Robert E. Murphy, Arvind Kinhikar, Joselyn Del Rosario, Ryan Preston, Mike Shields, and Nancy Levin

Size: px
Start display at page:

Download "Robert E. Murphy, Arvind Kinhikar, Joselyn Del Rosario, Ryan Preston, Mike Shields, and Nancy Levin"

Transcription

1 Combined use of Immunoassay and Two-Dimensional Liquid Chromatography Mass Spectrometry for the Detection and Identification of Metabolites from Biotherapeutic Pharmacokinetic Samples Robert E. Murphy, Arvind Kinhikar, Joselyn Del Rosario, Ryan Preston, Mike Shields, and Nancy Levin CovX, Pfizer BioTherapeutics Research and Development September 15, 211

2 Agenda CovX Technology Anti-Idiotype Capture Reagent Immunoassays Developed and PK Results Two-dimensional Liquid Chromatography/MS method 2DLC/MS PK Results and Intact Protein Metabolite Identification Immunoassay and 2DLC/MS correlation Summary 1

3 CovX Technology Pharmacophore fusion onto catalytic antibody ACTIVE MOLECULE SPONTANEOUS COVALENT ASSEMBLY IN SOLUTION ANTIBODY HOMOGENEOUS FUSION PROTEIN 2

4 A closer look at the fusion reaction Intact SEC/MS characterization T (minutes after addition) Mid-reaction time point Final product (2 peptides fused) Deconvoluted Mass Spectra (149 to 155 amu) 3

5 CovX-bodies Evolution Peptides to proteins to bi-functional bioconjugates 4 Mono-functional peptide CovX-Bodies Substitute protein for peptides: protein CovX-Bodies Bi-functional peptide CovX-Bodies

6 Transforming Peptides into Drugs Antibody and peptide are both key CovX-Body design elements Peptide and linker design dramatically impacts CovX-Body properties 5 5

7 GLP-1 Model 6 GLP-1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR DPP-4 enzyme -HA EGTFTSDVSSYLEGQAAKEFIAWLVKGR Exendin-4 HGEGTFTSDLSKQMEEEAVR LFIEWLKNGGPSSGAPPPSG EGTFTSDLSKQMEEEAVRLF IEWLKNGGPSSGAPPPS

8 Anti-Idiotype Development: Specific and Universal Capture Reagent 7 Anti-Idiotype MAb Variable Constant CovX Body Fc Domain Peptide Fab Anti-Idiotype Antibody that binds to the variable domains of another antibody Develop non-blocking private anti-idiotype that is specific for CovX body Utility Generic capture or detection reagent for all CovX Bodies More sensitive assays; lower backgrounds Single format for preclinical and clinical assays Vendor independence

9 PK Immunoassays Developed 8 Total Active TMB Color TMB Color HRP 3) HRP-Antihuman IgG SA-HRP 3) Anti-peptide (N-term Specific) 2) CovX body 2) CovX body 1) Anti-Id 1) Anti-Id Block Block Block Block Block Block Block

10 Conc (ug/ml) Conc (ug/ml) Conc (ug/ml) Mouse PK Immunoassay Results GLP-1 CovX-body 5. Exendin-4 CovX-body Time (hrs) 6. Blue Total Green Active Time (hrs) Modified Exendin-4 CovX-body Time (hrs) 9

11 1 Anti-Idiotype Column Preparation -38 umoles of resin + 12 nmoles of anti-id in ph 9. buffer -react for 2 hrs, then quench with 1M tris -wash with PBS and 1M NaCl -pack 2 x 5 mm column with 15uL of resin

12 Two-Dimensional Liquid Chromatography with UV and MS Detection Step 1: Anti-Id Analysis and condition RPLC Step 2: Collect fraction minutes Step 3: RPLC/MS analysis Auto Pump 1 Pump 1 Waste Anti-Id UV UV V:P1 2uL loop RPLC Pump 2 V:P2 V:P2 Pump 2 V:P1 QTOF QTOF QTOF 11 Pump 1 UV Pump 2 11

13 First Dimension Anti-ID Chromatography with UV Detection CovX Body Std in mouse serum, UV at 28 nm Anti-Id column Protein A column 12 12

14 Conc (ug/ml) First Dimension Anti-ID Chromatography with UV Detection 7 Mouse PK Curves of Three related CovX Bodies using Anti-ID Column and UV Detection at 28 nm Time (hrs) 13 GLP-1 Exendin-4 Modified Exendin-4 13

15 Two-Dimensional Liquid Chromatography with MS Detection GLP-1 CovX-body PK samples PK at 6 hrs PK at 1 hr PK at 5 min Dosing solution 14 14

16 Two-Dimensional Liquid Chromatography with MS Detection Conc (ug/ml) Ab+GLP-1-21 Da GLP-1 CovX-body PK samples PK at 6 hrs Immunoassay Results 35. PK at 1 hr GLP-1 Total GLP-1 Active PK at 5 min Time (hrs) Ab+GLP-1 Dosing solution HAEGTFTSDVSSYLEGQA AK EFIAWLVKGR 15 15

17 Peptide Stability in DPP-4 by RPLC/MS and MS/MS CVX1227 with DPP enzyme, day June7a (5.18) Cm (246:264) Incubated with DPP-4 overnight 1.16e GLP-1 peptide -28 Da (-HA) June7a (4.973) Cm (247:261) 1 GLP-1 peptide HAEGTFTSDVSSYLEGQAAK EFIAWLVKGR m/z 16 16

18 Two-Dimensional Liquid Chromatography with MS Detection Exendin-4 CovX-body PK samples CVX1844_21 3ug/mL water 5. 31Aug9a (64.25) M1 [Ev-64554,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1211:1479) PK at 48hrs e Aug9a (64.13) M1 [Ev-6599,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:1483) 1 PK at 31 hrs e Aug9a (64.393) M1 [Ev-6479,It32] (Gs,2.,2817:4,1.,L33,R33); Cm (128:1477) PK at 24 hrs e Aug9a (7.742) M1 [Ev-6586,It36] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:148) 1 Dosing solution e mass

19 Conc (ug/ml) 5. Ab+2xpeptides -2 and 4 Da CVX1844_21 3ug/mL water 31Aug9a (64.25) M1 [Ev-64554,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1211:1479) Two-Dimensional Liquid Chromatography with MS Detection Aug9a (64.13) M1 [Ev-6599,It33] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:1483) Aug9a (64.393) M1 [Ev-6479,It32] (Gs,2.,2817:4,1.,L33,R33); Cm (128:1477) PK at 48hrs PK at 31 hrs PK at 24 hrs Aug9a (7.742) M1 [Ev-6586,It36] (Gs,2.,2817:4,1.,L33,R33); Cm (1212:148) Dosing solution -HG Exendin-4 CovX-body PK samples 9.7e ; IEWLKNGGPSSGAPPPS mass Ab+2xpeptides Immunoassay Results e4 2.29e Time (hrs) Total Active HGEGTFTSDLSKQMEEEAVR 1.1e5 LFIEWLKNGGPSSGAPPPSG EGTFTSDLSKQMEEEAVRLF 18

20 CVX225_21 PK at 6hr 5. 31Aug9a (64.126) M1 [Ev-63974,It31] (Gs,2.,2781:45,1.,L33,R33); Cm (1212:1463) PK at 48 hrs Two-Dimensional Liquid Chromatography with MS Detection Modified Exendin-4 CovX-body e Aug9a (64.38) M1 [Ev-8195,It32] (Gs,2.,2571:4,1.,L33,R33); Cm (121:1461) PK at 31 hrs ; e Aug9a (64.392) M1 [Ev-7484,It33] (Gs,2.,2667:4,1.,L33,R33); Cm (1213:1462) PK at 24 hrs ; e Aug9a (64.326) M1 [Ev-7654,It4] (Gs,2.,2667:4,1.,L33,R33); Cm (1212:1463) 1 19 PK at 6 hrs e mass

21 Two-Dimensional Liquid Chromatography with MS Detection Conc (ug/ml) CVX225_21 PK at 6hr 5. 31Aug9a (64.126) M1 [Ev-63974,It31] (Gs,2.,2781:45,1.,L33,R33); Cm (1212:1463) 1 Ab+2xpeptides -68 Da PK at 48 hrs Modified Exendin-4 CovX-body e4 Immunoassay Results 31Aug9a (64.38) M1 [Ev-8195,It32] (Gs,2.,2571:4,1.,L33,R33); Cm (121:1461) 1 PK at 31 hrs e4 Total Active Aug9a (64.392) M1 [Ev-7484,It33] (Gs,2.,2667:4,1.,L33,R33); Cm (1213:1462) 1 1 PK at 24 hrs Aug9a (64.326) M1 [Ev-7654,It4] (Gs,2.,2667:4,1.,L33,R33); Cm (1212:1463) PK at 6 hrs e4 Ab+2xpeptides e5 Time (hrs) mass

22 Conc (ug/ml) Immunoassay Results using C-terminal Specific Ab Using C-Term Specific Ab TMB Color 6. Modified Exendin-4 CovX-body Immunoassay Results SA-HRP Total Active Exendin C-term 3) Anti-peptide (C-term Specific) 2) CovX body 1) Anti-Id Time (hrs) Block Block Block Block 21 21

23 Conc (ug/ml) Conc (ug/ml) Time (hrs) Modified Exendin-4 CovX-Body -Excellent PK and half-life -Some degradation (not active) -Immunoassay active and 2 peptide additions by MS correlate Peptide Optimization Results Immunoassay and 2DLC/MS Comparison IA Total IA Active MS 1PA-21 MS 1PA GLP-1 CovX-Body 14. -Poor 12.PK and half-life 1. -Degraded quickly 8. -Immunoassay 6. (IA) active and 1 peptide 4. addition (PA) by MS correlate IA Total IA Active MS 2PA-68 MS 2PA Time (hrs)

24 Summary 23 Anti-Idiotype reagent greatly reduces background interference in immunoassay and 2DLC/MS and is a universal reagent for CovX-Body capture 2DLC/MS is a powerful technique for the automated analysis of intact proteins from serum 2DLC/MS can be used to confirm immunoassay results when using the same reagents to capture CovX-Bodies Mass spectrometry of intact proteins is useful for the identification of in-vivo metabolites Analysis of PK samples for intact biotherapeutics and in-vivo metabolites is a powerful research tool for improving drug development optimization

25 Questions/Discussion Acknowledgements: James Kerr Gary Ward Rodney Lappe CHAPTER 5: INSTRUMENTATION FOR COMPREHENSIVE MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY CHAPTER 6: METHOD DEVELOPMENT IN COMPREHENSIVE MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY CHAPTER 18 THE ANALYSIS OF SURFACTANTS BY MULTIDIMENSIONAL LIQUID CHROMATOGRAPHY 24

SUPPLEMENTAL INFORMATION

SUPPLEMENTAL INFORMATION SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The

More information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information

Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt

More information

See external label 2 C-8 C Σ=96 tests Cat # 3122Z MICROWELL ELISA THYROID STIMULATING HORMONE (TSH) ENZYME IMMUNOASSAY TEST KIT TSH.

See external label 2 C-8 C Σ=96 tests Cat # 3122Z MICROWELL ELISA THYROID STIMULATING HORMONE (TSH) ENZYME IMMUNOASSAY TEST KIT TSH. DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external

More information

Nature Methods: doi: /nmeth Supplementary Figure 1

Nature Methods: doi: /nmeth Supplementary Figure 1 Supplementary Figure 1 Subtiligase-catalyzed ligations with ubiquitin thioesters and 10-mer biotinylated peptides. (a) General scheme for ligations between ubiquitin thioesters and 10-mer, biotinylated

More information

Protein MultiColor Stable, Low Range

Protein MultiColor Stable, Low Range Product Name: DynaMarker Protein MultiColor Stable, Low Range Code No: DM670L Lot No: ******* Size: 200 μl x 3 (DM670 x 3) (120 mini-gel lanes) Storage: 4 C Stability: 12 months at 4 C Storage Buffer:

More information

NF-κB p65 (Phospho-Thr254)

NF-κB p65 (Phospho-Thr254) Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 NF-κB p65 (Phospho-Thr254) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02015 Please read the provided manual

More information

Two-color lateral flow assay for multiplex detection of causative agents behind acute febrile illnesses

Two-color lateral flow assay for multiplex detection of causative agents behind acute febrile illnesses Supplementary Information Two-color lateral flow assay for multiplex detection of causative agents behind acute febrile illnesses Seoho Lee 1,2, Saurabh Mehta 2,3*, David Erickson 1,2* 1 Sibley School

More information

Europium Labeling Kit

Europium Labeling Kit Europium Labeling Kit Catalog Number KA2096 100ug *1 Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...

More information

Shotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance.

Shotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance. Abundance Abundance Abundance Abundance Abundance Shotgun Proteomics Protein Mixture 1 2 3 MS/MS proteolysis m/z 2 3 Time µlc m/z MS 1 m/z Peptide Mixture m/z Block Diagram of a Mass Spectrometer Sample

More information

Insulin (Porcine/Canine) ELISA

Insulin (Porcine/Canine) ELISA Insulin (Porcine/Canine) ELISA For the quantitative measurement of insulin in Porcine/Canine serum and plasma (EDTA) For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 80-INSPO-E01

More information

Mouse GLP-2 EIA. Cat. No. KT-374. For the quantitative determination of GLP-2 in mouse serum or plasma. For Research Use Only. 1 Rev.

Mouse GLP-2 EIA. Cat. No. KT-374. For the quantitative determination of GLP-2 in mouse serum or plasma. For Research Use Only. 1 Rev. Mouse GLP-2 EIA For the quantitative determination of GLP-2 in mouse serum or plasma. Cat. No. KT-374 For Research Use Only. 1 Rev. 11357374 PRODUCT INFORMATION Mouse GLP-2 EIA Cat. No. KT-374 INTENDED

More information

Exendin-4 (Exenatide) ELISA Kit

Exendin-4 (Exenatide) ELISA Kit Exendin-4 (Exenatide) ELISA Kit Catalog: DEIABL227 For the quantitative determination of Exendin-4 in serum or plasma using competitive ELISA method For Research Use Only. Protocol Provided for Informational

More information

Supplementary Material

Supplementary Material Supplementary Material HLA-DM Captures Partially Empty HLA-DR Molecules for Catalyzed Peptide Removal Anne-Kathrin Anders, Melissa J. Call, Monika-Sarah E. D. Schulze, Kevin D. Fowler, David A. Schuert,

More information

Human Urokinase / PLAU / UPA ELISA Pair Set

Human Urokinase / PLAU / UPA ELISA Pair Set Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

Chip-Based E-Tip SPE followed by Infusion MS. Copyright by Jack Henion, 2015 Lecture 1, Page 30

Chip-Based E-Tip SPE followed by Infusion MS. Copyright by Jack Henion, 2015 Lecture 1, Page 30 Chip-Based E-Tip SPE followed by Infusion MS Copyright by Jack Henion, 2015 Lecture 1, Page 30 Infusion -MS Analysis of Sample Mixtures HPLC Mass Spec Elution/spray solvent Pipette tip with micro SPE packing

More information

LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016

LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016 LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES Gilles Frache Materials Characterization Day October 14 th 2016 1 MOLECULAR ANALYSES Which focus? LOCALIZATION of molecules by Mass Spectrometry

More information

Human LDL Receptor / LDLR ELISA Pair Set

Human LDL Receptor / LDLR ELISA Pair Set Human LDL Receptor / LDLR ELISA Pair Set Catalog Number : SEK10231 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized in

More information

Influenza A H1N1 HA ELISA Pair Set

Influenza A H1N1 HA ELISA Pair Set Influenza A H1N1 HA ELISA Pair Set for H1N1 ( A/Puerto Rico/8/1934 ) HA Catalog Number : SEK11684 To achieve the best assay results, this manual must be read carefully before using this product and the

More information

O O H. Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION EXPERIMENTAL. LC /MS conditions

O O H. Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION EXPERIMENTAL. LC /MS conditions Simplifying Qual/Quan Analysis in Discovery DMPK using UPLC and Xevo TQ MS Robert S. Plumb and Paul D. Rainville Waters Corporation, Milford, MA, U.S. INTRODUCTION The determination of the drug metabolism

More information

Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS

Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS Bioanalytical Quantitation of Biotherapeutics Using Intact Protein vs. Proteolytic Peptides by LC-HR/AM on a Q Exactive MS Jenny Chen, Hongxia Wang, Zhiqi Hao, Patrick Bennett, and Greg Kilby Thermo Fisher

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding

More information

Automated Purification and Analytical Reinjection of a Small Molecule Drug, Probenecid, on a Gilson LC/MS Dual Function System

Automated Purification and Analytical Reinjection of a Small Molecule Drug, Probenecid, on a Gilson LC/MS Dual Function System Automated Purification and Analytical Reinjection of a Small Molecule Drug, Probenecid, on a Gilson LC/MS Dual Function System Keywords Introduction Application Note PHA0413 High Pressure Liquid Chromatography

More information

Comprehensive Two-Dimensional HPLC and Informative Data Processing for Pharmaceuticals and Lipids

Comprehensive Two-Dimensional HPLC and Informative Data Processing for Pharmaceuticals and Lipids PO-CON1576E Comprehensive Two-Dimensional HPLC and Informative Data Processing for Pharmaceuticals and Lipids HPLC 2015 PSB-MULTI-06 Yoshiyuki WATABE, Tetsuo IIDA, Daisuke NAKAYAMA, Kanya TSUJII, Saki

More information

Porcine/Canine Insulin ELISA

Porcine/Canine Insulin ELISA Porcine/Canine Insulin ELISA For the quantitative determination of insulin in porcine or canine serum and plasma. Please read carefully due to Critical Changes, e.g., Calculation of Results. For Research

More information

Mouse Cathepsin B ELISA Kit

Mouse Cathepsin B ELISA Kit GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Mouse Cathepsin B ELISA Kit Catalog No. GWB-ZZD154

More information

Anti-Simponi Antibodies

Anti-Simponi Antibodies Anti-Simponi Antibodies AbD Serotec offers you recombinant monoclonal antibodies to the antibody drug golimumab (Simponi). Our ready-made anti-golimumab antibodies are ideal for preclinical research and

More information

Influenza B Hemagglutinin / HA ELISA Pair Set

Influenza B Hemagglutinin / HA ELISA Pair Set Influenza B Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK11053 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

SIV p27 ANTIGEN CAPTURE ASSAY

SIV p27 ANTIGEN CAPTURE ASSAY SIV p27 ANTIGEN CAPTURE ASSAY Enzyme Immunoassay for the detection of Simian Immunodeficiency Virus (SIV) p27 in tissue culture media Catalog #5436 and #5450 Version 6; 12/2012 ABL PRODUCTS AND SERVICES

More information

Anti-HUMIRA Antibodies

Anti-HUMIRA Antibodies Anti-HUMIRA Antibodies AbD Serotec offers you recombinant monoclonal antibodies to the human antibody adalimumab (HUMIRA). Our ready-made anti-adalimumab antibodies are ideal for preclinical research and

More information

Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set

Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Human Immunodeficiency Virus type 1 (HIV-1) gp120 / Glycoprotein 120 ELISA Pair Set Catalog Number : SEK11233 To achieve the best assay results, this manual must be read carefully before using this product

More information

TECHNICAL BULLETIN. Catalog Number RAB0447 Storage Temperature 20 C

TECHNICAL BULLETIN. Catalog Number RAB0447 Storage Temperature 20 C Phospho-Stat3 (ptyr 705 ) and pan-stat3 ELISA Kit for detection of human, mouse, or rat phospho-stat3 (ptyr 705 ) and pan-stat3 in cell and tissue lysates Catalog Number RAB0447 Storage Temperature 20

More information

Title: Column Chromatography of Green Fluorescent Protein

Title: Column Chromatography of Green Fluorescent Protein Title: Column Chromatography of Green Fluorescent Protein Approvals: Preparer Date_07Oct06 Reviewer: Mary Jane Kurtz Date 09Jul13 Part I Crude Isolation of GFP from Lysed Cells q Page 1 of 6 1. Purpose:

More information

Human Cathepsin D ELISA Kit

Human Cathepsin D ELISA Kit GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Human Cathepsin D ELISA Kit Catalog No. GWB-J4JVV9

More information

TECHNICAL BULLETIN. Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates

TECHNICAL BULLETIN. Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates Phospho-Akt (pser 473 ) ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) in cell and tissue lysates Catalog Number RAB0011 Storage Temperature 20 C TECHNICAL BULLETIN Product Description

More information

Mouse TrkB ELISA Kit

Mouse TrkB ELISA Kit Mouse TrkB ELISA Kit CATALOG NO: IRKTAH5472 LOT NO: SAMPLE INTENDED USE For quantitative detection of mouse TrkB in cell culture supernates, cell lysates and tissue homogenates. BACKGROUND TrkB receptor

More information

Measuring Lipid Composition LC-MS/MS

Measuring Lipid Composition LC-MS/MS Project: Measuring Lipid Composition LC-MS/MS Verification of expected lipid composition in nanomedical controlled release systems by liquid chromatography tandem mass spectrometry AUTHORED BY: DATE: Sven

More information

Insulin ELISA. For the quantitative determination of insulin in serum and plasma.

Insulin ELISA. For the quantitative determination of insulin in serum and plasma. Insulin ELISA For the quantitative determination of insulin in serum and plasma. For In Vitro Diagnostic use within the United States of America. This product is for Research Use Only outside of the United

More information

Mouse C-peptide EIA. Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY

Mouse C-peptide EIA. Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY Mouse C-peptide EIA Cat. No. YII-YK013-EX FOR LABORATORY USE ONLY TOYO 2CHOME, KOTO-KU, TOKYO, 135-0016, JAPAN http://www.cosmobio.co.jp e-mail : export@cosmobio.co.jp Phone : +81-3-5632-9617 FAX : +81-3-5632-9618

More information

ab Cathepsin D Human ELISA Kit

ab Cathepsin D Human ELISA Kit ab119586 Cathepsin D Human ELISA Kit Instructions for Use For quantitative detection of Human Cathepsin D in cell culture supernatants, serum and plasma (heparin, EDTA). This product is for research use

More information

Work-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples:

Work-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples: Dr. Sanjeeva Srivastava IIT Bombay Work-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples: Sample preparation for serum proteome analysis Sample

More information

2D-LC as an Automated Desalting Tool for MSD Analysis

2D-LC as an Automated Desalting Tool for MSD Analysis 2D-LC as an Automated Desalting Tool for MSD Analysis Direct Mass Selective Detection of a Pharmaceutical Peptide from an MS-Incompatible USP Method Application Note Biologics and Biosimilars Author Sonja

More information

Human IL-2. Pre-Coated ELISA Kit

Human IL-2. Pre-Coated ELISA Kit Human IL-2 (Interleukin 2) Pre-Coated ELISA Kit Catalog No: 90-2083 1 96 well Format (96 tests) Detection Range: 31.2 2000 pg/ml Sensitivity: < 18.75 pg/ml This immunoassay kit allows for the in vitro

More information

HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual)

HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) HIV-1 p24 ELISA Pair Set Cat#: orb54951 (ELISA Manual) BACKGROUND Human Immunodeficiency Virus ( HIV ) can be divided into two major types, HIV type 1 (HIV-1) and HIV type 2 (HIV-2). HIV-1 is related to

More information

Note: During 30 minute incubation; proceed thru appropriate sections below (e.g. sections II, III and V).

Note: During 30 minute incubation; proceed thru appropriate sections below (e.g. sections II, III and V). LEGEND MAX β Amyloid x 40 LEGEND MAX β Amyloid x 40 ELISA Kit Components and Protocol Kit Components Capture Antibody Coated Plate 1 stripwell plate 1 40 Standard (2) 20μg vial 5X Wash Buffer 125mL Standard

More information

OxiSelect HNE-His Adduct ELISA Kit

OxiSelect HNE-His Adduct ELISA Kit Product Manual OxiSelect HNE-His Adduct ELISA Kit Catalog Number STA-334 96 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Lipid peroxidation is a well-defined mechanism

More information

Bovine Insulin ELISA

Bovine Insulin ELISA Bovine Insulin ELISA For quantitative determination of insulin in bovine serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 80-INSBO-E01 Size: 96 wells Version:

More information

Human HBcAb IgM ELISA kit

Human HBcAb IgM ELISA kit Human HBcAb IgM ELISA kit Catalog number: NR-R10163 (96 wells) The kit is designed to qualitatively detect HBcAb IgM in human serum or plasma. FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC PURPOSES

More information

Rat cholesterol ELISA Kit

Rat cholesterol ELISA Kit Rat cholesterol ELISA Kit Catalog No. CSB-E11706r (96T) This immunoassay kit allows for the in vitro quantitative determination of rat Cholesterol concentrations in serum, plasma and other biological fluids.

More information

Mouse Ultrasensitive Insulin ELISA

Mouse Ultrasensitive Insulin ELISA Mouse Ultrasensitive Insulin ELISA For the quantitative determination of insulin in mouse serum and plasma. Please read carefully due to Critical Changes, e.g., Calculation of Results. For Research Use

More information

UV Tracer TM Maleimide NHS ester

UV Tracer TM Maleimide NHS ester UV Tracer TM Maleimide HS ester Product o.: 1020 Product ame: UV-Tracer TM Maleimide-HS ester Chemical Structure: Chemical Composition: C 41 H 67 5 18 Molecular Weight: 1014.08 Appearance: Storage: Yellow

More information

Human Cathepsin V ELISA Kit

Human Cathepsin V ELISA Kit Human Cathepsin V ELISA Kit Catalog #: DIA-XYA118 Detection and Quantification of Human Cathepsin V Concentrations in Cell Lysates, Sera and Plasma. Please read the provided manual as suggested experimental

More information

MALDI Imaging Drug Imaging Detlev Suckau Head of R&D MALDI Bruker Daltonik GmbH. December 19,

MALDI Imaging Drug Imaging Detlev Suckau Head of R&D MALDI Bruker Daltonik GmbH. December 19, MALDI Imaging Drug Imaging Detlev Suckau Head of R&D MALDI Bruker Daltonik GmbH December 19, 2014 1 The principle of MALDI imaging Spatially resolved mass spectra are recorded Each mass signal represents

More information

Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set

Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set Influenza A H7N9 (A/Anhui/1/2013) Hemagglutinin / HA ELISA Pair Set Catalog Number : SEK40103 To achieve the best assay results, this manual must be read carefully before using this product and the assay

More information

Rat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum

Rat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum Rat C-peptide ELISA For the quantitative determination of C-peptide in rat serum Please read carefully due to Critical Changes, e.g., see Calculation of Results. For Research Use Only. Not For Use In Diagnostic

More information

Superoxide Dismutase Assay Kit

Superoxide Dismutase Assay Kit Superoxide Dismutase Assay Kit Catalog Number KA3782 100 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis

Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis Applying a Novel Glycan Tagging Reagent, RapiFluor-MS, and an Integrated UPLC-FLR/QTof MS System for Low Abundant N-Glycan Analysis Ying Qing Yu Waters Corporation, Milford, MA, USA APPLICATION BENEFITS

More information

Michael Blackburn HOW LOW CAN YOU GO: DRIVING DOWN LIMITS OF HYBRID IA-LC/MS. European Bioanalytical Forum. 19 th November 2015

Michael Blackburn HOW LOW CAN YOU GO: DRIVING DOWN LIMITS OF HYBRID IA-LC/MS. European Bioanalytical Forum. 19 th November 2015 HOW LOW CAN YOU GO: DRIVING DOWN LIMITS OF QUANTITATION FOR PEPTIDE BIOMOLECULES BY HYBRID IA-LC/MS Michael Blackburn Bioanalytical Services European Bioanalytical Forum Barcelona, Spain 19 th November

More information

MULTIDIMENSIONALE SCHEIDINGEN IN DE GAS- EN VLOEISTOF CHROMATOGRAFIE

MULTIDIMENSIONALE SCHEIDINGEN IN DE GAS- EN VLOEISTOF CHROMATOGRAFIE MULTIDIMENSINALE SCHEIDINGEN IN DE GAS- EN VLEISTF CHRMATGRAFIE Hans-Gerd Janssen and many others Unilever Foods R&D Vlaardingen, Vlaardingen, the Netherlands University of Amsterdam, Amsterdam, the Netherlands

More information

Enzyme Immunoassay for

Enzyme Immunoassay for Enzyme Immunoassay for Prostaglandin E 2 For Research Use Only INTRODUCTION Prostaglandin E 2 EIA Kit Product Number: EA02 Store at 4 C FOR RESEARCH USE ONLY Document Control Number: EA02.120214 Page 1

More information

See external label 96 tests ULTRASENSITIVE THYROID STIMULATING HORMONE (u-tsh) TSH Ultra Sensitive

See external label 96 tests ULTRASENSITIVE THYROID STIMULATING HORMONE (u-tsh) TSH Ultra Sensitive DIAGNOSTIC AUTOMATION, INC. 21250 Califa Street, Suite 102 and 116, Woodland Hills, CA 91367 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com

More information

CHAPTER 4 IMMUNOLOGICAL TECHNIQUES

CHAPTER 4 IMMUNOLOGICAL TECHNIQUES CHAPTER 4 IMMUNOLOGICAL TECHNIQUES Nitroblue Tetrazolium Chloride (NBT) Reduction test NBT reduction test was evaluated by employing the method described by Hudson and Hay,1989 based upon principle that

More information

Analysis of Peptides via Capillary HPLC and Fraction Collection Directly onto a MALDI Plate for Off-line Analysis by MALDI-TOF

Analysis of Peptides via Capillary HPLC and Fraction Collection Directly onto a MALDI Plate for Off-line Analysis by MALDI-TOF Analysis of Peptides via Capillary HPLC and Fraction Collection Directly onto a MALDI Plate for Off-line Analysis by MALDI-TOF Application Note 219 Joan Stevens, PhD; Luke Roenneburg; Kevin Fawcett (Gilson,

More information

Rat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum. For Research Use Only. Not For Use In Diagnostic Procedures.

Rat C-peptide ELISA. For the quantitative determination of C-peptide in rat serum. For Research Use Only. Not For Use In Diagnostic Procedures. Rat C-peptide ELISA For the quantitative determination of C-peptide in rat serum. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: Size: 80-CPTRT-E01 96 wells Version: May 26,

More information

MASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010

MASS SPECTROMETRY BASED METABOLOMICS. Pavel Aronov. ABRF2010 Metabolomics Research Group March 21, 2010 MASS SPECTROMETRY BASED METABOLOMICS Pavel Aronov ABRF2010 Metabolomics Research Group March 21, 2010 Types of Experiments in Metabolomics targeted non targeted Number of analyzed metabolites is limited

More information

GLP-2 ELISA. For the quantitative determination of GLP-2 in human serum and plasma samples.

GLP-2 ELISA. For the quantitative determination of GLP-2 in human serum and plasma samples. GLP-2 ELISA For the quantitative determination of GLP-2 in human serum and plasma samples. For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: 48-GP2HU-E01.1 Size: 96 wells Version:

More information

Product Information. Instruction for Use. Troponin I ELISA kit Catalog Number: EA Storage Temperature: 2 8 C

Product Information. Instruction for Use. Troponin I ELISA kit Catalog Number: EA Storage Temperature: 2 8 C 9620 Medical Center Dr., Suite 200, Rockville, MD 20850 Phone: 1.888.267.4436 Fax: 301-340-9254 Email: techsupport@origene.com Web: www.origene.com Product Information Troponin I ELISA kit Catalog Number:

More information

Human Alpha 1 microglobulin ELISA Kit

Human Alpha 1 microglobulin ELISA Kit Human Alpha 1 microglobulin ELISA Kit Catalogue No.: EH4144 Size: 48T/96T Reactivity: Human Range:0.625-40ng/ml Sensitivity:

More information

Improve Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant

Improve Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant Improve Protein Analysis with the New, Mass Spectrometry- Compatible Surfactant ABSTRACT Incomplete solubilization and digestion and poor peptide recovery are frequent limitations in protein sample preparation

More information

Human Cathepsin V ELISA Kit

Human Cathepsin V ELISA Kit Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 Human Cathepsin V ELISA Kit Catalog #: OKAG00201 Detection and Quantification of Human Cathepsin V (hctsv) Concentrations

More information

Rat Insulin ELISA. For the quantitative determination of insulin in rat serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures.

Rat Insulin ELISA. For the quantitative determination of insulin in rat serum and plasma. For Research Use Only. Not For Use In Diagnostic Procedures. Rat Insulin ELISA For the quantitative determination of insulin in rat serum and plasma For Research Use Only. Not For Use In Diagnostic Procedures. Catalog Number: Size: 80-INSRT-E01, E10 96 wells, 10

More information

STAT3 (py705) (Human/Mouse/Rat) ELISA Kit

STAT3 (py705) (Human/Mouse/Rat) ELISA Kit STAT3 (py705) (Human/Mouse/Rat) ELISA Kit Catalog Number KA2175 96 assays Version: 01 Intended for research use only www.abnova.com I. INTRODUCTION STAT3 (py705) (Human/Mouse/Rat) ELISA (Enzyme-Linked

More information

AFLATOXIN M1 CAT. NO. 961AFLMO1M

AFLATOXIN M1 CAT. NO. 961AFLMO1M h AFLATOXIN M1 CAT. NO. 961AFLMO1M Competitive ELISA Immunoassay for the quantitative detection of Aflatoxin M1 in milk, milk powder and cheese. General Aflatoxins are toxic metabolites produced by a variety

More information

Evolution of Peak Capacity in Fluid-based Separation Techniques

Evolution of Peak Capacity in Fluid-based Separation Techniques Evolution of Peak Capacity in Fluid-based Separation Techniques P Fluid-based SOLID LIQUID SUPER- CRITICAL FLUID 73.8 bar GAS 31.1 C T P Fluid-based + CE FLUID SOLID 73.8 bar GAS 31.1 C T 21 st Century

More information

Unbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM

Unbiased in-depth characterization of CEX fractions from a stressed mab by MS. Matthias Berg, Novartis Pharma, BTDM Unbiased in-depth characterization of CEX fractions from a stressed mab by MS Matthias Berg, Novartis Pharma, BTDM Characterization of CEX fractions Biopharmaceuticals like IgGs show a certain degree of

More information

Mercodia Porcine C-peptide ELISA

Mercodia Porcine C-peptide ELISA Mercodia Porcine C-peptide ELISA Directions for Use 10-1256-01 REAGENTS FOR 96 DETERMINATIONS Manufactured by Mercodia AB, Sylveniusgatan 8A, SE-754 50 Uppsala, Sweden EXPLANATION OF SYMBOLS USED ON LABELS

More information

LH (Bovine) ELISA Kit

LH (Bovine) ELISA Kit LH (Bovine) ELISA Kit Catalog Number KA2280 96 assays Version: 05 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...

More information

Comparison of mass spectrometers performances

Comparison of mass spectrometers performances Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion

More information

STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit

STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit STAT3 (py705)/ Pan STAT3 (Human/Mouse/Rat) ELISA Kit Catalog Number KA2176 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Principle of the Assay...

More information

Supplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems

Supplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems Supplementary Figure 1 Overview of steps in the construction of photosynthetic protocellular systems (a) The small unilamellar vesicles were made with phospholipids. (b) Three types of small proteoliposomes

More information

Mouse C-peptide ELISA

Mouse C-peptide ELISA Mouse C-peptide ELISA For the quantitative determination of C-peptide in mouse serum. For Research Use Only. Not for use in Diagnostic Procedures. Please read carefully due to Critical Changes, e.g., Preparation

More information

See external label 2 C 8 C 96 tests B-HCG (Total) Cat #

See external label 2 C 8 C 96 tests B-HCG (Total) Cat # DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external

More information

human Total Cathepsin B Catalog Number: DY2176

human Total Cathepsin B Catalog Number: DY2176 human Total Cathepsin B Catalog Number: DY2176 This DuoSet ELISA Development kit contains the basic components required for the development of sandwich ELISAs to measure natural and recombinant human Total

More information

Author. Introduction. Abstract

Author. Introduction. Abstract Simultaneous Measurement of Sirolimus and Tacrolimus Concentrations in Blood by Semi-Automated Extraction and Liquid Chromatography-Electrospray Ionization Mass Spectrometry Application Author Gary L.

More information

Dr. Erin E. Chambers Waters Corporation. Presented by Dr. Diego Rodriguez Cabaleiro Waters Europe Waters Corporation 1

Dr. Erin E. Chambers Waters Corporation. Presented by Dr. Diego Rodriguez Cabaleiro Waters Europe Waters Corporation 1 Development of an SPE-LC/MS/MS Assay for the Simultaneous Quantification of Amyloid Beta Peptides in Cerebrospinal Fluid in Support of Alzheimer s Research Dr. Erin E. Chambers Waters Corporation Presented

More information

Rat Glicentin EIA FOR RESEARCH USE ONLY. <Distributed by> DF Kasumigaseki Place, 3-6-7, Kasumigaseki, Chiyoda-ku Tokyo Japan

Rat Glicentin EIA FOR RESEARCH USE ONLY. <Distributed by> DF Kasumigaseki Place, 3-6-7, Kasumigaseki, Chiyoda-ku Tokyo Japan YK111 Rat Glicentin EIA FOR RESEARCH USE ONLY DF Kasumigaseki Place, 3-6-7, Kasumigaseki, Chiyoda-ku Tokyo 100-0013 Japan URL: http://www.sceti.co.jp/export/ e-mail: exp-pet@sceti.co.jp

More information

Supporting Information

Supporting Information Supporting Information Cyclic Peptidyl Inhibitors against Human Peptidyl-Prolyl Isomerase Pin1 Tao Liu, Yu Liu, Hung-Ying Kao, *,, and Dehua Pei Table of Contents: Table S1. Structures of amino acid building

More information

Mouse C-peptide ELISA

Mouse C-peptide ELISA Mouse C-peptide ELISA For the quantitative determination of C-peptide in mouse serum. For Research Use Only. Not for use in Diagnostic Procedures. Please read carefully due to Critical Changes, e.g., Calculation

More information

Edgar Naegele. Abstract

Edgar Naegele. Abstract Simultaneous determination of metabolic stability and identification of buspirone metabolites using multiple column fast LC/TOF mass spectrometry Application ote Edgar aegele Abstract A recent trend in

More information

The Immunoassay Guide to Successful Mass Spectrometry. Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013

The Immunoassay Guide to Successful Mass Spectrometry. Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013 The Immunoassay Guide to Successful Mass Spectrometry Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013 What is it? Hey! Look at that! Something is reacting in here! I just wish I knew what it

More information

RayBio Human Granzyme B ELISA Kit

RayBio Human Granzyme B ELISA Kit RayBio Human Granzyme B ELISA Kit Catalog #: ELH-GZMB User Manual Last revised April 15, 2016 Caution: Extraordinarily useful information enclosed ISO 13485 Certified 3607 Parkway Lane, Suite 100 Norcross,

More information

ACTG Laboratory Technologist Committee Revised Version 2.0 ACTG Lab Man Coulter HIV-1 p24 ELISA May 21, 2004

ACTG Laboratory Technologist Committee Revised Version 2.0 ACTG Lab Man Coulter HIV-1 p24 ELISA May 21, 2004 Coulter HIV p24 1. PRINCIPLE The Human Immunodeficiency Virus Type 1 (HIV-1) is recognized as the etiologic agent of acquired immunodeficiency syndrome (AIDS). The virus is transmitted by sexual contact,

More information

PRODUCT INFORMATION & MANUAL

PRODUCT INFORMATION & MANUAL PRODUCT INFORMATION & MANUAL 0.4 micron for Overall Exosome Isolation (Cell Media) NBP2-49826 For research use only. Not for diagnostic or therapeutic procedures. www.novusbio.com - P: 303.730.1950 - P:

More information

Paul D. Rainville Ph.D. Health Sciences Group Waters Corporation Waters Corporation 1

Paul D. Rainville Ph.D. Health Sciences Group Waters Corporation Waters Corporation 1 A new level of sensitivity and standardization: The promise of integrated micro fluidic devices coupled with mass spectrometry for the analysis of biofluids Paul D. Rainville Ph.D. Health Sciences Group

More information

ARK Methotrexate Assay Application Ortho Clinical Diagnostics VITROS 5600 Integrated System and VITROS 4600 Chemistry System

ARK Methotrexate Assay Application Ortho Clinical Diagnostics VITROS 5600 Integrated System and VITROS 4600 Chemistry System C ARK Methotrexate Assay Application Ortho Clinical Diagnostics VITROS 5600 Integrated System and VITROS 4600 Chemistry System Reference No. 5026000100 Intended for the Quantitative Determination of Methotrexate

More information

YK052 Mouse Leptin ELISA

YK052 Mouse Leptin ELISA YK052 Mouse Leptin ELISA FOR LABORATORY USE ONLY YANAIHARA INSTITUTE INC. 2480-1 AWAKURA, FUJINOMIYA-SHI SHIZUOKA, JAPAN 418-0011 Contents Ⅰ. Introduction 2 Ⅱ. Characteristics 3 Ⅲ. Composition 4 Ⅳ. Method

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with

More information

TECHNICAL BULLETIN. GLP-1 EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0201 Storage Temperature 20 C

TECHNICAL BULLETIN. GLP-1 EIA Kit for serum, plasma, culture supernatant, and cell lysates. Catalog Number RAB0201 Storage Temperature 20 C GLP-1 EIA Kit for serum, plasma, culture supernatant, and cell lysates Catalog Number RAB0201 Storage Temperature 20 C TECHNICAL BULLETIN Product Description The GLP-1 (Glucagon-like Peptide 1) Enzyme

More information

Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set

Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Human Immunodeficiency Virus type 1 (HIV-1) p24 / Capsid Protein p24 ELISA Pair Set Catalog Number : SEK11695 To achieve the best assay results, this manual must be read carefully before using this product

More information