v/v) water was shaken at 250 rpm and 30 ºC. For the case of 0% (v/v) water, 200 mg of activated 4A molecular sieve was added to ensure totally anhydrous condition. Specific activity was measured at 30 min, and amide yield was determined at 20 h. 120 Specific activity (U/g protein) Final amide yield (%) % 0.50% 1% 2% 4% 8% Water content (%) Figure S2. Effect of water content on aminolysis of methyl hexanoate 1a with benzylamine 2a catalyzed by free CALB in n-hexane. : Specific activity (U/g protein); : Final amide yield (%). 9. General procedure for aminolysis of esters to give amides 3a-g and (R)- 3h-j with free CALB Free CALB was prepared by removing the glycerol and salts inside the commercially available CALB solution from SPRIN by washing the enzyme solution with deionized water in an Amicon Ultra-15 Centrifugal Filter Units (20 kd). The dry enzyme powder was acquired by lyophilizing the enzyme solution for at least 24 h. 10 mg free CALB was added to a 10 ml shaking flask containing 5 ml n-hexane, 200 mg activated 4A molecular sieve powder and 20 mm amine 2a-f. 10 mm ester 1a-e was then S12
13 added to initiate the reaction and the mixture was shaken at 30 C, and 250 rpm. Specific activity was measured at 30 min. Amide yield was determined at 20 h. Table S2. Synthesis of Amide 3a-g via Aminolysis of Ester 1a-d with Amine 2a-d by Using CALB. R 1 1 1a: R 1 = n-pentyl 1b: R 1 = Cy 1c: R 1 = Ph 1d: R 1 = PhCH 2 CH 2 1d 1d 1d + R 2 NH 2 Enzyme R 2 R 1 NH 2 3 2a: R 2 = PhCH 2 2a 2a 2a 2b: R 2 = Ph 2c: R 2 = PhCH 2 CH 2 2d: R 2 = n-pentyl + CH 3 H 3a: R 1 = n-pentyl; R 2 = PhCH 2 3b: R 1 = Cy; R 2 = PhCH 2 3c: R 1 = Ph; R 2 = PhCH 2 3d: R 1 = PhCH 2 CH 2 ; R 2 = PhCH 2 3e: R 1 = PhCH 2 CH 2 ; R 2 = Ph 3f: R 1 = PhCH 2 CH 2 ; R 2 = PhCH 2 CH 2 3g: R 1 = PhCH 2 CH 2 ; R 2 = n-pentyl CALB a Activity (U/g) b Yield (%) c 21.5 > a The reaction was performed with 10 mm of ester 1a-d and 20 mm of amine 2a-d in 5 ml anhydrous n-hexane containing 10 mg of free enzyme. b Specific activity (U/g enzyme) was determined after 30 min. c Yield (%) of the amide was determined after 20 h. Table S3. Enantioselective Aminolysis of Ester with Amine to Synthesize Chiral Amides by Using Free CALB. Entry a Enzyme Ester Amine Product Time (h) Activity (U/g enzyme) b ee p (%) c Yield (%) c E e 1 CALB 1e 2a (R)-3h CALB 1d 2e (R)-3i d CALB 1d 2f (R)-3j d a The reaction was performed with 10 mm of ester and 20 mm of amine in 5 ml anhydrous n-hexane with 10 mg of pure enzyme. b Specific activity (U/g enzyme) was determined after 30 min. c ee p (%) and yield (%) of the amide were determined after the time stated in the table d Specific activity was determined after 20 h. The specific activity at 30 min was too low to be detectable. e E was calculated according to the equation E=ln [1-c (1+ee p )]/ln [1-c (1-ee p )], c is the conversion. S13
14 10. NMR spectra a) N H 3a b) Figure S3. a) 1 H NMR spectrum of 3a. b) 13 C NMR spectrum of 3a. 3a was prepared via aminolysis of ester 3a with amine 2a by using SpL. S14
15 a) b) Figure S4. a) 1 H NMR spectrum of 3b. b) 13 C NMR spectrum of 3b. 3b was prepared via aminolysis of ester 3b with amine 2a by using SpL. S15
16 a) b) Figure S5. a) 1 H NMR spectrum of 3d. b) 13 C NMR spectrum of 3d. 3d was prepared via aminolysis of ester 3d with amine 2a by using SpL. S16
17 Figure S6. a) 1 H NMR spectrum of 3a. b) 13 C NMR spectrum of 3a. 3a was prepared via aminolysis of hexanoic acid 4b with benzylamine 2a by using E. coli (SpL). S17
18 a) b) Figure S7. a) 1 H NMR spectrum of 3k. b) 13 C NMR spectrum of 3k. 3k was prepared via aminolysis of octanoic acid 4c with benzylamine 2a by using E. coli (SpL). S18
19 a) NH 3l b) Figure S8. a) 1 H NMR spectrum of 3l. b) 13 C NMR spectrum of 3l. 3l was prepared via aminolysis of decanoic acid 4d with benzylamine 2a by using E. coli (SpL). S19
20 a) b) Figure S9. a) 1 H NMR spectrum of 3m. b) 13 C NMR spectrum of 3m. 3m was prepared via aminolysis of oleic acid 4e with benzylamine 2a by using E. coli (SpL). S20
21 a) b) Figure S10. a) 1 H NMR spectrum of 3n. b) 13 C NMR spectrum of 3n. 3n was prepared via aminolysis of cyclopentanecarboxylic acid 4f with benzylamine 2a by using E. coli (SpL). S21
22 11. HRMS spectra [M+Na] + [M+Na+ACN]+ [M+H] + Figure S11. HRMS spectrum of 3a. 3a was prepared via aminolysis of ester with SpL. [M+H] + [M+Na] + + [M+Na+ACN] Figure S12. HRMS spectrum of 3b. 3b was prepared via aminolysis of ester with SpL. [M+Na] + [M+H] + Figure S13. HRMS spectrum of 3d. 3d was prepared via aminolysis of ester with SpL. S22
23 Figure S14. HRMS spectrum of 3a. 3a was prepared via aminolysis of hexanoic acid 4b with benzylamine 2a catalyzed by E.coli (SpL). [M+H] + S23
24 Figure S15. HRMS spectrum of 3k. 3k was prepared via aminolysis of octanoic acid 4c with benzylamine 2a catalyzed by E.coli (SpL). [M+H] + Figure S16. HRMS spectrum of 3l. 3l was prepared via aminolysis of decanoic acid 4d with benzylamine 2a catalyzed by E.coli (SpL). [M+H] + Figure S17. HRMS spectrum of 3m. 3m was prepared via aminolysis of oleic acid 4e with benzylamine 2a catalyzed by E.coli (SpL). S24
25 [M+H] + Figure S18. HRMS spectrum of 3n. 3n was prepared via aminolysis of cyclopentanenoic acid 4f with benzylamine 2a catalyzed by E.coli (SpL). S25
26 12. HPLC chromatograms + NH 2 SpL N H 1a 2a 3a a) 3a b) 3a Figure S19. a) Normal phase HPLC chromatogram of 3a prepared by condensation of hexanoic acid 4c and benzylamine 2a. b) Normal phase HPLC chromatogram of the reaction mixture of SpLcatalyzed aminolysis of 1a with 2a at 30 min. S26
27 + NH 2 SpL N H 1b 2a 3b a) 3b b) 3b Figure S20. a) Normal phase HPLC chromatogram of 3b prepared by condensation of cyclohexanecarboxylic acid 4b and benzylamine 2a. b) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1b with 2a at 30 min. S27
28 + NH 2 SpL N H 1c 2a 3c a) 3c b) 1c 3c Figure S21. a) Normal phase HPLC chromatogram of 3c (Sigma-Aldrich). b) Normal phase HPLC chromatogram of the reaction mixture from SpL-catalyzed aminolysis of 1c with 2a at 30 min. S28
29 + NH 2 SpL N H 1d 2a 3d a) 3d b) 3d 1d Figure S22. a) Normal phase HPLC chromatogram of 3d prepared by condensation of 3- phenylpropionic acid 4a and benzylamine 2a. b) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with 2a at 30 min. S29
30 + NH 2 SpL N H 1d 2b 3e a) 3e b) 1d 2b 3e Figure S23. a) Normal phase HPLC chromatogram of 3e prepared by SpL-catalyzed aminolysis of 1d with 2b. b) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with 2b at 30 min. S30
31 + NH 2 SpL N H 1d 2c 3f a) 3f b) 3f 1d Figure S24. a) Normal phase HPLC chromatogram of 3f prepared by condensation of 3- phenylpropionic acid 4a and phenethylamine 2c. b) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with 2c at 30 min. S31
32 + NH 2 SpL N H 1d 2d 3g a) 3g b) 1d 3g Figure S25. a) Normal phase HPLC chromatogram of 3g prepared by condensation of 3- phenylpropionic acid 4a and amylamine 2d. b) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with 2d at 30 min. S32
33 H + NH 2 SpL H NH 1e 2a 3h a) (R)-3h (S)-3h b) (S)-3h (R)-3h c) (R)-3h (S)-3h Figure S 26. a) Normal phase HPLC chromatogram of racemic 3h prepared by condensation of mandelic acid 4d and benzylamine 2a. b) Normal phase HPLC chromatogram of the reaction mixture of Novozyme 435-catalyzed aminolysis of (S)-1e with 2a. c) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of racemic 1e with 2a at 30 min. S33
34 + H 2 N SpL NH 1d 2e 3i a) (R)-3i (S)-3i b) (R)-3i c) (R)-3i (S)-3i Figure S27. a) Normal phase HPLC chromatogram of racemic 3i prepared by condensation of 3- phenylpropionic acid 4a and 1-cyclohexylethylamine 2e. b) Normal phase HPLC chromatogram of the reaction mixture of Novozyme 435-catalyzed aminolysis of 1d with (R)-2e. c) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with racemic 2e at 30 min. S34
35 + H 2 N SpL NH 1d 2f 3j a) (R)-3j (S)-3j b) (R)-3j c) 1d (R)-3j (S)-3j Figure S28. a) Normal phase HPLC chromatogram of racemic 3j prepared by condensation of 3- phenylpropionic acid 4a and α-methylbenzylamine 2f. b) Normal phase HPLC chromatogram of the reaction mixture of Novozyme 435-catalyzed aminolysis of 1d with (R)-2f. c) Normal phase HPLC chromatogram of the reaction mixture of SpL-catalyzed aminolysis of 1d with racemic 2f at 30 min. S35
36 CH + NH 2 SpL NH 4b 2a 3a 3a Figure S29. Normal phase HPLC chromatogram of 3a prepared from the aminolysis of hexanoic acid 4b with benzylamine 2a catalyzed by E. coli (SpL). S36
37 CH + NH 2 SpL NH 4c 2a 3k 3k Figure S30. Normal phase HPLC chromatogram of 3k prepared from the aminolysis of octanoic acid 4c with benzylamine 2a catalyzed by E. coli (SpL). S37
38 CH + NH 2 SpL NH 4d 2a 3l 3l Figure S31. Normal phase HPLC chromatogram of racemic 3l prepared from the aminolysis of decanoic acid 4d with benzylamine 2a catalyzed by E. coli (SpL). S38
39 H + NH 2 SpL N H 4e 2a 3m 3m Figure S32. Normal phase HPLC chromatogram of racemic 3m prepared from the aminolysis of oleic acid 4e with benzylamine 2a catalyzed by E. coli (SpL). S39
40 CH + NH 2 SpL NH 4f 2a 3n 3n Figure S33. Normal phase HPLC chromatogram of racemic 3n prepared from the aminolysis of cyclopentanecarboxylic acid 4f with benzylamine 2a catalyzed by E. coli (SpL). S40
ph Switchable and Fluorescent Ratiometric Squarylium Indocyanine Dyes as Extremely Alkaline Sensors
ph Switchable and Fluorescent Ratiometric Squarylium Indocyanine Dyes as Extremely Alkaline Sensors Jie Li, Chendong Ji, Wantai Yang, Meizhen Yin* State Key Laboratory of Chemical Resource Engineering,
More informationEnantioselective synthesis of anti- and syn-β-hydroxy-α-phenyl carboxylates via boron-mediated asymmetric aldol reaction
Enantioselective synthesis of anti- and syn-β-hydroxy-α-phenyl carboxylates via boron-mediated asymmetric aldol reaction P. Veeraraghavan Ramachandran* and Prem B. Chanda Department of Chemistry, Purdue
More informationSupplementary Material (ESI) for Chemical Communications This journal is (c) The Royal Society of Chemistry 2008
Experimental Details Unless otherwise noted, all chemicals were purchased from Sigma-Aldrich Chemical Company and were used as received. 2-DOS and neamine were kindly provided by Dr. F. Huang. Paromamine
More informationLewis acid-catalyzed regioselective synthesis of chiral α-fluoroalkyl amines via asymmetric addition of silyl dienolates to fluorinated sulfinylimines
Supporting Information for Lewis acid-catalyzed regioselective synthesis of chiral α-fluoroalkyl amines via asymmetric addition of silyl dienolates to fluorinated sulfinylimines Yingle Liu a, Jiawang Liu
More informationDevelopment of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells
Supporting Information for Development of a near-infrared fluorescent probe for monitoring hydrazine in serum and living cells Sasa Zhu, Weiying Lin,* Lin Yuan State Key Laboratory of Chemo/Biosensing
More informationSynthesis and Blastocyst Implantation Inhibition Potential of Lupeol Derivatives in Female Mice
Supporting Information Rec. Nat. Prod. 9:4 (2015) 561-566 Synthesis and Blastocyst Implantation Inhibition Potential of Lupeol Derivatives in Female Mice Anita Mahapatra 1*, Purvi Shah 1, Mehul Jivrajani
More informationAn Unusual Glycosylation Product from a Partially Protected Fucosyl Donor. under Silver Triflate activation conditions. Supporting information
An Unusual Glycosylation Product from a Partially Protected Fucosyl Donor under Silver Triflate activation conditions Robin Daly a and Eoin M. Scanlan* a e-mail: eoin.scanlan@tcd.ie a Trinity Biomedical
More informationmm C3a. 1 mm C3a Time (s) C5a. C3a. Blank. 10 mm Time (s) Time (s)
125 I-C5a (cpm) Fluorescnece Em 520nm a 4000 3000 2000 1000 c 0 5000 4000 3000 2000 Blank C5a C3a 6 0.3 mm C3a 7 9 10 11 12 13 15 16 0.3 mm C5a 0 300 600 900 1200 Time (s) 17 Fluorescnece Em 520nm Fluorescnece
More informationSupporting information
Supporting information Diversity Oriented Asymmetric Catalysis (DOAC): Stereochemically Divergent Synthesis of Thiochromanes Using an Imidazoline-aminophenol aminophenol (IAP)-Ni Catalyzed Michael/Henry
More informationSupporting Information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2018 Supporting Information Facile Three-Step Synthesis and Photophysical Properties of [8]-, [9]-,
More informationSimple copper/tempo catalyzed aerobic dehydrogenation. of benzylic amines and anilines
Simple copper/tempo catalyzed aerobic dehydrogenation of benzylic amines and anilines Zhenzhong Hu and Francesca M. Kerton,* Department of Chemistry, Memorial University of Newfoundland, St. John s, NL,
More informationCDI Mediated Monoacylation of Symmetrical Diamines and Selective Acylation of Primary Amines of Unsymmetrical Diamines
Supporting information: CDI Mediated Monoacylation of Symmetrical Diamines and Selective Acylation of Primary Amines of Unsymmetrical Diamines Sanjeev K. Verma*, Ramarao Ghorpade, Ajay Pratap and M. P.
More informationSupporting information to Amino-functional polyester dendrimers based on bis-mpa as nonviral vectors for sirna delivery
Supporting information to Amino-functional polyester dendrimers based on bis-mpa as nonviral vectors for sirna delivery P. Stenström, D. Manzanares, Y. Zhang, V. Ceña and M. Malkoch* * To whom correspondence
More informationNovel D-erythro N-Octanoyl Sphingosine Analogs As Chemo- and Endocrine. Resistant Breast Cancer Therapeutics
Page 11 of 32 Cancer Chemotherapy and Pharmacology Novel D-erythro N-Octanoyl Sphingosine Analogs As Chemo- and Endocrine Resistant Breast Cancer Therapeutics James W. Antoon, Jiawang Liu, Adharsh P. Ponnapakkam,
More informationp-toluenesulfonic Acid-Mediated 1,3-Dipolar Cycloaddition of
Supporting Information for: p-toluenesulfonic Acid-Mediated 1,3-Dipolar Cycloaddition of Nitroolefins with NaN 3 for Synthesis of 4-Aryl-NH-1,2,3-triazoles Xue-Jing Quan, Zhi-Hui Ren, Yao-Yu Wang, and
More informationSupporting Information. Radical fluorination powered expedient synthesis of 3 fluorobicyclo[1.1.1]pentan 1 amine
Electronic Supplementary Material (ESI) for rganic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2015 Supporting Information Radical fluorination powered expedient synthesis
More informationElectronic Supplementary Information
Electronic Supplementary Information A Novel and Facile Zn-mediated Intramolecular Five-membered Cyclization of β-tetraarylporphyrin Radicals from β-bromotetraarylporphyrins Dong-Mei Shen, Chao Liu, Qing-Yun
More informationSolid Phase Peptide Synthesis (SPPS) and Solid Phase. Fragment Coupling (SPFC) Mediated by Isonitriles
Solid Phase Peptide Synthesis (SPPS) and Solid Phase Fragment Coupling (SPFC) Mediated by Isonitriles Ting Wang a and Samuel J. Danishefsky a,b,* alaboratory for Bioorganic Chemistry, Sloan- Kettering
More informationPreparation, isolation and characterization of N α -Fmoc-peptide isocyanates: Solution synthesis of oligo-α-peptidyl ureas
SUPPORTING INFORMATION Preparation, isolation and characterization of N α -Fmoc-peptide isocyanates: Solution synthesis of oligo-α-peptidyl ureas Vommina V. Suresh Babu*, Basanagoud S. Patil, and Rao Venkataramanarao
More informationMasatoshi Shibuya,Takahisa Sato, Masaki Tomizawa, and Yoshiharu Iwabuchi* Department of Organic Chemistry, Graduate School of Pharmaceutical Sciences,
Oxoammonium ion/naclo 2 : An Expedient, Catalytic System for One-pot Oxidation of Primary Alcohols to Carboxylic Acid with Broad Substrate Applicability Masatoshi Shibuya,Takahisa Sato, Masaki Tomizawa,
More informationSupporting Information
Supporting Information Wiley-VCH 2008 69451 Weinheim, Germany Supporting Information Enantioselective Cu-catalyzed 1,4-Addition of Various Grignard Reagents to Cyclohexenone using Taddol-derived Phosphine-Phosphite
More informationElectronic Supplementary Material
Electronic Supplementary Material PAMAM Dendrimers Bearing Electron-Donating Chromophores: Fluorescence and Electrochemical Properties Bing-BingWang a, Xin Zhang a, Ling Yang a, Xin-Ru Jia* a, Yan Ji a,
More informationA biocatalytic hydrogenation of carboxylic acids
Electronic Supplementary Information (ESI) for: A biocatalytic hydrogenation of carboxylic acids Yan Ni, Peter-Leon Hagedoorn,* Jian-He Xu, Isabel Arends, Frank Hollmann* 1. General Chemicals All the carboxylic
More informationSupporting Information. Recyclable hypervalent-iodine-mediated solid-phase peptide
Supporting Information Recyclable hypervalent-iodine-mediated solid-phase peptide synthesis and cyclic peptide synthesis Dan Liu, Ya-Li Guo, Jin Qu and Chi Zhang* for Address: State Key Laboratory of Elemento-Organic
More informationChristophe Lincheneau, Bernard Jean-Denis and Thorfinnur Gunnlaugsson* Electronic Supplementary Information
Self-assembly formation of mechanically interlocked [2]- and [3]catenanes using lanthanide ion [Eu(III)] templation and ring closing metathesis reactions Christophe Lincheneau, Bernard Jean-Denis and Thorfinnur
More informationSupporting Information. Efficient copper-catalyzed Michael addition of acrylic derivatives with primary alcohols in the presence of base
Supporting Information Efficient copper-catalyzed Michael addition of acrylic derivatives with primary alcohols in the presence of base Feng Wang, a Haijun Yang, b Hua Fu, b,c * and Zhichao Pei a * a College
More informationSupporting Information
Supporting Information Wiley-VCH 2008 69451 Weinheim, Germany Enantioselective Rhodium-catalyzed Addition of Arylboronic Acids to α-ketoesters Hai-Feng Duan, Jian-Hua Xie, Xiang-Chen Qiao, Li-Xin Wang,
More informationStereoselective Aza-Darzens Reactions of Tert- Butanesulfinimines: Convenient Access to Chiral Aziridines
Stereoselective Aza-Darzens Reactions of Tert- Butanesulfinimines: Convenient Access to Chiral Aziridines Toni Moragas Solá, a Ian Churcher, b William Lewis a and Robert A. Stockman* a Supplementary Information
More informationThiol-Activated gem-dithiols: A New Class of Controllable. Hydrogen Sulfide (H 2 S) Donors
Thiol-Activated gem-dithiols: A New Class of Controllable Hydrogen Sulfide (H 2 S) Donors Yu Zhao, Jianming Kang, Chung-Min Park, Powell E. Bagdon, Bo Peng, and Ming Xian * Department of Chemistry, Washington
More informationSupporting Information
Supporting Information Wiley-VCH 2008 69451 Weinheim, Germany Chemoselective Peptide Cyclization via Induced Traceless Staudinger Ligation Rolf Kleineweischede, Christian P.R. Hackenberger* Institute for
More informationNitro-Grela-type complexes containing iodides. robust and selective catalysts for olefin metathesis
Supporting Information for Nitro-Grela-type complexes containing iodides robust and selective catalysts for olefin metathesis under challenging conditions. Andrzej Tracz, 1,2 Mateusz Matczak, 1 Katarzyna
More informationSupporting Information for. Boronic Acid Functionalized Aza-Bodipy (azabdpba) based Fluorescence Optodes for the. analysis of Glucose in Whole Blood
Supporting Information for Boronic Acid Functionalized Aza-Bodipy (azabdpba) based Fluorescence Optodes for the analysis of Glucose in Whole Blood Yueling Liu, Jingwei Zhu, Yanmei Xu, Yu Qin*, Dechen Jiang*
More informationSupporting Information. Copyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2007
Supporting Information Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2007 Organocatalytic Asymmetric Sulfa-Michael Addition to α,β- Unsaturated Ketones Paolo Ricci, Armando Carlone, Giuseppe
More informationAnalysis of fatty acid metabolism using Click-Chemistry and HPLC-MS
Analysis of fatty acid metabolism using Click-Chemistry and HPLC-MS Alexander J. Pérez and Helge B. Bode -Supporting Information- Contents Experimental section Supplementary figures NMR spectra Page S2
More informationAllenylphosphine oxides as simple scaffolds for. phosphinoylindoles and phosphinoylisocoumarins
Supporting Information for Allenylphosphine oxides as simple scaffolds for phosphinoylindoles and phosphinoylisocoumarins G. Gangadhararao, Ramesh Kotikalapudi, M. Nagarjuna Reddy and K. C. Kumara Swamy*
More informationUse of degradable cationic surfactants with cleavable linkages for enhancing the. chemiluminescence of acridinium ester labels. Supplementary Material
Use of degradable cationic surfactants with cleavable linkages for enhancing the chemiluminescence of acridinium ester labels Supplementary Material Anand atrajan*and David Wen Siemens Healthcare Diagnostics
More informationManganese powder promoted highly efficient and selective synthesis of fullerene mono- and biscycloadducts at room temperature
Supplementary Information Manganese powder promoted highly efficient and selective synthesis of fullerene mono- and biscycloadducts at room temperature Weili Si 1, Xuan Zhang 1, Shirong Lu 1, Takeshi Yasuda
More informationChemo- and Enantioselective Rh-Catalyzed Hydrogenation of 3-Methylene-1,2-diazetidines: Application to Vicinal Diamine Synthesis
Chemo- and Enantioselective Rh-Catalyzed Hydrogenation of 3-Methylene-1,2-diazetidines: Application to Vicinal Diamine Synthesis Greg P. Iacobini, a David W. Porter, b and Michael Shipman* a a Department
More informationSupporting Information
Investigation of self-immolative linkers in the design of hydrogen peroxide metalloprotein inhibitors Jody L. Major Jourden, Kevin B. Daniel, and Seth M. Cohen* Department of Chemistry and Biochemistry,
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2015 Electronic Supplementary Information ovel pseudo[2]rotaxanes constructed by selfassembly of dibenzyl
More informationSupporting Information for:
Supporting Information for: Methylerythritol Cyclodiphosphate (MEcPP) in Deoxyxylulose Phosphate Pathway: Synthesis from an Epoxide and Mechanisms Youli Xiao, a Rodney L. Nyland II, b Caren L. Freel Meyers
More informationSupporting Information. for. Pd-catalyzed decarboxylative Heck vinylation of. 2-nitro-benzoates in the presence of CuF 2
Supporting Information for Pd-catalyzed decarboxylative Heck vinylation of 2-nitro-benzoates in the presence of CuF 2 Lukas J. Gooßen*, Bettina Zimmermann, Thomas Knauber Address: Department of Chemistry,
More informationSupporting Information. for. Access to pyrrolo-pyridines by gold-catalyzed. hydroarylation of pyrroles tethered to terminal alkynes
Supporting Information for Access to pyrrolo-pyridines by gold-catalyzed hydroarylation of pyrroles tethered to terminal alkynes Elena Borsini 1, Gianluigi Broggini* 1, Andrea Fasana 1, Chiara Baldassarri
More informationSupporting Information for
Supporting Information for Tandem Mass Spectrometry Assays of Palmitoyl Protein Thioesterase and Tripeptidyl Peptidase Activity in Dried Blood Spots for the Detection of Neuronal Ceroid Lipofuscinoses
More informationL-Carnosine-Derived Fmoc-Tripeptides Forming ph- Sensitive and Proteolytically Stable Supramolecular
Supporting Information: L-Carnosine-Derived Fmoc-Tripeptides Forming ph- Sensitive and Proteolytically Stable Supramolecular Hydrogels Rita Das Mahapatra, a Joykrishna Dey* a, and Richard G. Weiss b a
More informationSUPPLEMENTAL FIGURE 1 Structures and IC50 values of compounds 13 32
SUPPLEMETAL FIGURE 1 Structures and IC50 values of compounds 13 32 THE JURAL F UCLEAR MEDICIE Vol. 53 o. 11 ovember 2012 Synthesis of [ 19 F]1 ([ 19 F]--(2-{4-[5-(benzyloxy)pyridin-2-yl]piperazin-1-yl}-2-oxoethyl)-
More informationSupporting Information
Supporting Information Asymmetric Catalysis of the Carbonyl-Amine Condensation: Kinetic Resolution of Primary Amines Sayantani Das, Nilanjana Majumdar, Chandra Kanta De, Dipti Sankar Kundu, Arno Döhring,
More informationSupporting Information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2015 Supporting Information Enzyme-activatable Probe with a Self-immolative Linker for Rapid and Sensitive
More informationSchwartz s reagent-mediated regiospecific synthesis of 2,3-disubstituted indoles from isatins
Electronic Supplementary Information (ESI) Schwartz s reagent-mediated regiospecific synthesis of 2,3-disubstituted indoles from isatins A. Ulikowski and B. Furman* Institute of Organic Chemistry, Polish
More informationSupporting Information
Supporting Information Developing novel activity-based fluorescent probes that target different classes of proteases Qing Zhu, Aparna Girish, Souvik Chattopadhaya and Shao Q Yao * Departments of Chemistry
More informationSupplemental Material
Supplemental Material General Methods Unless otherwise indicated, all anhydrous solvents were commercially obtained and stored under nitrogen. Reactions were performed under an atmosphere of dry nitrogen
More informationSupporting Information
Supporting Information Synthesis of N-Heteropolycyclic Compounds Including Quinazolinone Skeletons by Using Friedel-Crafts Alkylation Bu Keun Oh, Eun Bi Ko, Jin Wook Han* and Chang Ho Oh* Department of
More informationFacile Cu(II) mediated conjugation of thioesters and thioacids to peptides and proteins under mild conditions
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2018 Facile Cu(II) mediated conjugation of thioesters and thioacids to peptides
More informationSupporting Information
Supporting Information B(C 6 F 5 ) 3 -catalyzed Regioselective Deuteration of Electronrich Aromatic and Heteroaromatic compounds Wu Li, Ming-Ming Wang, Yuya Hu and Thomas Werner* Leibniz-Institute of Catalysis
More informationTriptycene-Based Small Molecules Modulate (CAG) (CTG) Repeat Junctions
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2015 Triptycene-Based Small Molecules Modulate (CAG) (CTG) Repeat Junctions Stephanie A. Barros
More informationZinc Chloride Promoted Formal Oxidative Coupling of Aromatic Aldehydes and Isocyanides to α- Ketoamides
Supporting information for Zinc Chloride Promoted Formal xidative Coupling of Aromatic Aldehydes and Isocyanides to α- Ketoamides Marinus Bouma, Géraldine Masson* and Jieping Zhu* Institut de Chimie des
More informationSupporting Information. Nitrodibenzofuran: a One- and Two-Photon Sensitive Protecting Group that is Superior to
Supporting Information Nitrodibenzofuran: a One- and Two-Photon Sensitive Protecting Group that is Superior to Brominated Hydroxycoumarin for Thiol Caging in Peptides M. Mohsen Mahmoodi, Daniel Abate-Pella,
More informationCatalyst-free chemoselective N-tert-butyloxycarbonylation of amines in water
SUPPORTING INFORMATION Catalyst-free chemoselective N-tert-butyloxycarbonylation of amines in water Sunay V. Chankeshwara and Asit K. Chakraborti* National Institute of Pharmaceutical Education and Research
More informationMicrowave heating in peptide side chain modification via sulfhydryl reaction
Microwave heating in peptide side chain modification via sulfhydryl reaction E. Calce and S. De Luca* Institute of Biostructures and Bioimaging, National Research Council, 80134 Naples, Italy stefania.deluca@cnr.it
More informationSupporting Information
Supporting Information Unconventional Passerini Reaction towards α-aminoxyamides Ajay L. Chandgude, Alexander Dömling* Department of Drug Design, University of Groningen, Antonius Deusinglaan 1, 9713 AV
More informationAcyl Radical Reactions in Fullerene Chemistry: Direct Acylation of. [60]Fullerene through an Efficient Decatungstate-Photomediated Approach.
Supporting information Acyl Radical Reactions in Fullerene Chemistry: Direct Acylation of [60]Fullerene through an Efficient Decatungstate-Photomediated Approach. Manolis D. Tzirakis and Michael rfanopoulos
More informationSupporting Information. Copyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2007
Supporting Information Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2007 Supporting Information General. NMR spectra for identification of intermediates and final compoundswere recorded
More informationSupporting Information. for. Synthesis of 2,1-benzisoxazole-3(1H)-ones by basemediated. photochemical N O bond-forming
Supporting Information for Synthesis of 2,1-benzisoxazole-3(1H)-ones by basemediated photochemical N O bond-forming cyclization of 2-azidobenzoic acids Daria Yu. Dzhons and Andrei V. Budruev* Address:
More informationSupporting Information. for. Synthesis of dye/fluorescent functionalized. dendrons based on cyclotriphosphazene
Supporting Information for Synthesis of dye/fluorescent functionalized dendrons based on cyclotriphosphazene Aurélien Hameau 1,2, Sabine Fuchs 1,2, Régis Laurent 1,2, Jean-Pierre Majoral* 1,2 and Anne-Marie
More informationDual-site Controlled and Lysosome-targeted ICT-PET-FRET. Fluorescent Probe for Monitoring ph Changes in Living Cells
Supporting information for Dual-site Controlled and Lysosome-targeted ICT-PET-FRET Fluorescent Probe for Monitoring ph Changes in Living Cells Baoli Dong, Xuezhen Song, Chao Wang, Xiuqi Kong, Yonghe Tang
More informationYnamides as racemization-free coupling reagents for amide and peptide synthesis
Ynamides as racemization-free coupling reagents for amide and peptide synthesis Long Hu, Silin Xu, Zhenguang Zhao, Yang Yang, Zhiyuan Peng, Ming Yang, Changliu Wang, Junfeng Zhao* Key Laboratory of Chemical
More informationElectronic Supplementary Information. Quinine/Selectfluor Combination Induced Asymmetric Semipinacol Rearrangement of
Electronic Supplementary Information Quinine/Selectfluor Combination Induced Asymmetric Semipinacol Rearrangement of Allylic Alcohols: An Effective and Enantioselective Approach to α Quaternary β Fluoro
More informationSupplementary Information
Supplementary Information Synthesis and antioxidant evaluation of enantiomerically pure bis- (1,2,3-triazolylmethyl)amino esters from modified α-amino acids Juan I. Sarmiento-Sánchez a *, Adrián Ochoa-Teran
More informationSupplementary Figure 1. Chemical structures of activity-based probes (ABPs) and of click reagents used in this study.
Supplementary Figure 1. Chemical structures of activity-based probes (ABPs) and of click reagents used in this study. In this study, one fluorophosphonate (FP, 1), three nitrophenol phosphonate probes
More informationSupporting Information
Electronic Supplementary Material (ESI) for Organic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2014 Supporting Information 1. General Information...S2 a. Materials b. HPLC
More informationSynthesis of cationic porphyrin modified amino. acids
Synthesis of cationic porphyrin modified amino acids Eric Biron and Normand Voyer* Département de chimie and CREFSIP, Faculté des sciences et de génie, Université Laval, Québec, Québec, Canada G1K 7P4
More informationPurdue Institute for Drug Discovery, Purdue University, 720 Clinic Drive, West Lafayette, IN 47907, USA. b
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2016 Florescent analogs of cyclic and linear dinucleotides as phosphodiesterase and oligoribonuclease
More informationSupporting Information
Supporting Information Developing Activity Localization Fluorescence Peptide Probe Using Thiol-Ene Click Reaction for Spatially Resolved Imaging of Caspase-8 in Live Cells Wei Liu,, Si-Jia Liu,, Yong-Qing
More informationZillillah, a Guowei Tan, a,b and Zhi Li* a,b. 4 Engineering Drive 4, Singapore Fax: ; Tel:
Highly Active, Stable, and Recyclable Magnetic Nano-size Solid Acid Catalysts: Efficient Esterification of Free Fatty Acid in Grease to Produce Biodiesel Zillillah, a Guowei Tan, a,b and Zhi Li* a,b a
More informationNaoya Takahashi, Keiya Hirota and Yoshitaka Saga* Supplementary material
Supplementary material Facile transformation of the five-membered exocyclic E-ring in 13 2 -demethoxycarbonyl chlorophyll derivatives by molecular oxygen with titanium oxide in the dark Naoya Takahashi,
More informationSupporting Information
Supporting Information Antioxidant Generation and Regeneration in Lipid Bilayers: the Amazing Case of Lipophilic Thiosulfinates and Hydrophilic Thiols Feng Zheng & Derek A. Pratt* Department of Chemistry,
More informationAll chemicals were obtained from Aldrich, Acros, Fisher, or Fluka and were used without
Supplemental Data Alexander et al. Experimental Procedures General Methods for Inhibitor Synthesis All chemicals were obtained from Aldrich, Acros, Fisher, or Fluka and were used without further purification,
More informationSupplementary Information
Supplementary Information Selective monomethylation of primary amines with simple electrophiles Thomas LEBLEU, Xiaolu MA, Jacques MADDALUNO and Julien LEGROS * General remarks 1 H NMR spectra were obtained
More informationSupporting Materials. Experimental Section. internal standard TMS (0 ppm). The peak patterns are indicated as follows: s, singlet; d,
CuBr-Catalyzed Efficient Alkynylation of sp 3 C-H Bonds Adjacent to a itrogen Atom Zhiping Li and Chao-Jun Li* Department of Chemistry, McGill University, 801 Sherbrooke St. West, Montreal, Quebec H3A
More informationPyridazine N-Oxides as Precursors of Metallocarbenes: Rhodium-Catalyzed Transannulation with Pyrroles. Supporting Information
Pyridazine N-Oxides as Precursors of Metallocarbenes: Rhodium-Catalyzed Transannulation with Pyrroles Vinaykumar Kanchupalli, Desna Joseph and Sreenivas Katukojvala* Department of Chemistry, Indian Institute
More informationEthyl 2-hydroxy-4-methyl-1-((prop-2-yn-1-yloxy)methyl)cyclohex-3-enecarboxylate (16):
General methods: 1 H NMR and 13 C NMR spectra were recorded in CDCl 3 or CDCl3 and CCl 4 as solvent on 300 MHz or 500 MHz spectrometer at ambient temperature. The coupling constant J is given in Hz. The
More informationHighly enantioselective tandem enzyme-organocatalyst crossed aldol reactions. with acetaldehyde in deep-eutectic-solvents.
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2014 Highly enantioselective tandem enzyme-organocatalyst crossed aldol reactions with acetaldehyde
More informationSupporting Information
Supporting Information A single design strategy for dual sensitive ph probe with a suitable range to map ph in living cells Kang-Kang Yu, Ji-Ting Hou, Kun Li, * Qian Yao, Jin Yang, Ming-Yu Wu, Yong-Mei
More informationAnalytical Method for 2, 4, 5-T (Targeted to Agricultural, Animal and Fishery Products)
Analytical Method for 2, 4, 5-T (Targeted to Agricultural, Animal and Fishery Products) The target compound to be determined is 2, 4, 5-T. 1. Instrument Liquid Chromatograph-tandem mass spectrometer (LC-MS/MS)
More informationCatalytic decarboxylative alkylation of β-keto acids with sulfonamides via the cleavage of carbon nitrogen and carbon carbon bonds
Catalytic decarboxylative alkylation of β-keto acids with sulfonamides via the cleavage of carbon nitrogen and carbon carbon bonds Cui-Feng Yang, Jian-Yong Wang and Shi-Kai Tian* Joint Laboratory of Green
More informationSupplemental Information. Reactivity of Monovinyl (Meth)Acrylates Containing Cyclic Carbonates
Supplemental Information Reactivity of Monovinyl (Meth)Acrylates Containing Cyclic Carbonates Kathryn A. Berchtold a, Jun Nie b, Jeffrey W. Stansbury c, d, and Christopher N. Bowman c, d, a Materials Science
More informationThe First Au-Nanoparticles Catalyzed Green Synthesis of Propargylamines Via Three-Component Coupling Reaction of Aldehyde, Alkyne And Amine
Supporting information of The First Au-anoparticles Catalyzed Green Synthesis of Propargylamines Via Three-Component Coupling Reaction of Aldehyde, Alkyne And Amine Mazaahir Kidwai a *, Vikas Bansal a,
More informationSUPPORTING INFORMATION. Transition metal-promoted synthesis of 2-aryl/heteroaryl-thioquinazoline: C-S
1 SUPPORTING INFORMATION Transition metal-promoted synthesis of 2-aryl/heteroaryl-thioquinazoline: C-S Bond formation by Chan-Lam Cross-Coupling Reaction SATYA KARUNA PULAKHANDAM a, NARESH KUMAR KATARI
More informationRameshwar Prasad Pandit and Yong Rok Lee * School of Chemical Engineering, Yeungnam University, Gyeongsan , Korea
Electronic Supplementary Material (ESI) for rganic & Biomolecular Chemistry. This journal is The Royal Society of Chemistry 2014 Novel ne-pot Synthesis of Diverse γ,δ-unsaturated β-ketoesters by Thermal
More informationSupporting Information
Zinc-Mediated Addition of Diethyl Bromomalonate to Alkynes for the Cascade Reaction towards Polysubstituted Pyranones and Tetracarbonyl Derivatives Anne Miersch, Klaus Harms, and Gerhard Hilt* Fachbereich
More informationStudent Handout. This experiment allows you to explore the properties of chiral molecules. You have
Student Handout This experiment allows you to explore the properties of chiral molecules. You have learned that some compounds exist as enantiomers non-identical mirror images, such as your left and right
More informationTenofovir disoproxil fumarate (Tenofoviri disoproxili fumaras)
C 19 H 30 N 5 O 10 P. C 4 H 4 O 4 Relative molecular mass. 635.5. Chemical names. bis(1-methylethyl) 5-{[(1R)-2-(6-amino-9H-purin-9-yl)-1-methylethoxy]methyl}-5-oxo-2,4,6,8-tetraoxa-5-λ 5 - phosphanonanedioate
More informationAsymmetric organocatalytic diboration of alkenes
Asymmetric organocatalytic diboration of alkenes Amadeu Bonet, a Cristina Solé, Henrik Gulyás,* Elena Fernández* a Dept. Química Física i Inorgànica, University Rovira i Virgili, C/Marcel lí Domingo s/n,
More informationOrganic Semiconducting Nanoparticles as Efficient Photoacoustic Agents for Lightening Early Thrombus and
Supporting Information rganic Semiconducting anoparticles as Efficient Photoacoustic Agents for Lightening Early Thrombus and Monitoring Thrombolysis in Living Mice Cao Cui,, Zhen Yang,, Xiang Hu, Jinjun
More informationSupport Information. Table of contents. Experimental procedures. S2. Spectroscopic data... S2-S23. Photophysical properties..
Support Information Regioselective 2,6-dihalogenation of BODIPYs in 1,1,1,3,3,3-hexafluoro-2-propanol and preparation of novel meso-alkyl polymeric BODIPY dyes Liang Wang a, Jian-Wei Wang a, Ai-jun Cui
More informationSupporting Information
Supporting Information Asymmetric organocatalytic formation of protected and unprotected tetroses under potentially prebiotic conditions. Laurence Burroughs, Paul A. Clarke,* Henrietta Forintos, James
More information3016 Oxidation of ricinoleic acid (from castor oil) with KMnO 4 to azelaic acid
6 Oxidation of ricinoleic acid (from castor oil) with KMnO 4 to azelaic acid CH -(CH ) OH (CH ) -COOH KMnO 4 /KOH HOOC-(CH ) -COOH C H 4 O (.) KMnO 4 KOH (.) (6.) C H 6 O 4 (.) Classification Reaction
More informationOrganic and biochemical synthesis of monolignol biosynthetic pathway intermediates
Jie Liu 2012-2-8 Organic and biochemical synthesis of monolignol biosynthetic pathway intermediates 1. Organic synthesis of 5-hydroxyferulic acid Malonic acid 3, 4-Dihydroxy-5-methoxy-benzaldehyde 0.1
More informationSupporting Information. Palladium-catalyzed reductive cleavage of tosylated arene using isopropanol as the mild reducing agent
Electronic Supplementary Material (ESI) for Organic Chemistry Frontiers. This journal is the Partner Organisations 2014 Supporting Information Supporting Information Palladium-catalyzed reductive cleavage
More informationThiol-Ene Photoimmobilization of Chymotrypsin on Polysiloxane Gels for Enzymatic Peptide Synthesis
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2018 Supporting information for: Thiol-Ene Photoimmobilization of Chymotrypsin on Polysiloxane Gels
More information