INHIBITION OF A CALCIUM-DEPENDENT CYSTEINE PROTEASE BY DOXYCYCLINE

Size: px
Start display at page:

Download "INHIBITION OF A CALCIUM-DEPENDENT CYSTEINE PROTEASE BY DOXYCYCLINE"

Transcription

1 136 INHIBITION OF A CALCIUM-DEPENDENT CYSTEINE PROTEASE BY DOXYCYCLINE ADRIAN C. NICOLESCU 1 *, CONSTANTIN MIRCIOIU 2 1 Queen s University, Faculty of Health Sciences, Department of Biochemistry, 18 Stuart Street, Kingston, Ontario, K7L 3N6, Canada 2 UMF Carol Davila, Faculty of Pharmacy, 6 Traian Vuia Street, Bucharest, Romania *corresponding author: nicolesc@queensu.ca Abstract The activation of calcium-dependent cysteine proteases (calpains) due to an uncontrolled increase in the cellular calcium influx can lead to aberrant degradation of cellular proteins and cell death. The inhibitory effect of doxycycline on other proteases, but not calpains, has been reported. We discovered that doxycycline significantly inhibits murine calpain 2 at concentrations 30 µm. An increase in the calcium ion concentration did not affect this inhibitory effect, suggesting that doxycycline does not act by simply chelating the calcium ions. The analysis of the amino acid sequences of murine calpain 2 and human calpains 1 and 2 suggests that doxycycline is likely to have similar effects on human calpains. These results extend the non-antimicrobial activity of doxycycline to a different family of proteases, and could be used to design compounds potentially useful for modulating the activity of calpains. Rezumat Activarea cistein-proteazelor dependente de calciu (calpaine) datorată unei creşteri necontrolate a influxului celular de calciu poate conduce la degradarea aberantă a proteinelor celulare şi la moartea celulelor. Efectul inhibitor al doxiciclinei asupra altor proteaze, însă nu asupra calpainelor, este documentat. Noi am evidenţiat că doxiciclina inhibă semnificativ calpaina 2 murină la concentraţii 30 µm. O creştere a concentraţiei ionilor de calciu nu a afectat acest efect inhibitor, sugerând că doxiciclina nu acţionează prin simpla complexare a ionilor de calciu. Analiza secvenţelor de aminoacizi ai calpainei 2 murine şi ai calpainelor 1 şi 2 umane sugerează că doxiciclina ar avea efect similar asupra calpainelor umane. Aceste rezultate extind acţiunea non-antimicrobiană a doxiciclinei la o altă clasă de proteaze şi pot fi folosite pentru conceperea de compuşi cu utilitate potenţială în modularea activităţii calpainelor. Keywords: cysteine proteases, doxycycline, enzyme inhibition Introduction Calcium-dependent cysteine proteases or calpains (EC ) are multidomain cytosolic enzymes that catalyze the limited degradation of proteins involved in key biological processes, such as cytoskeletal

2 137 remodeling, signal transduction, cell differentiation, embryonic development, apoptosis, necrosis, vesicular protein transport, and cell migration [1-3]. The best characterized calpains, calpain 1 and calpain 2, are abundantly expressed in most tissues and consist of an isoform-specific 80 kda subunit (with 60% identity between calpain 1 and calpain 2) that contains the protease core, and a common 28 kda subunit. Both enzymes have several calcium-binding sites, which allosterically affect the enzyme activity. The function of calpains must be tightly regulated since aberrant activation of calpains, following cells inability to regulate calcium influx to the cytoplasm, can result in uncontrolled protein degradation and irreversible cell damage. Enhanced calpain activity has been associated with various pathologies, including myocardial infarction, heart failure, hypertension, atrial fibrillation, as well as stroke, brain trauma, Alzheimer s and Huntington s diseases, Duchenne muscular dystrophy, liver dysfunction, cataract, and certain types of cancer [2, 4, 5]. Since the overactivation of calpains has been linked to the development of various pathological conditions, calpains represent important targets for pharmacological inhibition. Doxycycline, a broad-spectrum antibiotic, has been shown to inhibit at sub-antimicrobial concentrations other calcium-dependent proteases, such as matrix metalloproteases [6, 7, 11], supposedly by interfering with the enzyme s calcium binding sites [6, 8]. The present work hypothesized that doxycycline inhibits calpains and tested the effect of doxycycline on murine calpain 2 activity. Materials and methods Materials. All reagents were of analytical grade and unless otherwise specified were purchased from Sigma-Aldrich (Oakville, ON). Murine recombinant calpain 2 was a generous gift from Dr. Peter L. Davies from Queen s University, Kingston, Ontario. Kinetic analysis of calpain 2 activity. The hydrolysis of 30 µm PLFAER fluorogenic substrate (prepared in 1.8 % v/v DMSO) by 0.1 µm calpain 2 in 50 mm Tris ph 7.6, containing 1 mm dithiothreitol (DTT), was measured at 25 C in a plate reader-based protocol in the presence or absence of doxycycline. Calpeptin, a known inhibitor of calpains, was used as a positive control to validate the assay. To prevent possible aggregation

3 138 of calpain 2 at high calcium concentrations, the assay buffer was supplemented with 150 mm NaCl. Assays were performed in a volume of 120 µl per well in black polystyrene half-area plates (Corning, NY). Fluorescence associated with the cleavage product was measured (λ ex 335 nm, λ em 595 nm, cut-off filter 475 nm) every 8 s for 30 min in a SPECTRAmax Gemini XPS (Molecular Devices, Sunnyvale, CA) plate reader. The rate of product formation in each well was determined through linear regression of the experimental data (r 2 > 0.99). Appropriate lag times, to preclude data prior to equilibration at 25 C, and end times, to preclude data following a loss of linearity, were entered manually prior to linear regression to obtain initial rates. The initial rates in the presence of inhibitors were normalized to the initial rates for the vehicle controls. All experiments were performed in triplicates and the concentration of doxycycline required to produce 50 % inhibition (IC 50 ) was determined from the nonlinear fit of data using GraphPad Prism version 4.03 (GraphPad Software, San Diego, CA). Sequence alignment. The amino-acid sequences for the large subunit of murine calpain 2, and human calpain 2 and human calpain 1 were obtained from the NCBI protein data base. Multiple amino-acid sequence alignment was performed by using the program Clustal W [9]. Statistical analysis. All data are presented as mean ± standard deviation (SD). Comparisons among multiple groups were performed using one-way ANOVA followed by Newman-Keuls post hoc test. Two-tailed P values < 0.05 were considered statistically significant. Results and discussion The present study demonstrates, in a cell-free system, that doxycycline inhibits murine calpain 2 at moderate micromolar concentrations and that an excess in calcium ions concentration does not significantly affect this inhibitory effect. The ability of the kinetic assay to provide reliable results was tested with calpeptin, a non-specific inhibitor of calpains. The level of inhibition obtained for calpeptin (Figure 1) was consistent with previously reported calpeptin inhibitory concentrations [10].

4 139 Figure 1 Calpeptin inhibition of PLFAER fluorogenic substrate degradation by murine calpain 2 in the presence of 1 mm CaCl 2. Data are means ± SD of triplicates. * Statistically significant difference compared to vehicle control, P < 0.05, one-way ANOVA, where PLFAER is a fluorescence resonance energy transfer based substrate. Doxycycline inhibited the calcium-dependent activation of murine calpain 2 in a concentration-dependent manner (Figure 2 and table I). The inhibitory effect of doxycycline became significant at 30 µm (approx. 18% inhibition), and was substantial (approx. 65% inhibition) at 100 µm. Figure 2 Doxycycline inhibition of PLFAER fluorogenic substrate degradation by murine calpain 2 in the presence of 1 mm CaCl 2. Data are means ± SD of triplicates. * Statistically significant difference compared to vehicle control, P < 0.05, one-way ANOVA. Doxycycline is known to chelate divalent metal ions, including calcium. Therefore, the inhibitory effect of doxycycline on calpain 2 was also investigated in the presence of a large excess of calcium ions. The

5 140 presence of 10 mm CaCl 2 in the reaction mixture did not reduce significantly the inhibitory effect of doxycycline on calpain 2. Under these conditions, doxycycline inhibited calpain 2 in a concentration-dependent manner (Figure 3 and table I), and at similar inhibitory levels to those observed in the presence of 1 mm CaCl 2, suggesting that the inhibitory effect of doxycycline is not simply due to a complexation reaction. Figure 3 Doxycycline inhibition of PLFAER fluorogenic substrate degradation by murine calpain 2 in the presence of 10 mm CaCl 2. Data are means ± SD of triplicates. * Statistically significant difference compared to vehicle control, P < 0.05, one-way ANOVA. Table I Initial rates for doxcycline inhibition of murine calpain 2 and calpain [doxycycline] (µm) Initial rates ± SD (min -1 ) 1 mm CaCl 2 10 mm CaCl ± ± ± ± ± ± ± ± 4.2 The calculated inhibitory potency of doxycycline was 72 µm (Figure 4) in the presence of either 1 mm or 10 mm CaCl 2, further emphasizing an interaction of doxycycline with calpain that is not significantly affected by calcium. Interestingly, doxycycline also inhibited

6 141 the activity of the calpain protease core at comparable levels as the fulllength enzyme (data not shown). The calpain protease core (containing calpain s domains 1 and 2 and the catalytic site) requires for its activation two calcium ions, which potentially may be targeted by molecules interfering with the protein s calcium-binding sites. Figure 4 Concentration-dependent effect of doxycycline on murine calpain 2 activity. Data represent means ± SD of triplicates and were fitted to sigmoidal (variable slope) curves The analysis of the amino acid sequence alignment indicates an overall identity of 93% conservation between the murine and human calpains 2, as well as a 96% conservation of the calcium-binding residues (Figure 4). There is also a 61% amino acid conservation between murine calpain 2 and human calpain 1, and a 88% conservation of the calciumbinding residues between these proteins (Figure 4). This analysis predicts that doxycycline is likely to have similar inhibitory effects on human calpains. Using matrix metalloprotease 7, it has been suggested that doxycycline inhibits matrix metalloproteases by binding to the structural calcium- and zinc-binding sites of these proteins and, thus, destabilizing the proteins native structure [6]. A similar scenario can be proposed for the observed inhibition of calpain 2 by doxycyclin. Additionally, the proximity

7 142 of aromatic amino acid residues to calcium-binding sites may further stabilize the binding of doxycycline to the protein. murcpn MAGIAMKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPS 50 humcpn MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPS 49 humcpn1 MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA 60 murcpn2 FPALPSSLGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDSWLLAA 110 humcpn2 FPAIPSALGFKELGPYSSKTRGMRWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAA 109 humcpn1 FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA 120 murcpn2 IASLTLNEEILARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHS 170 humcpn2 IASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHS 169 humcpn1 IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS 180 murcpn2 AEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFKIIQK 230 humcpn2 AEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQK 229 humcpn1 AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK 240 murcpn2 ALEKGSLLGCSIDITSAADSEAVTYQKLVKGHAYSVTGAEEVESSGSLQKLIRIRNPWGQ 290 humcpn2 ALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGE 289 humcpn1 ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE 300 murcpn2 VEWTGKWNDNCPSWNTVDPEVRANLTERQEDGEFWMSFSDFLRHYSRLEICNLTPDTLTC 350 humcpn2 VEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS 349 humcpn1 VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS 360 murcpn2 DSYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDED-DEDG--ERGCTF 407 humcpn2 DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDED-EEDG--ESGCTF 406 humcpn1 RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDP-DDYGDRESGCSF 419 murcpn2 LVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFLTTRARERSDTFIN 467 humcpn2 LVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFIN 466 humcpn1 VLALMQKHRRRERPFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFIN 479 murcpn2 LREVLNRFKLPPGEYVLVPSTFEPHKNGDFCIRVFSEKKADYQTVDDEIEANI-EEIEAN 526 humcpn2 LREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL-EEFDIS 525 humcpn1 LREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLS 539 murcpn2 EEDIGDGFRRLFAQLAGEDAEISAFELQTILRRVLAKREDIKSDGFSIETCKIMVDMLDE 586 humcpn2 EDDIDDGVRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDS 585 humcpn1 EEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDR 599 murcpn2 DGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVI 646 humcpn2 DGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVI 645 humcpn1 DGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELI 659 murcpn2 VARFADDELIIDFDNFVRCLVRLEILFKIFKQLDPENTGTIQLDLISWLSFSVL- 700 humcpn2 VARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL- 699 humcpn1 ITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA 714 Figure 5 Amino acid sequence alignment of murine calpain 2, human calpains 1 and 2. Calciumbinding residues are colored in red and highlighted in yellow. Tryptophan residues in the proximity of the calcium-binding sites are highlighted in green.

8 143 The activation of calpains by calcium ions involves conformational changes in the calpain s stucture, changes that are necessary for the proper alignment of the catalytic triad. Conceivably, doxycycline binding to calcium-coordinating amino acids in calpains prevents these conformational changes required for enzymatic activity. Conclusions The present study demonstrates for the first time the inhibitory effect of doxycycline on murine calpain 2. Considering the overall amino acid conservation between the murine calpain 2 and human calpains 1 and 2, it is likely that doxycycline would similarly inhibit human calpains. The development of molecules that inhibit calpains at sites away from the catalytic cleft represents a viable alternative for drug discovery. The inhibition mechanism of calpains by doxycyline may involve allosteric sites and, thus, doxycycline may provide an example and research tool for designing more specific calpain inhibitors with potential use in therapy. Acknowledgements The authors are thankful to Drs. Peter L. Davies and Michael Neisham for the use of the research infrastructure. Adrian Nicolescu is a recipient of a Heart and Stroke Foundation of Canada research fellowship. In loving memory of Dr. Maria Ivona Poenaru ( ). References 1. Goll D.E., Thompson V.F., Li H., Wei W., Cong J., The calpain system, Physiological Reviews, 2003, 83, Zatz M., Starling A., Calpains and disease, New England Journal of Medicine, 2005, 352, Franco S.J., Huttenlocher A., Regulating cell migration: calpains make the cut, Journal of Cell Science, 2005, 118, Nixon R.A., The calpains in aging and aging-related diseases, Ageing Research Reviews, 2003, 2, Perrin C., Vergely C., Rochette L., Calpains and cardiac diseases, Annales de Cardiologie et d'angeiologe (Paris), 2004, 53, Garcia R.A., Pantazatos D.P., Gessner C.R., Go K.V., Woods V.L. Jr., Villarreal F.J., Molecular interactions between matrilysin and the matrix metalloproteinase inhibitor doxycycline investigated by deuterium exchange mass spectrometry, Molecular Pharmacology, 2005, 67, Nicolescu A.C., Holt A., Kandasamy A.D., Pacher P., Schulz R., Inhibition of matrix metalloproteinase-2 by PARP inhibitors, Biochemical and Biophysical Research Communications, 2009, 387, Penescu M. et al, The application of mass spectrometry for identifing modern biochemical markers of nephropathies, Farmacia, 2009, 57(6),

9 Thompson J.D., Higgins D.G., T.J. Gibson, CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice, Nucleic Acids Research, 1994, 22, Tsujinaka T., Kajiwara Y., Kambayashi J., Sakon M., Higuchi N., Tanaka T., Mori T., Synthesis of a new cell penetrating calpain inhibitor (calpeptin), Biochemical and Biophysical Research Communications, 1988, 153, Habor A., Peroxisome proliferator activated receptors, Farmacia, 2010, 58(1), Manuscript received: July 28 th 2009

20S Proteasome Activity Assay Kit

20S Proteasome Activity Assay Kit 20S Proteasome Activity Assay Kit For 100 Assays Cat. No. APT280 FOR RESEARCH USE ONLY NOT FOR USE IN DIAGNOSTIC PROCEDURES USA & Canada Phone: +1(800) 437-7500 Fax: +1 (951) 676-9209 Europe +44 (0) 23

More information

Human Urokinase / PLAU / UPA ELISA Pair Set

Human Urokinase / PLAU / UPA ELISA Pair Set Human Urokinase / PLAU / UPA ELISA Pair Set Catalog Number : SEK10815 To achieve the best assay results, this manual must be read carefully before using this product and the assay is run as summarized

More information

SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # Kit Size

SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # Kit Size SensoLyte Rh110 Cathepsin K Assay Kit *Fluorimetric* Revision#1.2 Last Updated: May 2017 Catalog # 72152 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit detects Cathepsin K activity.

More information

Assay Report. Histone Deacetylase (HDAC) Inhibitor Assays Enzymatic Study of Compounds from Client

Assay Report. Histone Deacetylase (HDAC) Inhibitor Assays Enzymatic Study of Compounds from Client Assay Report Histone Deacetylase (HDAC) Inhibitor Assays Enzymatic Study of Compounds from Client Page 1 of 27 Client_HDAC _Year Month Day 1 Client_HDAC_Year Month Year HDAC Inhibitor Assays Study Sponsor:

More information

SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric*

SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric* SensoLyte 520 Cathepsin K Assay Kit *Fluorimetric* Catalog # 72171 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit is optimized to detect Cathepsin K activity. Enhanced Value: Ample

More information

Protease Activity Assay Kit (Red)

Protease Activity Assay Kit (Red) Protease Activity Assay Kit (Red) Catalog Number KA2524 500 assays Version: 11 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4

More information

SensoLyte 520 HIV-1 Protease Assay Kit *Fluorimetric*

SensoLyte 520 HIV-1 Protease Assay Kit *Fluorimetric* SensoLyte 520 HIV-1 Protease Assay Kit *Fluorimetric* Catalog # 71147 Kit Size 100 assays (96-well) or 500 assays (384-well) Convenient Format: Complete kit including all the assay components. Optimized

More information

SensoLyte Generic MMP Assay Kit *Colorimetric*

SensoLyte Generic MMP Assay Kit *Colorimetric* SensoLyte Generic MMP Assay Kit *Colorimetric* Revision#1.2 Catalog # Kit Size Last updated: May2017 AS-72095 100 Assays (96-well plate) Optimized Performance: This kit is optimized to detect MMP activity

More information

Data are contained in multiple tabs in Excel spreadsheets and in CSV files.

Data are contained in multiple tabs in Excel spreadsheets and in CSV files. Contents Overview Curves Methods Measuring enzymatic activity (figure 2) Enzyme characterisation (Figure S1, S2) Enzyme kinetics (Table 3) Effect of ph on activity (figure 3B) Effect of metals and inhibitors

More information

Assay Report. Phosphodiesterase (PDE) Inhibitor Assays Enzymatic Study of Compounds from Client

Assay Report. Phosphodiesterase (PDE) Inhibitor Assays Enzymatic Study of Compounds from Client Assay Report Phosphodiesterase (PDE) Inhibitor Assays Enzymatic Study of Compounds from Client Page 1 of 36 Client_PDE _Year Month Day 1 Client_PDE_Year Month Day PDE Inhibitor Assays Study Sponsor: Client

More information

QS S Assist KINASE_ADP-Glo TM Kit

QS S Assist KINASE_ADP-Glo TM Kit QS S Assist KINASE_ADP-Glo TM Kit Description KINASE ADP-Glo TM kit is designed for use in biochemical kinase assays based on a Luminescent ADP Detection Assay (ADP-Glo TM ). The kit includes human kinase,

More information

The MOLECULES of LIFE

The MOLECULES of LIFE The MOLECULES of LIFE Physical and Chemical Principles Solutions Manual Prepared by James Fraser and Samuel Leachman Chapter 16 Principles of Enzyme Catalysis Problems True/False and Multiple Choice 1.

More information

Broad Spectrum Protease Inhibitor Cocktail

Broad Spectrum Protease Inhibitor Cocktail Broad Spectrum Protease Inhibitor Cocktail Catalog number: AR1182 Boster s Broad Spectrum Protease Inhibitor Cocktail is a complex of various protease inhibitors, which has been tested for inhibiting proteases

More information

SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric*

SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric* SensoLyte 520 HDAC Activity Assay Kit *Fluorimetric* Catalog # 72084 Kit Size 100 Assays (96-well plate) Optimized Performance: This kit is optimized to detect HDAC activity. Enhanced Value: It provides

More information

SensoLyte 490 HIV-1 Protease Assay Kit *Fluorimetric*

SensoLyte 490 HIV-1 Protease Assay Kit *Fluorimetric* SensoLyte 490 HIV-1 Protease Assay Kit *Fluorimetric* Catalog # 71127 Unit Size Kit Size 1 kit 500 assays (96-well) or 1250 assays (384-well) This kit is optimized to detect the activity of human immunodeficiency

More information

Phospholipid Assay Kit

Phospholipid Assay Kit Phospholipid Assay Kit Catalog Number KA1635 100 assays Version: 06 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Improved Stability of the LANCE Ultra Signal in Kinase Assays

Improved Stability of the LANCE Ultra Signal in Kinase Assays Improved Stability of the LANCE Ultra Signal in Kinase Assays LANCE Ultra is a high throughput screening (HTS) technology platform optimized for homogeneous time-resolved fluorescence resonance energy

More information

Protease Activity Assay Kit (Fluorometric Red)

Protease Activity Assay Kit (Fluorometric Red) ab112153 Protease Activity Assay Kit (Fluorometric Red) Instructions for Use For detecting Protease activity in biological samples or to screen protease inhibitors using our proprietary red fluorescence

More information

Kit for assay of thioredoxin

Kit for assay of thioredoxin FkTRX-02-V2 Kit for assay of thioredoxin The thioredoxin system is the major protein disulfide reductase in cells and comprises thioredoxin, thioredoxin reductase and NADPH (1). Thioredoxin systems are

More information

Phospholipid Assay Kit

Phospholipid Assay Kit Phospholipid Assay Kit Catalog Number KA1635 100 assays Version: 05 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Mouse Cathepsin B ELISA Kit

Mouse Cathepsin B ELISA Kit GenWay Biotech, Inc. 6777 Nancy Ridge Drive San Diego, CA 92121 Phone: 858.458.0866 Fax: 858.458.0833 Email: techline@genwaybio.com http://www.genwaybio.com Mouse Cathepsin B ELISA Kit Catalog No. GWB-ZZD154

More information

REGULATION OF ENZYME ACTIVITY. Medical Biochemistry, Lecture 25

REGULATION OF ENZYME ACTIVITY. Medical Biochemistry, Lecture 25 REGULATION OF ENZYME ACTIVITY Medical Biochemistry, Lecture 25 Lecture 25, Outline General properties of enzyme regulation Regulation of enzyme concentrations Allosteric enzymes and feedback inhibition

More information

Proteasome Activity Assay Kit

Proteasome Activity Assay Kit Proteasome Activity Assay Kit Catalog Number KA1431 100 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

Serrata) Alkaline Phosphatase

Serrata) Alkaline Phosphatase Vol. 41, No. 5, April 1997 BIOCHEMISTRY and MOLECULAR BIOLOGY INTERNATIONAL Pages 951-959 An Essential Tryptophan Residue of Green Crab (Syclla Serrata) Alkaline Phosphatase Wen-Zhu Zheng 1, Qing-Xi Chen

More information

<Supplemental information>

<Supplemental information> The Structural Basis of Endosomal Anchoring of KIF16B Kinesin Nichole R. Blatner, Michael I. Wilson, Cai Lei, Wanjin Hong, Diana Murray, Roger L. Williams, and Wonhwa Cho Protein

More information

Optimization of a LanthaScreen Kinase assay for ZAP70

Optimization of a LanthaScreen Kinase assay for ZAP70 Optimization of a LanthaScreen Kinase assay for ZAP70 Overview This protocol describes how to develop a LanthaScreen kinase assay designed to detect and characterize kinase inhibitors. The development

More information

HDAC1 Inhibitor Screening Assay Kit

HDAC1 Inhibitor Screening Assay Kit HDAC1 Inhibitor Screening Assay Kit Catalog Number KA1320 96 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay...

More information

Sialic Acid Assay Kit

Sialic Acid Assay Kit Sialic Acid Assay Kit Catalog Number KA1655 100 assays Version: 04 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 Principle of the Assay...

More information

ab Calcineurin Phosphatase Activity Assay Kit (Colorimetric)

ab Calcineurin Phosphatase Activity Assay Kit (Colorimetric) ab139461 Calcineurin Phosphatase Activity Assay Kit (Colorimetric) Instructions for Use For measuring Calcineurin phosphatase activity. This product is for research use only and is not intended for diagnostic

More information

Nature Protocols: doi: /nprot Supplementary Figure 1. Fluorescent titration of probe CPDSA.

Nature Protocols: doi: /nprot Supplementary Figure 1. Fluorescent titration of probe CPDSA. Supplementary Figure 1 Fluorescent titration of probe CPDSA. Fluorescent titration of probe CPDSA (10 um) upon addition of GSH in HEPES (10 mm, ph = 7.4) containing 10% DMSO. Each spectrum was recorded

More information

Collagenase Assay Kit

Collagenase Assay Kit Collagenase Assay Kit Catalog # 31 and 32 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION The collagenases are members of the matrix metalloproteinase (MMP) family and degrade collagen

More information

Collagenase Assay Kit

Collagenase Assay Kit Collagenase Assay Kit Catalog # 31 and 32 For Research Use Only - Not Human or Therapeutic Use INTRODUCTION Collagenases are members of the matrix metalloproteinase (MMP) family and degrade collagen types

More information

Supplemental Information

Supplemental Information Supplemental Information SI1. AFM Imaging and SPR Imaging Before and After Exposure to Enzyme Mixture in the Sample Chamber and Buffer in the Reference Chamber of the Fluid Cell To verify that cellulose

More information

HDAC1 Inhibitor Screening Assay Kit

HDAC1 Inhibitor Screening Assay Kit HDAC1 Inhibitor Screening Assay Kit Item No. 10011564 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL INFORMATION

More information

SUPPLEMENTAL INFORMATION

SUPPLEMENTAL INFORMATION SUPPLEMENTAL INFORMATION EXPERIMENTAL PROCEDURES Tryptic digestion protection experiments - PCSK9 with Ab-3D5 (1:1 molar ratio) in 50 mm Tris, ph 8.0, 150 mm NaCl was incubated overnight at 4 o C. The

More information

Data Sheet. Fluorogenic HDAC 8 Assay Kit Catalog #: 50068

Data Sheet. Fluorogenic HDAC 8 Assay Kit Catalog #: 50068 Data Sheet Fluorogenic HDAC 8 Assay Kit Catalog #: 50068 DESCRIPTION: The Fluorogenic HDAC 8 Assay Kit is a complete assay system designed to measure histone deacetylase (HDAC) 8 activity for screening

More information

Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit

Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit PROTOCOL Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit DESCRIPTION Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit Sufficient materials

More information

SUPPLEMENTARY MATERIAL

SUPPLEMENTARY MATERIAL SUPPLEMENTARY MATERIAL Purification and biochemical properties of SDS-stable low molecular weight alkaline serine protease from Citrullus Colocynthis Muhammad Bashir Khan, 1,3 Hidayatullah khan, 2 Muhammad

More information

Optimization of a LanthaScreen Kinase assay for NTRK1 (TRKA)

Optimization of a LanthaScreen Kinase assay for NTRK1 (TRKA) Optimization of a LanthaScreen Kinase assay for NTRK1 (TRKA) Overview This protocol describes how to develop a LanthaScreen kinase assay designed to detect and characterize kinase inhibitors. The development

More information

HDAC Activity/Inhibition Assay Kit (Fluorometric)

HDAC Activity/Inhibition Assay Kit (Fluorometric) HDAC Activity/Inhibition Assay Kit (Fluorometric) Catalog Number KA0627 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background...

More information

Epigenase HDAC Activity/Inhibition Direct Assay Kit (Fluorometric)

Epigenase HDAC Activity/Inhibition Direct Assay Kit (Fluorometric) Epigenase HDAC Activity/Inhibition Direct Assay Kit (Fluorometric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE Uses: The Epigenase HDAC Activity/Inhibition Direct Assay Kit (Fluorometric)

More information

Spectrophotometric Determination of the Kinetic Parameters of β-fructofuranosidase and the Mechanism of Inhibition by Copper (II) Sulfate

Spectrophotometric Determination of the Kinetic Parameters of β-fructofuranosidase and the Mechanism of Inhibition by Copper (II) Sulfate Spectrophotometric Determination of the Kinetic Parameters of β-fructofuranosidase and the Mechanism of Inhibition by Copper (II) Sulfate Allen Zhang Tyson Miao Science One Program The University of British

More information

ab Lipoxygenase Inhibitor Screening Assay Kit

ab Lipoxygenase Inhibitor Screening Assay Kit ab133087 Lipoxygenase Inhibitor Screening Assay Kit Instructions for Use For the detection of hydroperoxides produced in the lipoxygenation reaction using a purified Lipoxygenases. This product is for

More information

RayBio DPP4 Inhibitor Screening Kit

RayBio DPP4 Inhibitor Screening Kit RayBio DPP4 Inhibitor Screening Kit User Manual Version 1.0 Mar 25, 2013 RayBio DPP4 Inhibitor Screening (Cat#: 68SR-DPP4-S100) RayBiotech, Inc. We Provide You With Excellent Support And Service Tel:(Toll

More information

PhosFree TM Phosphate Assay Biochem Kit

PhosFree TM Phosphate Assay Biochem Kit PhosFree TM Phosphate Assay Biochem Kit (Cat. # BK050) ORDERING INFORMATION To order by phone: (303) - 322-2254 To order by Fax: (303) - 322-2257 To order by e-mail: cservice@cytoskeleton.com Technical

More information

Free Fatty Acid Assay Kit

Free Fatty Acid Assay Kit Free Fatty Acid Assay Kit Catalog Number KA1667 100 assays Version: 05 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Epigenase HDAC Activity/Inhibition Direct Assay Kit (Colorimetric)

Epigenase HDAC Activity/Inhibition Direct Assay Kit (Colorimetric) Epigenase HDAC Activity/Inhibition Direct Assay Kit (Colorimetric) Base Catalog # P-4034 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE Uses: The Epigenase HDAC Activity/Inhibition Direct Assay Kit (Colorimetric)

More information

EpiQuik HDAC Activity/Inhibition Assay Kit (Fluorometric)

EpiQuik HDAC Activity/Inhibition Assay Kit (Fluorometric) EpiQuik HDAC Activity/Inhibition Assay Kit (Fluorometric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik HDAC Activity/Inhibition Assay Kit (Fluorometric) is very suitable for

More information

Chapter 3. Protein Structure and Function

Chapter 3. Protein Structure and Function Chapter 3 Protein Structure and Function Broad functional classes So Proteins have structure and function... Fine! -Why do we care to know more???? Understanding functional architechture gives us POWER

More information

Utilizing AlphaLISA Technology to Screen for Inhibitors of the CTLA-4 Immune Checkpoint

Utilizing AlphaLISA Technology to Screen for Inhibitors of the CTLA-4 Immune Checkpoint APPLICATION NOTE AlphaLISA Technology Authors: Matthew Marunde Stephen Hurt PerkinElmer, Inc. Hopkinton, MA Utilizing AlphaLISA Technology to Screen for Inhibitors of the CTLA-4 Immune Checkpoint Introduction

More information

Figure 1 Original Advantages of biological reactions being catalyzed by enzymes:

Figure 1 Original Advantages of biological reactions being catalyzed by enzymes: Enzyme basic concepts, Enzyme Regulation I III Carmen Sato Bigbee, Ph.D. Objectives: 1) To understand the bases of enzyme catalysis and the mechanisms of enzyme regulation. 2) To understand the role of

More information

Exploration of Plasticizer and Plastic Explosive Detection and Differentiation with. Serum Albumin Cross-Reactive Arrays

Exploration of Plasticizer and Plastic Explosive Detection and Differentiation with. Serum Albumin Cross-Reactive Arrays Exploration of Plasticizer and Plastic Explosive Detection and Differentiation with Serum Albumin Cross-Reactive Arrays Michelle Adams Ivy, Lauren T. Gallagher, Andrew D. Ellington, and Eric V. Anslyn*

More information

Optimization of a LanthaScreen Kinase assay for CSF1R (FMS)

Optimization of a LanthaScreen Kinase assay for CSF1R (FMS) Optimization of a LanthaScreen Kinase assay for CSF1R (FMS) Overview This protocol describes how to develop a LanthaScreen kinase assay designed to detect and characterize kinase inhibitors. The development

More information

1.2 Systematic Name: Orthophosphoric-monoester phosphohydrolase (alkaline optimum)

1.2 Systematic Name: Orthophosphoric-monoester phosphohydrolase (alkaline optimum) Document Title Alkaline Phosphatase Page 1 of 6 Originating Department QA Approval Departments QA, QC Approval Date 5 th June 2017 Effective Date 8 th June 2017 1.0 PRODUCT DETAILS 1.1 Enzyme Name: Alkaline

More information

Fluoro: MAO TM. Monoamine Oxidase A & B Detection Kit. Contact Information. This version to be used for kits shipped on or after April 27 th 2006

Fluoro: MAO TM. Monoamine Oxidase A & B Detection Kit. Contact Information. This version to be used for kits shipped on or after April 27 th 2006 Fluoro: MAO TM Monoamine Oxidase A & B Detection Kit This version to be used for kits shipped on or after April 27 th 2006 Contact Information Notes Revised protocol 5/06 Updated 1/07 I. Assay Principle:

More information

EPIGENTEK. EpiQuik HDAC Activity/Inhibition Assay Kit(Colorimetric) Base Catalog # P-4002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik HDAC Activity/Inhibition Assay Kit(Colorimetric) Base Catalog # P-4002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik HDAC Activity/Inhibition Assay Kit(Colorimetric) Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik HDAC Activity/Inhibition Assay Kit (Colorimetric) is very suitable for

More information

Manual. Precision Red Advanced Protein Assay Reagent. Cat. # ADV02. cytoskeleton.com. Cytoskeleton, Inc.

Manual. Precision Red Advanced Protein Assay Reagent. Cat. # ADV02. cytoskeleton.com. Cytoskeleton, Inc. The Protein Experts Manual Cytoskeleton, Inc. V. 6.0 Precision Red Advanced Protein Assay Reagent Cat. # ADV02 cytoskeleton.com Phone: (303) 322.2254 Fax: (303) 322.2257 Customer Service: cserve@cytoskeleton.com

More information

بسم هللا الرحمن الرحيم

بسم هللا الرحمن الرحيم بسم هللا الرحمن الرحيم Q1: the overall folding of a single protein subunit is called : -tertiary structure -primary structure -secondary structure -quaternary structure -all of the above Q2 : disulfide

More information

Enzymes. Gibbs Free Energy of Reaction. Parameters affecting Enzyme Catalysis. Enzyme Commission Number

Enzymes. Gibbs Free Energy of Reaction. Parameters affecting Enzyme Catalysis. Enzyme Commission Number SCBC203 Enzymes Jirundon Yuvaniyama, Ph.D. Department of Biochemistry Faculty of Science Mahidol University Gibbs Free Energy of Reaction Free Energy A B + H 2 O A OH + B H Activation Energy Amount of

More information

Toxins 2016, 8, 222; doi: /toxins

Toxins 2016, 8, 222; doi: /toxins S1 of S8 Supplementary Materials: Mapping Protein Protein Interactions of the Resistance Related Bacterial Zeta Toxin Epsilon Antitoxin Complex (ε2ζ2) with High Affinity Peptide Ligands Using Fluorescence

More information

ab Cathepsin K Inhibitor Screening Kit (Fluorometric)

ab Cathepsin K Inhibitor Screening Kit (Fluorometric) ab185439 Cathepsin K Inhibitor Screening Kit (Fluorometric) Instructions for Use For the sensitive and accurate screening of Cathepsin K inhibitors in a variety of samples This product is for research

More information

Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard. Product Number: AD0014

Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard. Product Number: AD0014 TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1284 Iodoacetamido Chelate & Europium Standard Product Number: AD0014 INTRODUCTION: Iodoacetamido-activated

More information

ab HRV 3C Protease Inhibitor Screening Kit (Colorimetric)

ab HRV 3C Protease Inhibitor Screening Kit (Colorimetric) Version 2 Last updated 2 March 2017 ab211089 HRV 3C Protease Inhibitor Screening Kit (Colorimetric) For the rapid, sensitive and accurate screening of potential HRV 3C Protease inhibitors. This product

More information

FIRST BIOCHEMISTRY EXAM Tuesday 25/10/ MCQs. Location : 102, 105, 106, 301, 302

FIRST BIOCHEMISTRY EXAM Tuesday 25/10/ MCQs. Location : 102, 105, 106, 301, 302 FIRST BIOCHEMISTRY EXAM Tuesday 25/10/2016 10-11 40 MCQs. Location : 102, 105, 106, 301, 302 The Behavior of Proteins: Enzymes, Mechanisms, and Control General theory of enzyme action, by Leonor Michaelis

More information

ab Histone Deacetylase (HDAC) Activity Assay Kit (Fluorometric)

ab Histone Deacetylase (HDAC) Activity Assay Kit (Fluorometric) ab156064 Histone Deacetylase (HDAC) Activity Assay Kit (Fluorometric) Instructions for Use For the quantitative measurement of Histone Deacetylase activity in cell lysates This product is for research

More information

OxiSelect Myeloperoxidase Chlorination Activity Assay Kit (Fluorometric)

OxiSelect Myeloperoxidase Chlorination Activity Assay Kit (Fluorometric) Product Manual OxiSelect Myeloperoxidase Chlorination Activity Assay Kit (Fluorometric) Catalog Number STA-804 192 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Myeloperoxidase

More information

Galactose Assay Kit. Catalog Number KA assays Version: 04. Intended for research use only.

Galactose Assay Kit. Catalog Number KA assays Version: 04. Intended for research use only. Galactose Assay Kit Catalog Number KA1669 100 assays Version: 04 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

STORE AT 4 o C Version 3

STORE AT 4 o C Version 3 Instruction Manual Advanced Protein Assay Reagent (Cat. # ADV01) ORDERING INFORMATION To order by phone: (303) - 322-2254 To order by Fax: (303) - 322-2257 To order by e-mail: cserve@cytoskeleton.com Technical

More information

InnoZyme Myeloperoxidase Activity Kit Cat. No. CBA024

InnoZyme Myeloperoxidase Activity Kit Cat. No. CBA024 User Protocol CBA024 Rev. 23 May 2005 RFH Page 1 of 6 InnoZyme Myeloperoxidase Activity Kit Cat. No. CBA024 Table of Contents Page Storage 1 Intended Use 1 Background 1 Principle of the Assay 2 Materials

More information

SUPPLEMENTARY MATERIAL Antiradical and antioxidant activity of flavones from Scutellariae baicalensis radix

SUPPLEMENTARY MATERIAL Antiradical and antioxidant activity of flavones from Scutellariae baicalensis radix SUPPLEMENTARY MATERIAL Antiradical and antioxidant activity of flavones from Scutellariae baicalensis radix Dorota Woźniak A, Andrzej Dryś B, and Adam Matkowski* A A Department of Pharmaceutical Biology

More information

Ascorbic Acid Assay Kit

Ascorbic Acid Assay Kit Ascorbic Acid Assay Kit Catalog Number KA1660 100 assays Version: 04 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Principle of the Assay... 3 General

More information

االمتحان النهائي لعام 1122

االمتحان النهائي لعام 1122 االمتحان النهائي لعام 1122 Amino Acids : 1- which of the following amino acid is unlikely to be found in an alpha-helix due to its cyclic structure : -phenylalanine -tryptophan -proline -lysine 2- : assuming

More information

Past Years Questions Chpater 6

Past Years Questions Chpater 6 Past Years Questions Chpater 6 **************************************** 1) Which of the following about enzymes is Incorrect? A) Most enzymes are proteins. B) Enzymes are biological catalysts. C) Enzymes

More information

Cathepsin K Activity Assay Kit

Cathepsin K Activity Assay Kit Cathepsin K Activity Assay Kit Catalog Number KA0769 100 assays Version: 03 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information... 4 Materials

More information

PHRM 836 September 1, 2015

PHRM 836 September 1, 2015 PRM 836 September 1, 2015 Protein structure- function relationship: Catalysis example of serine proteases Devlin, section 9.3 Physiological processes requiring serine proteases Control of enzymatic activity

More information

For the rapid, sensitive and accurate measurement of Aspartate aminotransferase activity in various samples

For the rapid, sensitive and accurate measurement of Aspartate aminotransferase activity in various samples ab105135 Aspartate Aminotransferase Activity Assay Kit Instructions for Use For the rapid, sensitive and accurate measurement of Aspartate aminotransferase activity in various samples This product is for

More information

Caspase-3 Assay Cat. No. 8228, 100 tests. Introduction

Caspase-3 Assay Cat. No. 8228, 100 tests. Introduction Introduction Caspase-3 Assay Cat. No. 8228, 100 tests Caspase-3 is a member of caspases that plays a key role in mediating apoptosis, or programmed cell death. Upon activation, it cleaves a variety of

More information

Identification and characterization of genes responsive to apoptosis: Application of DNA chip technology and mrna differential display

Identification and characterization of genes responsive to apoptosis: Application of DNA chip technology and mrna differential display Histol Histopathol (2000) 15: 1271-1 284 http://www.ehu.es/histol-histopathol Histology and H istopat hology Cellular and Molecular Biology Invited Revie W Identification and characterization of genes

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/2/4/e1500980/dc1 Supplementary Materials for The crystal structure of human dopamine -hydroxylase at 2.9 Å resolution Trine V. Vendelboe, Pernille Harris, Yuguang

More information

A TURBIDIMETRIC METHOD FOR THE ASSAY OF MELOXICAM USING MOLYBDOPHOSPHORIC ACID

A TURBIDIMETRIC METHOD FOR THE ASSAY OF MELOXICAM USING MOLYBDOPHOSPHORIC ACID FARMACIA, 2010, Vol.58, 3 315 A TURBIDIMETRIC METHOD FOR THE ASSAY OF MELOXICAM USING MOLYBDOPHOSPHORIC ACID ANDREEA ELENA MURARAŞU*, MARIANA MÂNDRESCU, ADRIAN FLORIN ŞPAC, VASILE DORNEANU University of

More information

Tunable Hydrophobicity in DNA Micelles Anaya, Milena; Kwak, Minseok; Musser, Andrew J.; Muellen, Klaus; Herrmann, Andreas; Müllen, Klaus

Tunable Hydrophobicity in DNA Micelles Anaya, Milena; Kwak, Minseok; Musser, Andrew J.; Muellen, Klaus; Herrmann, Andreas; Müllen, Klaus University of Groningen Tunable Hydrophobicity in DNA Micelles Anaya, Milena; Kwak, Minseok; Musser, Andrew J.; Muellen, Klaus; Herrmann, Andreas; Müllen, Klaus Published in: Chemistry DOI: 10.1002/chem.201001816

More information

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin

PAPER No. : 16, Bioorganic and biophysical chemistry MODULE No. : 22, Mechanism of enzyme catalyst reaction (I) Chymotrypsin Subject Paper No and Title 16 Bio-organic and Biophysical Module No and Title 22 Mechanism of Enzyme Catalyzed reactions I Module Tag CHE_P16_M22 Chymotrypsin TABLE OF CONTENTS 1. Learning outcomes 2.

More information

Enzymes: The Catalysts of Life

Enzymes: The Catalysts of Life Chapter 6 Enzymes: The Catalysts of Life Lectures by Kathleen Fitzpatrick Simon Fraser University Activation Energy and the Metastable State Many thermodynamically feasible reactions in a cell that could

More information

Cathepsin K Activity Assay Kit (Fluorometric)

Cathepsin K Activity Assay Kit (Fluorometric) ab65303 Cathepsin K Activity Assay Kit (Fluorometric) Instructions for Use For the rapid, sensitive and accurate measurement of Cathepsin K activity in various samples. This product is for research use

More information

Plasmonic blood glucose monitor based on enzymatic. etching of gold nanorods

Plasmonic blood glucose monitor based on enzymatic. etching of gold nanorods Plasmonic blood glucose monitor based on enzymatic etching of gold nanorods Xin Liu, Shuya Zhang, Penglong Tan, Jiang Zhou, Yan Huang, Zhou Nie* and Shouzhuo Yao State Key Laboratory of Chemo/Biosensing

More information

MRP2 TR ATPase Assay Protocol CAT. NO. SBAT03

MRP2 TR ATPase Assay Protocol CAT. NO. SBAT03 MRP2 TR ATPase CAT. NO. SBAT03 Page 1 of 18 Determination of the interaction of drugs with the human MRP2 (ABCC2) transporter using the ATPase Assay For the following membrane products: SB-MRP2-Sf9-ATPase

More information

PAF Acetylhydrolase Assay Kit

PAF Acetylhydrolase Assay Kit PAF Acetylhydrolase Assay Kit Catalog Number KA1354 96 assays Version: 04 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay... 3 General

More information

ab CYP2C19 Activity Assay Kit (Fluorometric)

ab CYP2C19 Activity Assay Kit (Fluorometric) Version 2 Last updated 1 March 2017 ab211072 CYP2C19 Activity Assay Kit (Fluorometric) For the rapid, sensitive and accurate measurement of cytochrome P450 2C19 (CYP2C19) activity in various samples. This

More information

ab HIV-1 Protease Inhibitor Screening Kit (Fluorometric)

ab HIV-1 Protease Inhibitor Screening Kit (Fluorometric) Version 1 Last updated 2 March 2017 ab211106 HIV-1 Protease Inhibitor Screening Kit (Fluorometric) For the rapid, sensitive and accurate screening of potential HIV-1 Protease inhibitors. This product is

More information

PD1/PD-L1 BINDING ASSAY KITS

PD1/PD-L1 BINDING ASSAY KITS PD1/PD-L1 BINDING ASSAY KITS PROTOCOL Part # 64ICP01PEG & 64ICP01PEH Test size: 500 tests (64ICP01PEG), 10,000 tests (64ICP01PEH) - assay volume: 20 µl Revision: 02 (July 2017) Store at: -60 C or below

More information

Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard. Product Number: AD0013

Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard. Product Number: AD0013 TECHNICAL DATA SHEET Lance Caution: For Laboratory Use. A product for research purposes only. Eu-W1024 ITC Chelate & Europium Standard Product Number: AD0013 INTRODUCTION: Fluorescent isothiocyanato-activated

More information

Total Phosphatidic Acid Assay Kit

Total Phosphatidic Acid Assay Kit Product Manual Total Phosphatidic Acid Assay Kit Catalog Number MET- 5019 100 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Phosphatidic Acid (PA) is a critical precursor

More information

Glycosyltransferase Activity Kit

Glycosyltransferase Activity Kit Glycosyltransferase Activity Kit Catalog Number EA001 This package insert must be read in its entirety before using this product. For research use only. Not for use in diagnostic procedures. TABLE OF CONTENTS

More information

Effects of Second Messengers

Effects of Second Messengers Effects of Second Messengers Inositol trisphosphate Diacylglycerol Opens Calcium Channels Binding to IP 3 -gated Channel Cooperative binding Activates Protein Kinase C is required Phosphorylation of many

More information

This PDF file includes: Supplementary Figures 1 to 6 Supplementary Tables 1 to 2 Supplementary Methods Supplementary References

This PDF file includes: Supplementary Figures 1 to 6 Supplementary Tables 1 to 2 Supplementary Methods Supplementary References Structure of the catalytic core of p300 and implications for chromatin targeting and HAT regulation Manuela Delvecchio, Jonathan Gaucher, Carmen Aguilar-Gurrieri, Esther Ortega, Daniel Panne This PDF file

More information

SMART Digest Kit Facilitating perfect digestion

SMART Digest Kit Facilitating perfect digestion Questions Answers SMART Digest Kit Facilitating perfect digestion The modern biopharmaceutical and protein research laboratory is tasked with providing high quality analytical results, often in high-throughput,

More information

MitoCheck Complex II Activity Assay Kit

MitoCheck Complex II Activity Assay Kit MitoCheck Complex II Activity Assay Kit Item No. 700940 www.caymanchem.com Customer Service 800.364.9897 Technical Support 888.526.5351 1180 E. Ellsworth Rd Ann Arbor, MI USA TABLE OF CONTENTS GENERAL

More information