Robert E. Murphy, Arvind Kinhikar, Joselyn Del Rosario, Ryan Preston, Mike Shields, and Nancy Levin
|
|
- Godfrey Corey Powell
- 6 years ago
- Views:
Transcription
1 Combined use of Immunoassay and Two-Dimensional Liquid Chromatography Mass Spectrometry for the Detection and Identification of Metabolites from Biotherapeutic Pharmacokinetic Samples Robert E. Murphy, Arvind Kinhikar, Joselyn Del Rosario, Ryan Preston, Mike Shields, and Nancy Levin CovX, Pfizer BioTherapeutics Research and Development September 15, 211
2 Agenda CovX Technology Anti-Idiotype Capture Reagent Immunoassays Developed and PK Results Two-dimensional Liquid Chromatography/MS method 2DLC/MS PK Results and Intact Protein Metabolite Identification Immunoassay and 2DLC/MS correlation Summary 1
3 CovX Technology Pharmacophore fusion onto catalytic antibody ACTIVE MOLECULE SPONTANEOUS COVALENT ASSEMBLY IN SOLUTION ANTIBODY HOMOGENEOUS FUSION PROTEIN 2
4 A closer look at the fusion reaction Intact SEC/MS characterization T (minutes after addition) Mid-reaction time point Final product (2 peptides fused) Deconvoluted Mass Spectra (149 to 155 amu) 3
5 CovX-bodies Evolution Peptides to proteins to bi-functional bioconjugates 4 Mono-functional peptide CovX-Bodies Substitute protein for peptides: protein CovX-Bodies Bi-functional peptide CovX-Bodies
6 Transforming Peptides into Drugs Antibody and peptide are both key CovX-Body design elements Peptide and linker design dramatically impacts CovX-Body properties 5 5
7 GLP-1 Model 6 GLP-1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR DPP-4 enzyme -HA EGTFTSDVSSYLEGQAAKEFIAWLVKGR Exendin-4 HGEGTFTSDLSKQMEEEAVR LFIEWLKNGGPSSGAPPPSG EGTFTSDLSKQMEEEAVRLF IEWLKNGGPSSGAPPPS
8 Anti-Idiotype Development: Specific and Universal Capture Reagent 7 Anti-Idiotype MAb Variable Constant CovX Body Fc Domain Peptide Fab Anti-Idiotype Antibody that binds to the variable domains of another antibody Develop non-blocking private anti-idiotype that is specific for CovX body Utility Generic capture or detection reagent for all CovX Bodies More sensitive assays; lower backgrounds Single format for preclinical and clinical assays Vendor independence
9 PK Immunoassays Developed 8 Total Active TMB Color TMB Color HRP 3) HRP-Antihuman IgG SA-HRP 3) Anti-peptide (N-term Specific) 2) CovX body 2) CovX body 1) Anti-Id 1) Anti-Id Block Block Block Block Block Block Block
10 Conc (ug/ml) Conc (ug/ml) Conc (ug/ml) Mouse PK Immunoassay Results GLP-1 CovX-body 5. Exendin-4 CovX-body Time (hrs) 6. Blue Total Green Active Time (hrs) Modified Exendin-4 CovX-body Time (hrs) 9
11 1 Anti-Idiotype Column Preparation -38 umoles of resin + 12 nmoles of anti-id in ph 9. buffer -react for 2 hrs, then quench with 1M tris -wash with PBS and 1M NaCl -pack 2 x 5 mm column with 15uL of resin
12 Two-Dimensional Liquid Chromatography with UV and MS Detection Step 1: Anti-Id Analysis and condition RPLC Step 2: Collect fraction minutes Step 3: RPLC/MS analysis Auto Pump 1 Pump 1 Waste Anti-Id UV UV V:P1 2uL loop RPLC Pump 2 V:P2 V:P2 Pump 2 V:P1 QTOF QTOF QTOF 11 Pump 1 UV Pump 2 11
13 First Dimension Anti-ID Chromatography with UV Detection CovX Body Std in mouse serum, UV at 28 nm Anti-Id column Protein A column 12 12
14 Conc (ug/ml) First Dimension Anti-ID Chromatography with UV Detection 7 Mouse PK Curves of Three related CovX Bodies using Anti-ID Column and UV Detection at 28 nm Time (hrs) 13 GLP-1 Exendin-4 Modified Exendin-4 13
15 Two-Dimensional Liquid Chromatography with MS Detection GLP-1 CovX-body PK samples PK at 6 hrs PK at 1 hr PK at 5 min Dosing solution 14 14
16 Two-Dimensional Liquid Chromatography with MS Detection Conc (ug/ml) Ab+GLP-1-21 Da GLP-1 CovX-body PK samples PK at 6 hrs Immunoassay Results 35. PK at 1 hr GLP-1 Total GLP-1 Active PK at 5 min Time (hrs) Ab+GLP-1 Dosing solution HAEGTFTSDVSSYLEGQA AK EFIAWLVKGR 15 15
17 Peptide Stability in DPP-4 by RPLC/MS and MS/MS CVX1227 with DPP enzyme, day June7a (5.18) Cm (246:264) Incubated with DPP-4 overnight 1.16e GLP-1 peptide -28 Da (-HA) June7a (4.973) Cm (247:261) 1 GLP-1 peptide HAEGTFTSDVSSYLEGQAAK EFIAWLVKGR m/z 16 16
18 Two-Dimensional Liquid Chromatography with MS Detection Exendin-4 CovX-body PK samples CVX1844_21 3ug/mL water 5. 31Aug9a (64.25) M1 [Ev-64554,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1211:1479) PK at 48hrs e Aug9a (64.13) M1 [Ev-6599,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:1483) 1 PK at 31 hrs e Aug9a (64.393) M1 [Ev-6479,It32] (Gs,2.,2817:4,1.,L33,R33); Cm (128:1477) PK at 24 hrs e Aug9a (7.742) M1 [Ev-6586,It36] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:148) 1 Dosing solution e mass
19 Conc (ug/ml) 5. Ab+2xpeptides -2 and 4 Da CVX1844_21 3ug/mL water 31Aug9a (64.25) M1 [Ev-64554,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1211:1479) Two-Dimensional Liquid Chromatography with MS Detection Aug9a (64.13) M1 [Ev-6599,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:1483) Aug9a (64.393) M1 [Ev-6479,It32] (Gs,2.,2817:4,1.,L33,R33); Cm (128:1477) PK at 48hrs PK at 31 hrs PK at 24 hrs Aug9a (7.742) M1 [Ev-6586,It36] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:148) Dosing solution -HG Exendin-4 CovX-body PK samples 9.7e ; IEWLKNGGPSSGAPPPS mass Ab+2xpeptides Immunoassay Results e4 2.29e Time (hrs) Total Active HGEGTFTSDLSKQMEEEAVR 1.1e5 LFIEWLKNGGPSSGAPPPSG EGTFTSDLSKQMEEEAVRLF 18
20 CVX225_21 PK at 6hr 5. 31Aug9a (64.126) M1 [Ev-63974,It31] (Gs,2.,2781:45,1.,L33,R33); Cm (1212:1463) PK at 48 hrs Two-Dimensional Liquid Chromatography with MS Detection Modified Exendin-4 CovX-body e Aug9a (64.38) M1 [Ev-8195,It32] (Gs,2.,2571:4,1.,L33,R33); Cm (121:1461) PK at 31 hrs ; e Aug9a (64.392) M1 [Ev-7484,It33] (Gs,2.,2667:4,1.,L33,R33); Cm (1213:1462) PK at 24 hrs ; e Aug9a (64.326) M1 [Ev-7654,It4] (Gs,2.,2667:4,1.,L33,R33); Cm (1212:1463) 1 19 PK at 6 hrs e mass
21 Two-Dimensional Liquid Chromatography with MS Detection Conc (ug/ml) CVX225_21 PK at 6hr 5. 31Aug9a (64.126) M1 [Ev-63974,It31] (Gs,2.,2781:45,1.,L33,R33); Cm (1212:1463) 1 Ab+2xpeptides -68 Da PK at 48 hrs Modified Exendin-4 CovX-body e4 Immunoassay Results 31Aug9a (64.38) M1 [Ev-8195,It32] (Gs,2.,2571:4,1.,L33,R33); Cm (121:1461) 1 PK at 31 hrs e4 Total Active Aug9a (64.392) M1 [Ev-7484,It33] (Gs,2.,2667:4,1.,L33,R33); Cm (1213:1462) 1 1 PK at 24 hrs Aug9a (64.326) M1 [Ev-7654,It4] (Gs,2.,2667:4,1.,L33,R33); Cm (1212:1463) PK at 6 hrs e4 Ab+2xpeptides e5 Time (hrs) mass
22 Conc (ug/ml) Immunoassay Results using C-terminal Specific Ab Using C-Term Specific Ab TMB Color 6. Modified Exendin-4 CovX-body Immunoassay Results SA-HRP Total Active Exendin C-term 3) Anti-peptide (C-term Specific) 2) CovX body 1) Anti-Id Time (hrs) Block Block Block Block 21 21
23 Conc (ug/ml) Conc (ug/ml) Time (hrs) Modified Exendin-4 CovX-Body -Excellent PK and half-life -Some degradation (not active) -Immunoassay active and 2 peptide additions by MS correlate Peptide Optimization Results Immunoassay and 2DLC/MS Comparison IA Total IA Active MS 1PA-21 MS 1PA GLP-1 CovX-Body 14. -Poor 12.PK and half-life 1. -Degraded quickly 8. -Immunoassay 6. (IA) active and 1 peptide 4. addition (PA) by MS correlate IA Total IA Active MS 2PA-68 MS 2PA Time (hrs)
24 Summary 23 Anti-Idiotype reagent greatly reduces background interference in immunoassay and 2DLC/MS and is a universal reagent for CovX-Body capture 2DLC/MS is a powerful technique for the automated analysis of intact proteins from serum 2DLC/MS can be used to confirm immunoassay results when using the same reagents to capture CovX-Bodies Mass spectrometry of intact proteins is useful for the identification of in-vivo metabolites Analysis of PK samples for intact biotherapeutics and in-vivo metabolites is a powerful research tool for improving drug development optimization
25 Questions/Discussion Acknowledgements: James Kerr Gary Ward Rodney Lappe CHAPTER 5: INSTRUMENTATION FOR COMPREHENSIVE MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY CHAPTER 6: METHOD DEVELOPMENT IN COMPREHENSIVE MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY CHAPTER 18 THE ANALYSIS OF SURFACTANTS BY MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY 24
SUPPLEMENTAL INFORMATION
SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The
More informationCharacterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt
More informationSee external label 2 C-8 C Σ=96 tests Cat # 3122Z MICROWELL ELISA THYROID STIMULATING HORMONE (TSH) ENZYME IMMUNOASSAY TEST KIT TSH.
DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external
More informationNature Methods: doi: /nmeth Supplementary Figure 1
Supplementary Figure 1 Subtiligase-catalyzed ligations with ubiquitin thioesters and 10-mer biotinylated peptides. (a) General scheme for ligations between ubiquitin thioesters and 10-mer, biotinylated
More informationProtein MultiColor Stable, Low Range
Product Name: DynaMarker Protein MultiColor Stable, Low Range Code No: DM670L Lot No: ******* Size: 200 μl x 3 (DM670 x 3) (120 mini-gel lanes) Storage: 4 C Stability: 12 months at 4 C Storage Buffer:
More informationNF-κB p65 (Phospho-Thr254)
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 NF-κB p65 (Phospho-Thr254) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02015 Please read the provided manual
More informationTwo-color lateral flow assay for multiplex detection of causative agents behind acute febrile illnesses
Supplementary Information Two-color lateral flow assay for multiplex detection of causative agents behind acute febrile illnesses Seoho Lee 1,2, Saurabh Mehta 2,3*, David Erickson 1,2* 1 Sibley School
More informationEuropium Labeling Kit
Europium Labeling Kit Catalog Number KA2096 100ug *1 Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...
More informationShotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance.
Abundance Abundance Abundance Abundance Abundance Shotgun Proteomics Protein Mixture 1 2 3 MS/MS proteolysis m/z 2 3 Time µlc m/z MS 1 m/z Peptide Mixture m/z Block Diagram of a Mass Spectrometer Sample
More informationInsulin (Porcine/Canine) ELISA
Insulin (Porcine/Canine) ELISA For the quantitative measurement of insulin in Porcine/Canine serum and plasma (EDTA) For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 80-INSPO-E01
More informationMouse GLP-2 EIA. Cat. No. KT-374. For the quantitative determination of GLP-2 in mouse serum or plasma. For Research Use Only. 1 Rev.
Mouse GLP-2 EIA For the quantitative determination of GLP-2 in mouse serum or plasma. Cat. No. KT-374 For Research Use Only. 1 Rev. 11357374 PRODUCT INFORMATION Mouse GLP-2 EIA Cat. No. KT-374 INTENDED
More informationExendin-4 (Exenatide) ELISA Kit
Exendin-4 (Exenatide) ELISA Kit Catalog: DEIABL227 For the quantitative determination of Exendin-4 in serum or plasma using competitive ELISA method For Research Use Only. Protocol Provided for Informational
More informationSupplementary Material
Supplementary Material HLA-DM Captures Partially Empty HLA-DR Molecules for Catalyzed Peptide Removal Anne-Kathrin Anders, Melissa J. Call, Monika-Sarah E. D. Schulze, Kevin D. Fowler, David A. Schuert,
More informationHuman Urokinase / PLAU / UPA ELISA Pair Set
Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized
More informationChip-Based E-Tip SPE followed by Infusion MS. Copyright by Jack Henion, 2015 Lecture 1, Page 30
Chip-Based E-Tip SPE followed by Infusion MS Copyright by Jack Henion, 2015 Lecture 1, Page 30 Infusion -MS Analysis of Sample Mixtures HPLC Mass Spec Elution/spray solvent Pipette tip with micro SPE packing
More informationLOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016
LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES Gilles Frache Materials Characterization Day October 14 th 2016 1 MOLECULAR ANALYSES Which focus? LOCALIZATION of molecules by Mass Spectrometry
More informationHuman LDL Receptor / LDLR ELISA Pair Set
Human LDL Receptor / LDLR ELISA Pair Set Catalog Number : SEK10231 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized in
More informationInfluenza A H1N1 HA ELISA Pair Set
Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the
More informationO O H. Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION EXPERIMENTAL. LC /MS conditions
Simplifying Qual/Quan Analysis in Discovery DMPK using UPLC and Xevo TQ MS Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION The determination of the drug metabolism
More informationBioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS
Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS Jenny Chen, Hongxia Wang, Zhiqi Hao, Patrick Bennett, and Greg Kilby Thermo Fisher
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding
More informationAutomated Purification and Analytical Reinjection of a Small Molecule Drug, Probenecid, on a Gilson LC/MS Dual Function System
Automated Purification and Analytical Reinjection of a Small Molecule Drug, Probenecid, on a Gilson LC/MS Dual Function System Keywords Introduction Application Note PHA0413 High Pressure Liquid Chromatography
More informationComprehensive Two-Dimensional HPLC and Informative Data Processing for Pharmaceuticals and Lipids
PO-CON1576E Comprehensive Two-Dimensional HPLC and Informative Data Processing for Pharmaceuticals and Lipids HPLC 2015 PSB-MULTI-06 Yoshiyuki WATABE, Tetsuo IIDA, Daisuke NAKAYAMA, Kanya TSUJII, Saki
More informationPorcine/Canine Insulin ELISA
Porcine/Canine Insulin ELISA For the quantitative determination of insulin in porcine or canine serum and plasma. Please read carefully due to Critical Changes, e.g., Calculation of Results. For Research
More informationMouse Cathepsin B ELISA Kit
GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Mouse Cathepsin B ELISA Kit Catalog No. GWB-ZZD154
More informationAnti-Simponi Antibodies
Anti-Simponi Antibodies AbD Serotec offers you recombinant monoclonal antibodies to the antibody drug golimumab (Simponi). Our ready-made anti-golimumab antibodies are ideal for preclinical research and
More informationInfluenza B Hemagglutinin / HA ELISA Pair Set
Influenza B Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK11053 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized
More informationSIV p27 ANTIGEN CAPTURE ASSAY
SIV p27 ANTIGEN CAPTURE ASSAY Enzyme Immunoassay for the detection of Simian Immunodeficiency Virus (SIV) p27 in tissue culture media Catalog #5436 and #5450 Version 6; 12/2012 ABL PRODUCTS AND SERVICES
More informationAnti-HUMIRA Antibodies
Anti-HUMIRA Antibodies AbD Serotec offers you recombinant monoclonal antibodies to the human antibody adalimumab (HUMIRA). Our ready-made anti-adalimumab antibodies are ideal for preclinical research and
More informationHuman Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set
Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Catalog Number : SEK11233 To achieve the best assay results, this manual must be read carefully before using this product
More informationTECHNICAL BULLETIN. Catalog Number RAB0447 Storage Temperature 20 C
Phospho-Stat3 (ptyr 705 ) and pan-stat3 ELISA Kit for detection of human, mouse, or rat phospho-stat3 (ptyr 705 ) and pan-stat3 in cell and tissue lysates Catalog Number RAB0447 Storage Temperature 20
More informationTitle: Column Chromatography of Green Fluorescent Protein
Title: Column Chromatography of Green Fluorescent Protein Approvals: Preparer Date_07Oct06 Reviewer: Mary Jane Kurtz Date 09Jul13 Part I Crude Isolation of GFP from Lysed Cells q Page 1 of 6 1. Purpose:
More informationHuman Cathepsin D ELISA Kit
GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Human Cathepsin D ELISA Kit Catalog No. GWB-J4JVV9
More informationTECHNICAL BULLETIN. Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates
Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates Catalog Number RAB0011 Storage Temperature 20 C TECHNICAL BULLETIN Product Description
More informationMouse TrkB ELISA Kit
Mouse TrkB ELISA Kit CATALOG NO: IRKTAH5472 LOT NO: SAMPLE INTENDED USE For quantitative detection of mouse TrkB in cell culture supernates, cell lysates and tissue homogenates. BACKGROUND TrkB receptor
More informationMeasuring Lipid Composition LC-MS/MS
Project: Measuring Lipid Composition LC-MS/MS Verification of expected lipid composition in nanomedical controlled release systems by liquid chromatography tandem mass spectrometry AUTHORED BY: DATE: Sven
More informationInsulin ELISA. For the quantitative determination of insulin in serum and plasma.
Insulin ELISA For the quantitative determination of insulin in serum and plasma. For In Vitro Diagnostic use within the United States of America. This product is for Research Use Only outside of the United
More informationMouse C-peptide EIA. Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY
Mouse C-peptide EIA Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY TOYO 2CHOME, KOTO-KU, TOKYO, 135-0016, JAPAN http://www.cosmobio.co.jp e-mail : export@cosmobio.co.jp Phone : +81-3-5632-9617 FAX : +81-3-5632-9618
More informationab Cathepsin D Human ELISA Kit
ab119586 Cathepsin D Human ELISA Kit Instructions for Use For quantitative detection of Human Cathepsin D in cell culture supernatants, serum and plasma (heparin, EDTA). This product is for research use
More informationWork-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples:
Dr. Sanjeeva Srivastava IIT Bombay Work-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples: Sample preparation for serum proteome analysis Sample
More information2D-LC as an Automated Desalting Tool for MSD Analysis
2D-LC as an Automated Desalting Tool for MSD Analysis Direct Mass Selective Detection of a Pharmaceutical Peptide from an MS-Incompatible USP Method Application Note Biologics and Biosimilars Author Sonja
More informationHuman IL-2. Pre-Coated ELISA Kit
Human IL-2 (Interleukin 2) Pre-Coated ELISA Kit Catalog No: 90-2083 1 96 well Format (96 tests) Detection Range: 31.2 2000 pg/ml Sensitivity: < 18.75 pg/ml This immunoassay kit allows for the in vitro
More informationHIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual)
HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) BACKGROUND Human Immunodeficiency Virus ( HIV ) can be divided into two major types, HIV type 1 (HIV-1) and HIV type 2 (HIV-2). HIV-1 is related to
More informationNote: During 30 minute incubation; proceed thru appropriate sections below (e.g. sections II, III and V).
LEGEND MAX β Amyloid x 40 LEGEND MAX β Amyloid x 40 ELISA Kit Components and Protocol Kit Components Capture Antibody Coated Plate 1 stripwell plate 1 40 Standard (2) 20μg vial 5X Wash Buffer 125mL Standard
More informationOxiSelect HNE-His Adduct ELISA Kit
Product Manual OxiSelect HNE-His Adduct ELISA Kit Catalog Number STA-334 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined mechanism
More informationBovine Insulin ELISA
Bovine Insulin ELISA For quantitative determination of insulin in bovine serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 80-INSBO-E01 Size: 96 wells Version:
More informationHuman HBcAb IgM ELISA kit
Human HBcAb IgM ELISA kit Catalog number: NR-R10163 (96 wells) The kit is designed to qualitatively detect HBcAb IgM in human serum or plasma. FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC PURPOSES
More informationRat cholesterol ELISA Kit
Rat cholesterol ELISA Kit Catalog No. CSB-E11706r (96T) This immunoassay kit allows for the in vitro quantitative determination of rat Cholesterol concentrations in serum, plasma and other biological fluids.
More informationMouse Ultrasensitive Insulin ELISA
Mouse Ultrasensitive Insulin ELISA For the quantitative determination of insulin in mouse serum and plasma. Please read carefully due to Critical Changes, e.g., Calculation of Results. For Research Use
More informationUV Tracer TM Maleimide NHS ester
UV Tracer TM Maleimide HS ester Product o.: 1020 Product ame: UV-Tracer TM Maleimide-HS ester Chemical Structure: Chemical Composition: C 41 H 67 5 18 Molecular Weight: 1014.08 Appearance: Storage: Yellow
More informationHuman Cathepsin V ELISA Kit
Human Cathepsin V ELISA Kit Catalog #: DIA-XYA118 Detection and Quantification of Human Cathepsin V Concentrations in Cell Lysates, Sera and Plasma. Please read the provided manual as suggested experimental
More informationMALDI Imaging Drug Imaging Detlev Suckau Head of R&D MALDI Bruker Daltonik GmbH. December 19,
MALDI Imaging Drug Imaging Detlev Suckau Head of R&D MALDI Bruker Daltonik GmbH December 19, 2014 1 The principle of MALDI imaging Spatially resolved mass spectra are recorded Each mass signal represents
More informationInfluenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set
Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK40103 To achieve the best assay results, this manual must be read carefully before using this product and the assay
More informationRat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum
Rat C-peptide ELISA For the quantitative determination of C-peptide in rat serum Please read carefully due to Critical Changes, e.g., see Calculation of Results. For Research Use Only. Not For Use In Diagnostic
More informationSuperoxide Dismutase Assay Kit
Superoxide Dismutase Assay Kit Catalog Number KA3782 100 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationApplying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis
Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis Ying Qing Yu Waters Corporation, Milford, MA, USA APPLICATION BENEFITS
More informationMichael Blackburn HOW LOW CAN YOU GO: DRIVING DOWN LIMITS OF HYBRID IA-LC/MS. European Bioanalytical Forum. 19 th November 2015
HOW LOW CAN YOU GO: DRIVING DOWN LIMITS OF QUANTITATION FOR PEPTIDE BIOMOLECULES BY HYBRID IA-LC/MS Michael Blackburn Bioanalytical Services European Bioanalytical Forum Barcelona, Spain 19 th November
More informationMULTIDIMENSIONALE SCHEIDINGEN IN DE GAS- EN VLOEISTOF CHROMATOGRAFIE
MULTIDIMENSINALE SCHEIDINGEN IN DE GAS- EN VLEISTF CHRMATGRAFIE Hans-Gerd Janssen and many others Unilever Foods R&D Vlaardingen, Vlaardingen, the Netherlands University of Amsterdam, Amsterdam, the Netherlands
More informationEnzyme Immunoassay for
Enzyme Immunoassay for Prostaglandin E 2 For Research Use Only INTRODUCTION Prostaglandin E 2 EIA Kit Product Number: EA02 Store at 4 C FOR RESEARCH USE ONLY Document Control Number: EA02.120214 Page 1
More informationSee external label 96 tests ULTRASENSITIVE THYROID STIMULATING HORMONE (u-tsh) TSH Ultra Sensitive
DIAGNOSTIC AUTOMATION, INC. 21250 Califa Street, Suite 102 and 116, Woodland Hills, CA 91367 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com
More informationCHAPTER 4 IMMUNOLOGICAL TECHNIQUES
CHAPTER 4 IMMUNOLOGICAL TECHNIQUES Nitroblue Tetrazolium Chloride (NBT) Reduction test NBT reduction test was evaluated by employing the method described by Hudson and Hay,1989 based upon principle that
More informationAnalysis of Peptides via Capillary HPLC and Fraction Collection Directly onto a MALDI Plate for Off-line Analysis by MALDI-TOF
Analysis of Peptides via Capillary HPLC and Fraction Collection Directly onto a MALDI Plate for Off-line Analysis by MALDI-TOF Application Note 219 Joan Stevens, PhD; Luke Roenneburg; Kevin Fawcett (Gilson,
More informationRat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum. For Research Use Only. Not For Use In Diagnostic Procedures.
Rat C-peptide ELISA For the quantitative determination of C-peptide in rat serum. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: Size: 80-CPTRT-E01 96 wells Version: May 26,
More informationMASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010
MASS SPECTROMETRY BASED METABOLOMICS Pavel Aronov ABRF2010 Metabolomics Research Group March 21, 2010 Types of Experiments in Metabolomics targeted non targeted Number of analyzed metabolites is limited
More informationGLP-2 ELISA. For the quantitative determination of GLP-2 in human serum and plasma samples.
GLP-2 ELISA For the quantitative determination of GLP-2 in human serum and plasma samples. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 48-GP2HU-E01.1 Size: 96 wells Version:
More informationProduct Information. Instruction for Use. Troponin I ELISA kit Catalog Number: EA Storage Temperature: 2 8 C
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 Phone: 1.888.267.4436 Fax: 301-340-9254 Email: techsupport@origene.com Web: www.origene.com Product Information Troponin I ELISA kit Catalog Number:
More informationHuman Alpha 1 microglobulin ELISA Kit
Human Alpha 1 microglobulin ELISA Kit Catalogue No.: EH4144 Size: 48T/96T Reactivity: Human Range:0.625-40ng/ml Sensitivity:
More informationImprove Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant
Improve Protein Analysis with the New, Mass Spectrometry- Compatible Surfactant ABSTRACT Incomplete solubilization and digestion and poor peptide recovery are frequent limitations in protein sample preparation
More informationHuman Cathepsin V ELISA Kit
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 Human Cathepsin V ELISA Kit Catalog #: OKAG00201 Detection and Quantification of Human Cathepsin V (hctsv) Concentrations
More informationRat Insulin ELISA. For the quantitative determination of insulin in rat serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures.
Rat Insulin ELISA For the quantitative determination of insulin in rat serum and plasma For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: Size: 80-INSRT-E01, E10 96 wells, 10
More informationSTAT3 (py705) (Human/Mouse/Rat) ELISA Kit
STAT3 (py705) (Human/Mouse/Rat) ELISA Kit Catalog Number KA2175 96 assays Version: 01 Intended for research use only www.abnova.com I. INTRODUCTION STAT3 (py705) (Human/Mouse/Rat) ELISA (Enzyme-Linked
More informationAFLATOXIN M1 CAT. NO. 961AFLMO1M
h AFLATOXIN M1 CAT. NO. 961AFLMO1M Competitive ELISA Immunoassay for the quantitative detection of Aflatoxin M1 in milk, milk powder and cheese. General Aflatoxins are toxic metabolites produced by a variety
More informationEvolution of Peak Capacity in Fluid-based Separation Techniques
Evolution of Peak Capacity in Fluid-based Separation Techniques P Fluid-based SOLID LIQUID SUPER- CRITICAL FLUID 73.8 bar GAS 31.1 C T P Fluid-based + CE FLUID SOLID 73.8 bar GAS 31.1 C T 21 st Century
More informationUnbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM
Unbiased in-depth characterization of CEX fractions from a stressed mab by MS Matthias Berg, Novartis Pharma, BTDM Characterization of CEX fractions Biopharmaceuticals like IgGs show a certain degree of
More informationMercodia Porcine C-peptide ELISA
Mercodia Porcine C-peptide ELISA Directions for Use 10-1256-01 REAGENTS FOR 96 DETERMINATIONS Manufactured by Mercodia AB, Sylveniusgatan 8A, SE-754 50 Uppsala, Sweden EXPLANATION OF SYMBOLS USED ON LABELS
More informationLH (Bovine) ELISA Kit
LH (Bovine) ELISA Kit Catalog Number KA2280 96 assays Version: 05 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...
More informationComparison of mass spectrometers performances
Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion
More informationSTAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit
STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit Catalog Number KA2176 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Principle of the Assay...
More informationSupplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems
Supplementary Figure 1 Overview of steps in the construction of photosynthetic protocellular systems (a) The small unilamellar vesicles were made with phospholipids. (b) Three types of small proteoliposomes
More informationMouse C-peptide ELISA
Mouse C-peptide ELISA For the quantitative determination of C-peptide in mouse serum. For Research Use Only. Not for use in Diagnostic Procedures. Please read carefully due to Critical Changes, e.g., Preparation
More informationSee external label 2 C 8 C 96 tests B-HCG (Total) Cat #
DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external
More informationhuman Total Cathepsin B Catalog Number: DY2176
human Total Cathepsin B Catalog Number: DY2176 This DuoSet ELISA Development kit contains the basic components required for the development of sandwich ELISAs to measure natural and recombinant human Total
More informationAuthor. Introduction. Abstract
Simultaneous Measurement of Sirolimus and Tacrolimus Concentrations in Blood by Semi-Automated Extraction and Liquid Chromatography-Electrospray Ionization Mass Spectrometry Application Author Gary L.
More informationDr. Erin E. Chambers Waters Corporation. Presented by Dr. Diego Rodriguez Cabaleiro Waters Europe Waters Corporation 1
Development of an SPE-LC/MS/MS Assay for the Simultaneous Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid in Support of Alzheimer s Research Dr. Erin E. Chambers Waters Corporation Presented
More informationRat Glicentin EIA FOR RESEARCH USE ONLY. <Distributed by> DF Kasumigaseki Place, 3-6-7, Kasumigaseki, Chiyoda-ku Tokyo Japan
YK111 Rat Glicentin EIA FOR RESEARCH USE ONLY DF Kasumigaseki Place, 3-6-7, Kasumigaseki, Chiyoda-ku Tokyo 100-0013 Japan URL: http://www.sceti.co.jp/export/ e-mail: exp-pet@sceti.co.jp
More informationSupporting Information
Supporting Information Cyclic Peptidyl Inhibitors against Human Peptidyl-Prolyl Isomerase Pin1 Tao Liu, Yu Liu, Hung-Ying Kao, *,, and Dehua Pei Table of Contents: Table S1. Structures of amino acid building
More informationMouse C-peptide ELISA
Mouse C-peptide ELISA For the quantitative determination of C-peptide in mouse serum. For Research Use Only. Not for use in Diagnostic Procedures. Please read carefully due to Critical Changes, e.g., Calculation
More informationEdgar Naegele. Abstract
Simultaneous determination of metabolic stability and identification of buspirone metabolites using multiple column fast LC/TOF mass spectrometry Application ote Edgar aegele Abstract A recent trend in
More informationThe Immunoassay Guide to Successful Mass Spectrometry. Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013
The Immunoassay Guide to Successful Mass Spectrometry Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013 What is it? Hey! Look at that! Something is reacting in here! I just wish I knew what it
More informationRayBio Human Granzyme B ELISA Kit
RayBio Human Granzyme B ELISA Kit Catalog #: ELH-GZMB User Manual Last revised April 15, 2016 Caution: Extraordinarily useful information enclosed ISO 13485 Certified 3607 Parkway Lane, Suite 100 Norcross,
More informationACTG Laboratory Technologist Committee Revised Version 2.0 ACTG Lab Man Coulter HIV-1 p24 ELISA May 21, 2004
Coulter HIV p24 1. PRINCIPLE The Human Immunodeficiency Virus Type 1 (HIV-1) is recognized as the etiologic agent of acquired immunodeficiency syndrome (AIDS). The virus is transmitted by sexual contact,
More informationPRODUCT INFORMATION & MANUAL
PRODUCT INFORMATION & MANUAL 0.4 micron for Overall Exosome Isolation (Cell Media) NBP2-49826 For research use only. Not for diagnostic or therapeutic procedures. www.novusbio.com - P: 303.730.1950 - P:
More informationPaul D. Rainville Ph.D. Health Sciences Group Waters Corporation Waters Corporation 1
A new level of sensitivity and standardization: The promise of integrated micro fluidic devices coupled with mass spectrometry for the analysis of biofluids Paul D. Rainville Ph.D. Health Sciences Group
More informationARK Methotrexate Assay Application Ortho Clinical Diagnostics VITROS 5600 Integrated System and VITROS 4600 Chemistry System
C ARK Methotrexate Assay Application Ortho Clinical Diagnostics VITROS 5600 Integrated System and VITROS 4600 Chemistry System Reference No. 5026000100 Intended for the Quantitative Determination of Methotrexate
More informationYK052 Mouse Leptin ELISA
YK052 Mouse Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA-SHI SHIZUOKA, JAPAN 418-0011 Contents Ⅰ. Introduction 2 Ⅱ. Characteristics 3 Ⅲ. Composition 4 Ⅳ. Method
More informationSUPPLEMENTARY INFORMATION
Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with
More informationTECHNICAL BULLETIN. GLP-1 EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0201 Storage Temperature 20 C
GLP-1 EIA Kit for serum, plasma, culture supernatant, and cell lysates Catalog Number RAB0201 Storage Temperature 20 C TECHNICAL BULLETIN Product Description The GLP-1 (Glucagon-like Peptide 1) Enzyme
More informationHuman Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set
Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Catalog Number : SEK11695 To achieve the best assay results, this manual must be read carefully before using this product
More information