REDOX PROTEOMICS. Roman Zubarev.
|
|
- Clara Marshall
- 6 years ago
- Views:
Transcription
1 REDOX PROTEOMICS Roman Zubarev Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm
2 What is (RedOx) Proteomics? Proteomics - large-scale analysis of proteome Proteome all polypeptides expressed in a given time in a given organ of a given organism Redox proteome - reversible and irreversible covalent modifications that link redox metabolism to biological structure and function Proteome analysis obtaining information on protein identities, sequences, modifications, structure and abundances
3 Omics cascade Action
4 RedOx Proteomics Reversible modifications Cys, Met, Sec (selenocysteine) Irreversible modifications Trp, Tyr, Arg, Lys,
5 214,000 Cys residues in the proteome
6 214,000 Cys residues in the proteome In cell & tissue proteins : 5-14% of Cys residues are oxidized, up to 40% if oxidants are added
7 Proteome dynamic range and its implications Dynamic(range(of(mass(spectrometers( 9000# 8000# 7000# 5000# 6000# 4000# Number(of(detected( proteins( 3000# 2000# 1000# Sample!"!#"!##"!###"!####"!#####"!######"!#######" Proteins,*number*of*copies*per*cell* 10#mg#########1#mg########100#µg#######10#µg########1#µg##########100#ng#####10#ng########1#ng# Sample*size* Zubarev R.A., Proteomics, 2013
8 What is Molecular Mass? Mass: M = Σm e n e, m e mass of an element n e number of atoms of this element in the molecule Isotope Mass Abundance Chemical mass 1 H % H (D) % 12 C 12.0(0) % C % 14 N % N % 16 O % O % 18 O % 31 P % S % S % 34 S % 36 S %
9 Molecular mass is the isotopic distribution! Mass defect nominal mass C=12 N=14 monoisotopic mass C=12.000(0) N= Isotopic shift average mass C= N=14.03 C 153 H 224 N 42 O Molecular mass, Da
10 Molecular mass is the isotopic distribution! Selenium
11 Top-Down Proteomics Cell lysis blood HPLC gels enzymatic cleavage PTMs protein mixture protein or large protein fragment CID protein enzymatic fragments (peptide mixture) intact cell, tissue Top-Down MS LC-MS/MS [M+19H] m/z m/z MS/MS ECD, CAD, CID,HCD, IRMPD, UVPD Protein ID All modifications m/z
12 Bottom Up Proteomics cell Lysis Blood HPLC gels enzymatic cleavage PTMs protein mixture protein or large protein fragment CID protein enzymatic fragments (peptide mixture) intact cell, tissue LC-MS/MS Bottom-Up (Shotgun) proteomics [M+3H] Time, min Survey MS scan m/z MS/MS CAD/HCD ECD/ETD m/z m/z Thx: Yu. Tsybin Protein ID Some modifications
13 Protein Identification by Tandem Mass Spectrometry Protein sequence ILNKPEDETHLEAQPTDASAQFIRNLQISNE DLSKEPSISREDLISKEQIVIRSSRQPQSQNPK LPLSILKEKHLRNATLGSEETTEHTPSDASTT EGKLMELGHKIMRNLENTVKETIKYLKSLF SHAFEVVKT Enzymatic digest Tryptic peptides EDLISK EQIVIR LPLSILK NLENTVK LMELGHK QPQSQNPK NLQISNEDLSK SLFSHAFEVVK NATLGSEETTEHTPSDASTTEGK ILNKPEDETHLEAQPTDASAQFIR Tandem Mass Spectrometry (MS/MS) Tryptic peptide NLENTVK MS/MS Fragmentation N L E N T V K Molecular mass: Fragment masses Your Peptide/ protein is this: Score = 77
14 MS-based quantitative discovery approaches SILAC TMT, itraq Label-free Cells Heavy Light Proteins H/L Heavy Light Peptides H/L H/L Biology? 0 0 Extraction Digestion Tissues, bodily fluids 0 0 N/A x x N 11 x x N-any
15 Hybrid LTQ-Orbitrap Mass Spectrometer 1. Ions are stored in the linear trap of LTQ 2. are axially ejected 3. and trapped in the C-trap and squeezed into a smaller cloud 4. then a voltage pulse across C-trap ejects ions towards the Orbitrap 5. where they are trapped and detected V Gas <1 mtorr x V -2.5 k V Central Electrode Voltage y -3.5 k V Transmission=30..50%
16 ESI The Nobel Prize John Fenn Fenn, J. B.; Mann, M.; Meng, C. K.; Wong, S. F.; Whitehouse, C. M. Science 246 (1989) Metal capillary + Atmospheric side - HV power supply 2..4 kv E 10 6 V/m Droplet desintegration electrons Spraying rate 1 µ l/min Spraying current Desolvation + na MS nano-electrospray Wilm, M. S.; Mann, M. Int. J. Mass Spectrom. Ion Processes 136 (1994) 167 Pulled glass capillary tip µm V Spraying rate µ l/min Spraying current in Chemistry na + ESI produces multiply-charged ions, [M + nh] n+ and [M - nh] n-
17 ESI of proteins native ESI mass spectra of cytochrome c in water with 3% MeOH and 0.5 mm ammonium acetate Konermann L, Douglas DJ. Biochem. 1997:36, denatured Charging of proteins is apprx. proportional to surface area
18 Backbone Fragmentation Electron 2004 Detachment Dissociation (EDD) a b Collisionally 1960s, 1990s Activated /Induced Dissociation (CAD/CID) Electron Capture 1998 Dissociation (ECD) c -CHR C(O) NH CHR UV Photodissociation Metastable-Induced Dissociation of Ions 2005 x y Infrared 1960s, 1995 Multiphoton Dissociation (IRMPD) z Electron Transfer 2004 Dissociation (ETD)
19 Near-complete sequencing of 15 kda protein Kjeldsen, F.; Zubarev, R.A. JACS, 2003, 125, 6628.
20 REDOX Proteomics Reduce S-S Leichert et al., PNAS 2008
21 IodoTMT Cys-labeling reagents TMT-10: Enables Multiplexing
22 RedOx Proteomics Proteins reduced by the drug Proteins oxidized by the drug
23 Proteome-wide Met oxidation analysis Ghesquiére et al., Mol Cell Proteomics 2011
24 RedOx Proteomics Conventional proteomics probes the abundance changes of thousands of proteins in the sample Redox proteomics can determine shifts in the oxidation state of hundreds of proteins All measurements are quantitative. Statistical significance can only be achieved through replicate analyses What happens in vivo happens also in vitro. Proper controls are needed! Validation of all important findings is required. Validation has to be done by a different method than discovery. G o o d L u c k!
2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry
Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique
More informationLearning Objectives. Overview of topics to be discussed 10/25/2013 HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS
HIGH RESOLUTION MASS SPECTROMETRY (HRMS) IN DISCOVERY PROTEOMICS A clinical proteomics perspective Michael L. Merchant, PhD School of Medicine, University of Louisville Louisville, KY Learning Objectives
More informationThe distribution of log 2 ratio (H/L) for quantified peptides. cleavage sites in each bin of log 2 ratio of quantified. peptides
Journal: Nature Methods Article Title: Corresponding Author: Protein digestion priority is independent of their abundances Mingliang Ye and Hanfa Zou Supplementary Figure 1 Supplementary Figure 2 The distribution
More informationIon Source. Mass Analyzer. Detector. intensity. mass/charge
Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS
More informationProteomics/Peptidomics
Proteomics/Peptidomics System biology tools and preclinical models for translational research in endometriosis, ESHRE Campus workshop, 4-5 September 2009 E. Waelkens Proteomics: What? Proteins Proteomics
More informationShotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance.
Abundance Abundance Abundance Abundance Abundance Shotgun Proteomics Protein Mixture 1 2 3 MS/MS proteolysis m/z 2 3 Time µlc m/z MS 1 m/z Peptide Mixture m/z Block Diagram of a Mass Spectrometer Sample
More informationMass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector
Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit
More informationAdvances in Hybrid Mass Spectrometry
The world leader in serving science Advances in Hybrid Mass Spectrometry ESAC 2008 Claire Dauly Field Marketing Specialist, Proteomics New hybrids instruments LTQ Orbitrap XL with ETD MALDI LTQ Orbitrap
More informationIntroduction to Proteomics 1.0
Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using
More informationFundamentals of Soft Ionization and MS Instrumentation
Fundamentals of Soft Ionization and MS Instrumentation Ana Varela Coelho varela@itqb.unl.pt Mass Spectrometry Lab Analytical Services Unit Index Mass spectrometers and its components Ionization methods:
More informationNIH Public Access Author Manuscript J Proteome Res. Author manuscript; available in PMC 2014 July 05.
NIH Public Access Author Manuscript Published in final edited form as: J Proteome Res. 2013 July 5; 12(7): 3071 3086. doi:10.1021/pr3011588. Evaluation and Optimization of Mass Spectrometric Settings during
More informationNew Instruments and Services
New Instruments and Services Liwen Zhang Mass Spectrometry and Proteomics Facility The Ohio State University Summer Workshop 2016 Thermo Orbitrap Fusion http://planetorbitrap.com/orbitrap fusion Thermo
More informationSUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to
More informationComparison of mass spectrometers performances
Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion
More informationDon t miss a thing on your peptide mapping journey How to get full coverage peptide maps using high resolution accurate mass spectrometry
Don t miss a thing on your peptide mapping journey How to get full coverage peptide maps using high resolution accurate mass spectrometry Kai Scheffler, PhD BioPharma Support Expert,LSMS Europe The world
More informationBiomolecular Mass Spectrometry
Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic
More informationMass spectrometry based proteomics
Practice-oriented, student-friendly modernization of the biomedical education for strengthening the international competitiveness of the rural Hungarian universities TÁMOP-4.1.1.C-13/1/KONV-2014-0001 Mass
More informationMass Spectrometry Infrastructure
Mass Spectrometry Infrastructure Todd Williams, Ph.D. Director KU Mass Spectrometry and Analytical Proteomics Laboratory Mass Spectrometry Lab B025 Malott Hall Mission The Mass Spectrometry and analytical
More informationQuantification with Proteome Discoverer. Bernard Delanghe
Quantification with Proteome Discoverer Bernard Delanghe Overview: Which approach to use? Proteome Discoverer Quantification Method What When to use Metabolic labeling SILAC Cell culture systems Small
More informationAutomating Mass Spectrometry-Based Quantitative Glycomics using Tandem Mass Tag (TMT) Reagents with SimGlycan
PREMIER Biosoft Automating Mass Spectrometry-Based Quantitative Glycomics using Tandem Mass Tag (TMT) Reagents with SimGlycan Ne uaca2-3galb1-4glc NAcb1 6 Gal NAca -Thr 3 Ne uaca2-3galb1 Ningombam Sanjib
More informationQuadrupole and Ion Trap Mass Analysers and an introduction to Resolution
Quadrupole and Ion Trap Mass Analysers and an introduction to Resolution A simple definition of a Mass Spectrometer A Mass Spectrometer is an analytical instrument that can separate charged molecules according
More informationFlow-Through Electron Capture Dissociation in a novel Branched RF Ion Trap
Flow-Through Electron Capture Dissociation in a novel Branched RF Ion Trap Takashi Baba, J. Larry Campbell, Yves Le Blanc, Jim. W. Hager and Bruce A. Thomson ASMS, June 18 / 2014 1 2014 AB SCIEX Trapping
More informationCharacterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt
More informationBiological Mass Spectrometry. April 30, 2014
Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing
More informationSupporting Information. Lysine Propionylation to Boost Proteome Sequence. Coverage and Enable a Silent SILAC Strategy for
Supporting Information Lysine Propionylation to Boost Proteome Sequence Coverage and Enable a Silent SILAC Strategy for Relative Protein Quantification Christoph U. Schräder 1, Shaun Moore 1,2, Aaron A.
More informationMass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University
Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk previously Peptide fragmentation Hybrid instruments 117 The Building Blocks of Life DNA RNA Proteins
More informationFOURIER TRANSFORM MASS SPECTROMETRY
FOURIER TRANSFORM MASS SPECTROMETRY https://goo.gl/vx3ogw FT-ICR Theory Ion Cyclotron Motion Inward directed Lorentz force causes ions to move in circular orbits about the magnetic field axis Alan G. Marshall,
More informationMass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD
Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD 4-7117 sbarnes@uab.edu Overview A mass spectrum Electrospray MS Analysis of intact proteins Molecular weight calculations
More informationLecture 3. Tandem MS & Protein Sequencing
Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:
More informationMass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010
Mass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010 Introduction, Ionization Methods Mass Analyzers, Ion Activation Methods
More informationProtein Interactions by Infrared Multiphoton Dissociation-MS. Crosslinker for Identification of. Photoactive Chemical
Photoactive Chemical Crosslinker for Identification of Protein Interactions by Infrared Multiphoton Dissociation-MS Myles W. Gardner, Jennifer S. Brodbelt Chemical Crosslinking of Proteins Protein structural
More informationProteins: Proteomics & Protein-Protein Interactions Part I
Proteins: Proteomics & Protein-Protein Interactions Part I Jesse Rinehart, PhD Department of Cellular & Molecular Physiology Systems Biology Institute DNA RNA PROTEIN DNA RNA PROTEIN Proteins: Proteomics
More informationBiological Mass spectrometry in Protein Chemistry
Biological Mass spectrometry in Protein Chemistry Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi MASS SPECTROMETRY is an analytical technique that identifies the chemical composition of
More informationNew Instruments and Services
New Instruments and Services http://planetorbitrap.com/orbitrap fusion Combining the best of quadrupole, Orbitrap, and ion trap mass analysis in a revolutionary Tribrid architecture, the Orbitrap Fusion
More informationHigh-sensitivity Orbitrap mass analysis of intact macromolecular assemblies. R. J. Rose, E. Damoc, E. Denisov, A. Makarov, A. J. R.
High-sensitivity Orbitrap mass analysis of intact macromolecular assemblies R. J. Rose, E. Damoc, E. Denisov, A. Makarov, A. J. R. Heck SUPPLEMENTARY INFORMATION HCD multipole C -trap Transport octapole
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/2/1/e1500678/dc1 Supplementary Materials for Chemical synthesis of erythropoietin glycoforms for insights into the relationship between glycosylation pattern and
More informationRDP Cores Highlights: the CF Analytics Core. Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology
CF@LANTA RDP Cores Highlights: the CF Analytics Core Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology CF@LANTA RDP Center The CF@LANTA RDP Center at Emory University
More informationNature Methods: doi: /nmeth.3177
Supplementary Figure 1 Characterization of LysargiNase, trypsin and LysN missed cleavages. (a) Proportion of peptides identified in LysargiNase and trypsin digests of MDA-MB-231 cell lysates carrying 0,
More informationABSTRACT. Catherine Fenselau, Professor, Department of Chemistry and Biochemistry
ABSTRACT Title of Dissertation: ANALYSIS OF INTACT PROTEINS IN COMPLEX MIXTURES Avantika Dhabaria Doctor of Philosophy 2013 Directed By: Catherine Fenselau, Professor, Department of Chemistry and Biochemistry
More informationOzonolysis of phospholipid double bonds during electrospray. ionization: a new tool for structure determination
Ozonolysis of phospholipid double bonds during electrospray ionization: a new tool for structure determination Michael C. Thomas, Todd W. Mitchell, Stephen J. Blanksby Departments of Chemistry and Biomedical
More informationIonization Methods. Neutral species Charged species. Removal/addition of electron(s) Removal/addition of proton(s)
Ionization Methods Neutral species Charged species Removal/addition of electron(s) M + e - (M +. )* + 2e - electron ionization Removal/addition of proton(s) M + (Matrix)-H MH + + (Matrix) - chemical ionization
More informationAnalysis of Glycopeptides Using Porous Graphite Chromatography and LTQ Orbitrap XL ETD Hybrid MS
Analysis of Glycopeptides Using Porous Graphite Chromatography and LTQ Orbitrap XL ETD Hybrid MS Terry Zhang, Rosa Viner, Zhiqi Hao, Vlad Zabrouskov, Thermo Fisher Scientific, San Jose, CA, USA Introduction
More informationMultiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow
Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power
More informationMore structural information with MS n
PRODUCT SPECIFICATIONS The LTQ XL linear ion trap mass spectrometer More structural information with MS n The LTQ XL linear ion trap mass spectrometer delivers more structural information faster and with
More informationMS/MS Scan Modes. Eötvös University, Budapest April 16, MS/MS Scan Modes. Árpád Somogyi. Product Ion Scan Select. Scan. Precursor Ion Scan Scan
MS/MS Modes Árpád Somogyi Eötvös University, Budapest April 16, 2012 MS/MS Modes Product Ion Precursor Ion Neutral Loss Δ ed Reaction Monitoring (SRM) 1 modes in a triple quadrupole (QqQ) (one quadrupole
More informationMass Spectrometry based metabolomics
Mass Spectrometry based metabolomics Metabolomics- A realm of small molecules (
More informationApplying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis
Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis Ying Qing Yu Waters Corporation, Milford, MA, USA APPLICATION BENEFITS
More informationProtein Analysis using Electrospray Ionization Mass Spectroscopy *
OpenStax-CNX module: m38341 1 Protein Analysis using Electrospray Ionization Mass Spectroscopy * Wilhelm Kienast Andrew R. Barron This work is produced by OpenStax-CNX and licensed under the Creative Commons
More informationAn Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27
An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 Top-down HRAM Bioanalysis of Native Proteins/Molecules Relative Abundance 100
More informationCharacterization of an Unknown Compound Using the LTQ Orbitrap
Characterization of an Unknown Compound Using the LTQ rbitrap Donald Daley, Russell Scammell, Argenta Discovery Limited, 8/9 Spire Green Centre, Flex Meadow, Harlow, Essex, CM19 5TR, UK bjectives unknown
More informationQuantitative chromatin proteomics reveals a dynamic histone. post-translational modification landscape that defines asexual
Quantitative chromatin proteomics reveals a dynamic histone post-translational modification landscape that defines asexual and sexual Plasmodium falciparum parasites Nanika Coetzee 1, Simone Sidoli 2,
More informationMass Spectrometry and Proteomics - Lecture 1 - Matthias Trost Newcastle University
Mass Spectrometry and Proteomics - Lecture 1 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk Content Lectures 1-3 The basics of mass measurement Ionisation techniques Mass analysers Detectors
More informationIntroduction to LC/MS/MS
Trends in 2006 Introduction to LC/MS/MS By Crystal Holt, LC/MS Product Specialist, Varian Inc. Toxicology laboratories Increased use of LC/MS Excellent LD Cheaper (still expensive) Much more robust Solves
More informationSupporting information
Supporting information Figure legends Supplementary Table 1. Specific product ions obtained from fragmentation of lithium adducts in the positive ion mode comparing the different positional isomers of
More informationAnalyzing Phenyl Ureas and Carbamates with HPLC/API-MS. Presented by Chen-Kai Meng, Ph.D. Applications Chemist
Analyzing Phenyl Ureas and Carbamates with HPLC/API-MS Presented by Chen-Kai Meng, Ph.D. Applications Chemist Outline Overview of ESI, APPI, and APCI sources Comparing ESI, APPI, and APCI results Identifying
More informationQuantification by Mass Spectrometry
Quantification by Mass Spectrometry PC219 Lecture 5 30 April, 2010 sguan@cgl.ucsf.edu 1 Applications of Quantitative Proteomics Qualitative protein identification is NOT sufficient to describe a biological
More informationSupporting information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2014 Supporting information Glycan Reductive Isotope-coded Amino Acid Labeling (GRIAL) for Mass Spectrometry-based
More informationFigure S6. A-J) Annotated UVPD mass spectra for top ten peptides found among the peptides identified by Byonic but not SEQUEST + Percolator.
Extending Proteome Coverage by Combining MS/MS Methods and a Modified Bioinformatics Platform adapted for Database Searching of Positive and Negative Polarity 193 nm Ultraviolet Photodissociation Mass
More informationSelective phosphatidylcholine double bond. fragmentation and localization using. Paternó-Büchi reactions and ultraviolet.
Electronic Supplementary Material (ESI) for Analyst. This journal is The Royal Society of Chemistry 2017 Selective phosphatidylcholine double bond fragmentation and localization using Paternó-Büchi reactions
More informationMass Spectrometry and Proteomics. Professor Xudong Yao Bioanalytical Chemistry Spring 2007
Mass Spectrometry and Proteomics Professor Xudong Yao Bioanalytical Chemistry Spring 2007 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Chemical proteomics Protein, Proteome and
More informationSCS Mass Spectrometry Laboratory
SCS Mass Spectrometry Laboratory Contact Information Staff 31 Noyes Laboratory (8:00-5:00 M-F) 217-333-2545 http://scs.illinois.edu/massspec/ Furong Sun (frs@illinois.edu) Furong Sun Director Training
More informationTechnical Note # TN-31 Redefining MALDI-TOF/TOF Performance
Bruker Daltonics Technical Note # TN-31 Redefining MALDI-TOF/TOF Performance The new ultraflextreme exceeds all current expectations of MALDI-TOF/TOF technology: A proprietary khz smartbeam-ii TM MALDI
More informationIdentification of Haemoglobinopathies by LC/MS
Identification of Haemoglobinopathies by LC/ Mark Harrison; Senior Scientist, ThermoFisher Scientific Sarah Battle; Senior Biomedical Scientist, Royal Hallamshire Hospital Introduction There are over 2
More informationIntroduction to Peptide Sequencing
Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?
More informationRelative Quantitation of Human Polymorphonuclear Leukocyte Cell Membrane GPEtn Lipids
Relative Quantitation of Human Polymorphonuclear Leukocyte Cell Membrane GPEtn Lipids Using the QTRAP System with mtraq Reagents Karin A. Zemski-Berry 1, John M. Hevko 2, and Robert C. Murphy 1 1 Department
More informationTime (min) Supplementary Figure 1: Gas decomposition products of irradiated DMC.
200000 C 2 CH 3 CH 3 DMC 180000 160000 140000 Intensity 120000 100000 80000 60000 40000 C 2 H 6 CH 3 CH 2 CH 3 CH 3 CCH 3 EMC DEC 20000 C 3 H 8 HCCH 3 5 10 15 20 25 Time (min) Supplementary Figure 1: Gas
More informationNew Solvent Grade Targeted for Trace Analysis by UHPLC-MS
New Solvent Grade Targeted for Trace Analysis by UHPLC-MS Subhra Bhattacharya, Deva H. Puranam, and Stephen C. Roemer Thermo Fisher Scientific Fisher Chemical, One Reagent Lane, Fair Lawn, NJ Material
More informationELŐADÁS KIVONAT CLASSROOM LECTURE HANDOUT. financed by the program
TÁMOP-4.1.1.C-13/1/KONV-2014-0001 projekt Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére program
More informationBioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS
Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS Jenny Chen, Hongxia Wang, Zhiqi Hao, Patrick Bennett, and Greg Kilby Thermo Fisher
More informationPTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System
Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow
More informationMS/MS to Targeted Proteomics (MRM)
MS/MS to Targeted Proteomics (MRM) How it worked on the Human Lens Proteome Jayson Falkner PhD jay@singleorganism.com Genes Show Limited Value in Predicting Diseases With only a few exceptions, what the
More informationRapid and Sensitive Screening of Benzodiazepines in Serum Using Liquid Chromatography-APCI-Linear Ion Trap System
T2007 Seattle, Washington Rapid and Sensitive Screening of Benzodiazepines in Serum Using Liquid hromatography-api-linear Ion Trap System Viktor Vorisek *, Vilma Habrdova, Pavel Zivny and Vladimir Palicka
More informationNew Mass Spectrometry Tools to Transform Metabolomics and Lipidomics
New Mass Spectrometry Tools to Transform Metabolomics and Lipidomics July.3.13 Ken Miller Vice President of Marketing, Life Sciences Mass Spectrometry 1 The world leader in serving science Omics & the
More informationFOURIER TRANSFORM MASS SPECTROMETRY
FOURIER TRANSFORM MASS SPECTROMETRY FT-ICR Theory Ion Cyclotron Motion Inward directed Lorentz force causes ions to move in circular orbits about the magnetic field axis Alan G. Marshall, Christopher L.
More informationMALDI-TOF. Introduction. Schematic and Theory of MALDI
MALDI-TOF Proteins and peptides have been characterized by high pressure liquid chromatography (HPLC) or SDS PAGE by generating peptide maps. These peptide maps have been used as fingerprints of protein
More informationPHOTOCATALYTIC DECONTAMINATION OF CHLORANTRANILIPROLE RESIDUES IN WATER USING ZnO NANOPARTICLES. DR. A. RAMESH, Ph.D, D.Sc.,
PHOTOCATALYTIC DECONTAMINATION OF CHLORANTRANILIPROLE RESIDUES IN WATER USING ZnO NANOPARTICLES DR. A. RAMESH, Ph.D, D.Sc., raamesh_a@yahoo.co.in 1 OBJECTIVES Determination of persistence and photolysis
More informationFOURIER TRANSFORM MASS SPECTROMETRY
FOURIER TRANSFORM MASS SPECTROMETRY FT-ICR Theory Ion Cyclotron Motion Inward directed Lorentz force causes ions to move in circular orbits about the magnetic field axis Alan G. Marshall, Christopher L.
More informationIonization Methods. Ionization Methods
Ionization Methods Árpád Somogyi Associate Director CCIC, Mass Spectrometry and Proteomics Laboratory OSU August 17, 2015 Ionization Methods Neutral species Charged species Removal/addition of electron(s)
More informationResearch to Routine Workflows for Large and Small Molecules using the Q Exactive HR/MS
Research to Routine Workflows for Large and Small Molecules using the Q Exactive HR/MS Sept. 22, 2011 Patrick Bennett Director Pharma Strategic Marketing Thermo Fisher Scientific Agenda Definitions Research
More informationMass Spectrometry. Actual Instrumentation
Mass Spectrometry Actual Instrumentation August 2017 See also http://www.uni-bielefeld.de/chemie/analytik/ms f additional infmation 1. MALDI TOF MASS SPECTROMETRY ON THE ULTRAFLEX 2 2. ESI MASS SPECTROMETRY
More informationCharacterization and Quantification of Covalent Modification of Proteins Using Mass Spectrometry
City University of New York (CUNY) CUNY Academic Works Dissertations, Theses, and Capstone Projects Graduate Center 9-2018 Characterization and Quantification of Covalent Modification of Proteins Using
More informationIon fragmentation of small molecules in mass spectrometry
Ion fragmentation of small molecules in mass spectrometry Jeevan Prasain jprasain@uab.edu 6-2612 Nomenclature: the main names and acronyms used in mass spectrometry Molecular ion: Ion formed by addition
More informationLECTURE 3. Ionization Techniques for Mass Spectrometry
LECTURE 3 Ionization Techniques for Mass Spectrometry Jack Henion, Ph.D. Emeritus Professor, Analytical Toxicology Cornell University Ithaca, NY 14850 Lecture 3, Page 1 Contents Electron ionization (EI)
More informationMS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine
Application Note: 346 MS/MS as an LC Detector for the Screening of Drugs and Their Metabolites in Race Horse Urine Gargi Choudhary and Diane Cho, Thermo Fisher Scientific, San Jose, CA Wayne Skinner and
More informationAgilent 7700x ICP-MS
Agilent 7700x ICP-MS Metals analysis Mid ppt to low ppb detection range Option to detect in four different gas modes to gain optimum detection of multiple metals or interferences in a sample Autosampler
More informationMSSimulator. Simulation of Mass Spectrometry Data. Chris Bielow, Stephan Aiche, Sandro Andreotti, Knut Reinert FU Berlin, Germany
Chris Bielow Algorithmic Bioinformatics, Institute for Computer Science MSSimulator Chris Bielow, Stephan Aiche, Sandro Andreotti, Knut Reinert FU Berlin, Germany Simulation of Mass Spectrometry Data Motivation
More informationThe use of mass spectrometry in lipidomics. Outlines
The use of mass spectrometry in lipidomics Jeevan Prasain jprasain@uab.edu 6-2612 utlines Brief introduction to lipidomics Analytical methodology: MS/MS structure elucidation of phospholipids Phospholipid
More informationTargeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS. Kayleigh Arthur
Targeted and untargeted metabolic profiling by incorporating scanning FAIMS into LC-MS Kayleigh Arthur K.Arthur@lboro.ac.uk Introduction LC-MS is a highly used technique for untargeted profiling analyses
More informationElectron Transfer Dissociation Mass Spectrometry of Hemoglobin on Clinical Samples
B American Society for Mass Spectrometry, 2012 J. Am. Soc. Mass Spectrom. (2012) 23:150Y15 DOI: 10.100/s1331-012-044-3 RESEARCH ARTICLE Electron Transfer Dissociation Mass Spectrometry of Hemoglobin on
More informationProteomics of body liquids as a source for potential methods for medical diagnostics Prof. Dr. Evgeny Nikolaev
Proteomics of body liquids as a source for potential methods for medical diagnostics Prof. Dr. Evgeny Nikolaev Institute for Biochemical Physics, Rus. Acad. Sci., Moscow, Russia. Institute for Energy Problems
More informationMass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications
- Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications Adapted from Mass Spectrometry in Biotechnology Gary Siuzdak,, Academic Press 1996 1 Introduction
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1
Supplementary Figure 1 The timeline of the NGAG method for extraction of N-linked glycans and glycosite-containing peptides. The timeline can be changed based on the number of samples. Supplementary Figure
More informationDeveloping Mass Spectrometry-Based Analytical Methodologies for Analyzing Complex Protein and Lipid Samples
Developing Mass Spectrometry-Based Analytical Methodologies for Analyzing Complex Protein and Lipid Samples Weimin Hou Thesis submitted to the Faculty of Graduate and Postdoctoral Studies in partial fulfillment
More informationfor the Identification of Phosphorylated Peptides
Application of a Data Dependent Neutral-Loss Experiment on the Finnigan LTQ for the Identification of Phosphorylated Peptides Gargi Choudhary Diane Cho Thermo Electron, San Jose, CA Abstracted from posters
More informationQUANTITATIVE ANALYSIS IN PROTEOMICS AND METABOLOMICS
UNIVERSITA DEGLI STUDI DI NAPOLI FEDERICO II TESI DI DOTTORATO IN SCIENZE CHIMICHE XXVIII CICLO QUANTITATIVE ANALYSIS IN PROTEOMICS AND METABOLOMICS Francesca Pane Tutor Prof. Angela Amoresano Coordinatore
More informationMass Spectrometry and Proteomics Xudong Yao
Mass Spectrometry and Proteomics Xudong Yao Dept of Chemistry University of Connecticut Storrs, CT April 19, 2005 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Gel or non-gel
More informationApplication of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast
Application of a new capillary HPLC- ICP-MS interface to the identification of selenium-containing proteins in selenized yeast Application note Food supplements Authors Juliusz Bianga and Joanna Szpunar
More informationMetabolomics: quantifying the phenotype
Metabolomics: quantifying the phenotype Metabolomics Promises Quantitative Phenotyping What can happen GENOME What appears to be happening Bioinformatics TRANSCRIPTOME What makes it happen PROTEOME Systems
More informationTECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn
GlycoProfile II Enzymatic In-Solution N-Deglycosylation Kit Product Code PP0201 Storage Temperature 2 8 C TECHNICAL BULLETIN Product Description Glycosylation is one of the most common posttranslational
More informationIdentification of Polyethylene Glycol Based Surfactants Using LC-MS Data
Identification of Polyethylene Glycol Based Surfactants Using LC-MS Data It can be difficult to identify PEG (polyethylene glycol) based surfactants by mass spectrometry. One needs to determine the end
More information