Discovering the Role of the Microbiome in Human Health through the Power of Metagenomics. Tanya Yatsunenko Second Genome
|
|
- Cathleen Dixon
- 5 years ago
- Views:
Transcription
1 Discovering the Role of the Microbiome in Human Health through the Power of Metagenomics Tanya Yatsunenko Second Genome
2 The microbiome is implicated in the biggest public health threats Ridaura et al, Science, 2013
3 Our view of the microbiome is evolving SANITIZER/
4 Incidence of Crohn s disease around the world
5 Global view on the gut microbiome USA 94 families: 312 people, 1mo-55 y/o Amerindians (Venezuela) 2 villages: 19 families: 98 people, 1mo 73 y/o Malawi 1 fecal sample per person 16S rrna 1.8 mln sequences/sample Shotgun sequencing of 110 microbiomes 150,000 sequences/sample 4 regions: 34 families: 114 people, 3 wks 35 y/o Yatsunenko et al, Nature, 2012
6 Analysis of microbial communities Composition 16S rrna gene surveys Functional potential (microbiome) Metagenomics
7 Analysis of composition of microbial communities (16S rrna) 4 biological samples
8 Comparison of microbial communities OR Taxon Gene Sample1 Sample2 Sample3 Sample4 A B C D E F Distance matrix 0 = min distance 1 = max distance Sample1 Sample2 Sample3 Sample4 Sample Sample Sample Sample4 0 Cluster microbiomes: Principal Coordinate Analysis Or Hierarchical Clustering OR UniFrac: Lozupone et al, 2005
9 USA microbiomes differ from Malawians and Amerindians at all sampled ages UniFrac PCoA of adults
10 What factors influence the microbiome? Environment Diet Genetics
11 Role of diet: mammals 60 phylogenetically diverse mammals Animals consuming similar diets have similar microbiomes Amino acid metabolism differentiates herbivorous vs carnivorous gut microbiomes UniFrac PCoA Ley et al, Science, 2008; Muegge et al, Science, 2011
12 Role of diet: humans 10 subjects Plant Animal Different from baseline Dramatic shifts on animal diet Genus Prevotella decreased Changes mirror differences Similar to baseline between herbivorous and carnivorous animals Increase in bile-tolerant microbes (Alistepes, Bilophila, Bacteroides) David et al, Nature, 2013
13 Analysis of microbiomes - metagenomics Genomic DNA or mrna Databases of sequenced genomes Gene Sample1 Sample2 Sample3 Sample4 A B C D E F
14 Functional annotation Example of pathway/genome database (BioCyc) >BTHE226 GJXV-2161 Na+-driven multidrug pump Bacteroides thetaiotaomicron VPI-5482 MADDKKIIFSMVGVSKAFQPNKNVLKDIYLSFFYGAKIGIIGLNGSGKSTLLKIIAGLEK SYQGEVVFSPGYSVGYLAQEPYLDDTKTVKEVVMEGVQPIVDALAEYEEINQKFGLPEYY EDQDKMDILFARQGELQDIIDATDAWNLDSKLERAMDALRCPPEDQPVVNLSGGERRRVA LCRLLLQKPDILLLDEPTNHLDAESIDWLEQHLQQYEGTVIAVTHDRYFLDHVAGWILEL >FP226 GJXV-1205 GTP cyclohydrolase Faecalibacterium prausnitzii M-65 MTGQKTPTALGTEKIGKLLMQYAIPAIIAMTASSLYNMVDSIFIGHGVGAMAISGLALTF PLMNLAAAFGSLVGVGAATLVSVKLGQKDYDTAQRVLGNVLVLNIIIGLAFTVLTLIFLD PILYFFGGSEATVGYARDYMVVILWGNVITHLYLGLNAVLRSAGHPQKAMYATIATVVIN >ASP232 GHWE-1493 orf Acidovorax sp.js42 MKKLVALAMLAASASPLWATTQSVTLSVPDMNCATCPITVKKALTKVSGVSKIDVNLDRR EAKVTFDDTKANVEVLTRATRNAGYPATVLGDAK >ASP232 GHWE-1158 orf Acidovorax sp.js42 MSVNHPIAFLCRLLTTAAFCCLVALGVTLARSTPWDANLVYSLTIGLVSWFTVDLGRMAL TRHSAIPWPRRPWGAVLIFAGTAMGFVSGSVVGHLYNGGALGDLAWLRGHEAVSTLVVTI AASASISFFFHSRGKARFLQARVAQVQRDAAEARLKLLETQLEPHMMFNTLANLRVLVAT DPPRAQEMLDHFIAYLRATLGASRAALHPLADEFARLQDYLALMAVRMGPRLDYTLELPE PSPDCRG FP226 Genome ID GJXV-1205 Gene ID GTP cyclohydrolase - Gene name Faecalibacterium prausnitzii M-65 Strain name
15 Functional annotation Query Sequence from Sample1: KDYDTAQRVLGNVLVLNIIIGLAFTVLTLIFLD >BTHE226 GJXV-2161 Na+-driven multidrug pump Bacteroides thetaiotaomicron VPI-5482 MADDKKIIFSMVGVSKAFQPNKNVLKDIYLSFFYGAKIGIIGLNGSGKSTLLKIIAGLEK SYQGEVVFSPGYSVGYLAQEPYLDDTKTVKEVVMEGVQPIVDALAEYEEINQKFGLPEYY EDQDKMDILFARQGELQDIIDATDAWNLDSKLERAMDALRCPPEDQPVVNLSGGERRRVA LCRLLLQKPDILLLDEPTNHLDAESIDWLEQHLQQYEGTVIAVTHDRYFLDHVAGWILEL >FP226 GJXV-1205 GTP cyclohydrolase Faecalibacterium prausnitzii M-65 MTGQKTPTALGTEKIGKLLMQYAIPAIIAMTASSLYNMVDSIFIGHGVGAMAISGLALTF PLMNLAAAFGSLVGVGAATLVSVKLGQKDYDTAQRVLGNVLVLNIIIGLAFTVLTLIFLD PILYFFGGSEATVGYARDYMVVILWGNVITHLYLGLNAVLRSAGHPQKAMYATIATVVIN >ASP232 GHWE-1493 orf Acidovorax sp.js42 MKKLVALAMLAASASPLWATTQSVTLSVPDMNCATCPITVKKALTKVSGVSKIDVNLDRR EAKVTFDDTKANVEVLTRATRNAGYPATVLGDAK 100% ID, Exact match to 2 nd sequence Add count to genes and genomes table Genes 1 2 GJXV-1205, GTP cyclohydrolase 1 0 GJXV-2161, Na+-driven multidrug pump 0 10 Genomes 1 2 Faecalibacterium prausnitzii M Acidovorax sp.js42 0 1
16 Functional annotation Genes -> Enzymes -> Pathways Genes 1 2 GJXV-1205, GTP cyclohydrolase 1 0 GJXV-2161, Na+-driven multidrug pump 0 10 Gene GJXV-1205 encodes an enzyme ENZRXNJXV-1763, which is part of the Lipopolysaccharide-Biosynthesis Pathway Enzymes 1 2 ENZRXNJXV ENZRXNJXV Pathways 1 2 NAGLIPASYN-PWY 1 0 PWY
17 Functional annotation Genes -> Enzymes -> Pathways and Strains 1 Query Sequence from Sample1: KDYDTAQRVLGNVLVLNIIIGLAFTVLTLIFLD Functional assignments Genes 1 2 GJXV-1205, GTP cyclohydrolase 1 0 GJXV-2161, Na+-driven multidrug pump 0 10 Bacterial strain assignments Strains 1 2 Faecalibacterium prausnitzii M Acidovorax sp.js Enzymes 1 2 ENZRXNJXV ENZRXNJXV Pathways 1 2 NAGLIPASYN-PWY 1 0 PWY
18 The function of most microbial genes is still not fully understood Escherichia coli K-12 Faecalibacterium prausnitzii Total # genes 4,273 3,553 Protein coding genes connected to MetaCyc Pathways 31% 16%
19 Differences between adult microbiomes could be related to diet USA Malawi Amerindians Amino acid metabolism Carbohydrate metabolism Vitamin metabolism Other functions USA microbiome enriched in: Catabolism of amino acids Catabolism of simple sugars Biosynthesis of vitamins Metabolism of bile salts
20 Amerindians Malawi Cassava Corn- nsyma Ants!
21 Role of environment USA year old twins Fathers are as similar to their children as mothers in adulthood Shared features of microbial communities among household members extends to husband and wife True for skin and oral microbiota Dog ownership increases the exchange of microbes Yatsunenko et al, Nature, 2012; Song et al, elife, 2013
22 Role of host genetics: twins Malawi 0-3 year old USA 0-1 year old Identical twins are as similar to each other as fraternal twins in all sampled countries and ages USA year old More similar Less similar Yatsunenko et al, Nature, 2012
23 Gut microbiota evolves toward adult-like in the first 3 years of life Less similar to adults 0.96 More similar to adults UniFrac Distance Average distance from Malawian child to all unrelated adults from Malawi Malawi Amerindians USA Age, years Yatsunenko et al, Nature, 2012
24 GTP Formamidopyrimidine nucleoside triphosphate 2,5-Diaminopyrimidine nucleoside triphosphate ,5-Diamino-6-(5 -triphosphoryl- 3,4 -trihydroxy-2 -oxopentyl)- amino-4-oxopyrimidine Representation of genes involved in folate biosynthesis is higher in infant microbiomes; those involved in folate metabolism are higher in adult microbiomes 2-Amino-4-hydroxy- 6-(erythro-1,2,3-trihydroxypropyl)- dihydropteridine triphosphate Dihydroneopterin Dihydroneopterin phosphate De novo biosynthesis 4-Amino- 4-deoxychorismate 4-aminobenzoate Chorismate ,8-Dihydropteroate Amino-4-hydroxy- 6-hydromethyl- 7,8-dihydropteridine 2-Amino-4-hydroxy- 6-hydromethyl- 7,8-dihydropteridine-P ? Higher dietary intake of folate in adults? Metabolism of tetrahydrofolate 7,8-dihydrofolate (DHF) 5-Formyl-THF Folate ,6,7,8-tetrahydrofolate (THF) Formyl-THF ,10-Methenyl-THF ,10-Methylene- THF EC Breast-fed babies THF-L-glutamate Formimino-THF Methyl- THF EC Adults THF-L-polyglutamate L-methionine B12 L-Homocysteine
25 5-Aminolevulinate Porphobilinogen Hydroxymethylbilane Uroporphyrinogen III Heme, Chlorophyll synthesis Glutamate-1- semialdehyde (Anaerobic pathway) Sirohydrochlorin Siroheme Precorrin Co-Sirohydrochlorin Co-Factor 3 Co-Precorrin 3 Co-Precorrin 4 Co-Precorrin 5A Co-Precorrin 6B Co-Precorrin Co-Precorrin 8X (Aerobic pathway) Precorrin 3A... Precorrin 3B Precorrin 4 Precorrin Precorrin 6B Precorrin 8X Biosynthesis of B12 is higher in adults Correlates with published reports indicating that blood levels of folate decrease and vitamin B12 increase as babies age Glycine, threonine metabolism (R)-1-Aminopropan-2-ol Cobinamide Adenosyl cobinamide (R)-1-Aminopropan-2-yl L-Threonine phosphate phosphate Adenosyl cobinamide phosphate L-Threonine Dimethyl benzimidazole α Ribazole-5 -P α Ribazole Adenosine-GDPcobinamide Cobyrinate Cob(II)yrinate a,c diamide Cob(I)yrinate a,c diamide Hydrogenobyrinate a,c diamide Adenosyl cobyrinate a,c diamide Adenosyl cobyrinate hexaamide Microbes that are abundant in babies do not have genes encoding B12 biosynthesis! Higher in the microbiomes of adults Vitamin B12 coenzyme Vitamin B12s
26 Hypothesis: B12 microbiome Intrinsic Factor secretion increases with age Yuriko et al, J of Ped Gastro, 2002
27 Our view of the microbiome is evolving SANITIZER/
28 Questions?
HUMAN GUT MICROBIOTA
HUMAN GUT MICROBIOTA Patrizia Brigidi Department of Pharmaceutical Sciences, University of Bologna, Italy patrizia.brigididi@unibo.it The Gut-Liver axis: a bidirectional relation in health and disease
More informationMark Manary MD. International Symposium on Understanding Moderate Malnutrition in Children for Effective Interventions
Possible role of the microbiome in the development of acute malnutrition and implications for food-based strategies to prevent and treat acute malnutrition International Symposium on Understanding Moderate
More informationGut Microbiomes of Malawian Twin Pairs Discordant for Kwashiorkor
Gut Microbiomes of Malawian Twin Pairs Discordant for Kwashiorkor Michelle I. Smith et al. Science 339, 548 (2013) Dept Meeting, 28 May 2013, M. UMEZAKI ABSTRACT. Kwashiorkor, an enigmatic form of severe
More informationThe Gut Microbiota: Evidence For Gut Microbes as Contributors to Weight Gain
The Gut Microbiota: Evidence For Gut Microbes as Contributors to Weight Gain Michael T. Bailey, Ph.D. Center for Microbial Pathogenesis The Research Institute, Nationwide Children s Hospital Department
More informationNutritional Megaloblastic Anemias DR. NABIL BASHIR HLS, 2018
Nutritional Megaloblastic Anemias DR. NABIL BASHIR HLS, 2018 Definition: Macrocytic Anemia MCV>100fL Impaired DNA formation due to lack of: B12 or folate in ultimately active form use of antimetabolite
More informationFolic Acid and vitamin B12
Folic Acid and vitamin B12 ILOs: by the end of this lecture, you will be able to: 1. Understand that vitamins are crucial nutrients that are important to health. 2. Know that folic acid and vitamin B12
More informationThe number of microorganisms residing in our intestines is 10 times the number of our somatic and germ cells.
The number of microorganisms residing in our intestines is 10 times the number of our somatic and germ cells. The number of microorganisms residing in our intestines is 10 times the number of our somatic
More informationNew Insights on the Structure of the Human Gut Microbiota. Chaysavanh Manichanh, PhD Vall d Hebron Research Institute Barcelona
New Insights on the Structure of the Human Gut Microbiota Chaysavanh Manichanh, PhD Vall d Hebron Research Institute Barcelona Sessio Societat Catalana Malalties Infecciosas i Microbiologia March 20th,
More informationBiochemistry: A Short Course
Tymoczko Berg Stryer Biochemistry: A Short Course Second Edition CHAPTER 31 Amino Acid Synthesis 2013 W. H. Freeman and Company Chapter 31 Outline Although the atmosphere is approximately 80% nitrogen,
More informationNIH Public Access Author Manuscript Nature. Author manuscript; available in PMC 2012 December 14.
NIH Public Access Author Manuscript Published in final edited form as: Nature. ; 486(7402): 222 227. doi:10.1038/nature11053. Human gut microbiome viewed across age and geography Tanya Yatsunenko 1, Federico
More informationMicrobial Adaptations of the Microbiome. Damian R. Plichta, PhD Director of Bioinformatics
Microbial Adaptations of the Microbiome Damian R. Plichta, PhD Director of Bioinformatics Tailored shotgun metagenomics Microbiome model for biomarker discovery microbiome incoming species conditional
More informationByproduct Cross Feeding and Community Stability in an In Silico Biofilm Model of the Gut Microbiome
processes Article Byproduct Cross Feeding and Community Stability in an In Silico Biofilm Model of the Gut Microbiome Michael A. Henson * and Poonam Phalak Department of Chemical Engineering and Institute
More informationAmino Acid Metabolism
Amino Acid Metabolism Last Week Most of the Animal Kingdom = Lazy - Most higher organisms in the animal kindom don t bother to make all of the amino acids. - Instead, we eat things that make the essential
More informationTHE ROLE OF MICROBIOME IN IBD
Disclosures THE ROLE OF MICROBIOME IN IBD Janssen UCB No relevance to the talk Subra Kugathasan, MD Professor of Pediatrics & Human Genetics Marcus Professor of Pediatric Gastroenterology Emory University
More informationUsing Phylogenetic Structure to Assess the Evolutionary Ecology of Microbiota! TJS! iseem Call! April 2015!
Using Phylogenetic Structure to Assess the Evolutionary Ecology of Microbiota! TJS! iseem Call! April 2015! How are Microbes Distributed In Nature?! A major question in microbial ecology! Used to assess
More informationMidterm 2. Low: 14 Mean: 61.3 High: 98. Standard Deviation: 17.7
Midterm 2 Low: 14 Mean: 61.3 High: 98 Standard Deviation: 17.7 Lecture 17 Amino Acid Metabolism Review of Urea Cycle N and S assimilation Last cofactors: THF and SAM Synthesis of few amino acids Dietary
More information0.5. Normalized 95% gray value interval h
Normalized 95% gray value interval.5.4.3.2.1 h Supplemental Figure 1: Symptom score of root samples used in the proteomics study. For each time point, the normalized 95% gray value interval is an averaged
More informationGut Reaction. Mary ET Boyle, Ph. D. Department of Cognitive Science UCSD
Gut Reaction Mary ET Boyle, Ph. D. Department of Cognitive Science UCSD Ley, R. et al (2005) PNAS vol. 102 no. 31 Bacterial diversity in the distal gut (ceca) of C57BL6 mice. (A) Phylogenetic tree of
More informationLecture 11 - Biosynthesis of Amino Acids
Lecture 11 - Biosynthesis of Amino Acids Chem 454: Regulatory Mechanisms in Biochemistry University of Wisconsin-Eau Claire 1 Introduction Biosynthetic pathways for amino acids, nucleotides and lipids
More informationAre microbes the missing piece of the gut comfort puzzle?
Priority Research Programme Foods for improving gut function and comfort Are microbes the missing piece of the gut comfort puzzle? Wayne Young Senior Scientist, AgResearch Host institution Foods for gut
More informationGlycolysis. Cellular Respiration
Glucose is the preferred carbohydrate of cells. In solution, it can change from a linear chain to a ring. Energy is stored in the bonds of the carbohydrates. Breaking these bonds releases that energy.
More information6/24/2014. How do you study microbial communities? Outnumbers Cells of the Body 10:1 Outnumber Human Genes 100:1. Michael T. Bailey, Ph.D.
Interactions between Diet and the Intestinal Microbiota: Implications for Obesity The Body is Colonized by an Enormous Array of Bacteria Outnumbers Cells of the Body 10:1 Outnumber Human Genes 100:1 Michael
More informationMaternal Secretor Status and Child Microbiota Composition. Paula Smith-Brown Paediatric Dietitian & PhD Scholar
Maternal Secretor Status and Child Microbiota Composition Paula Smith-Brown Paediatric Dietitian & PhD Scholar The First 1000 Days Development of Microbiota Yatsunenko et al. Nature 000, 1-7 (2012) WHO,
More informationDental Students Biochemistry Exam V Questions ( Note: In all cases, the only correct answer is the best answer)
Dental Students Biochemistry Exam V Questions - 2006 ( Note: In all cases, the only correct answer is the best answer) 1. Essential fatty acids are: A. precursors of biotin B. precursors of tyrosine C.
More informationIssues at Hand. Inflammatory Bowel Disease Paradigm. Diet changes the fecal microbiome. Experience with diet in IBD
Diet s Role in IBD David Suskind M.D. Professor of Pediatrics Director of Clinical Gastroenterology Division of Gastroenterology University of Washington Seattle Children s Hospital Issues at Hand Inflammatory
More informationFaecalibacterium prausnitzii
Faecalibacterium prausnitzii is an anti-inflammatory commensal bacterium identified by gut microbiota analysis of Crohn disease patients PNAS 105(43): 16731-16736, 2008. Speaker: Ming-Cheng Chen Advisor:
More informationIs there an anti-inflammatory diet in IBD?
CCFA North Texas Chapter IBD education symposium December 2, 2017, Dallas, TX Is there an anti-inflammatory diet in IBD? Themos Dassopoulos, MD Director, Baylor Scott and White Center for IBD Baylor University
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12198 1. Supplementary results 1.1. Associations between gut microbiota, glucose control and medication Women with T2D who used metformin had increased levels of Enterobacteriaceae (i.e.
More informationProf Dr Mohammad Ibrahim Prof of Medical Biochemistry
Amino Acids Metabolism ١ i Metabolism ٢ NH2 Structure It is α-amino acetic acid Nutrional Value It is non-essential amino acid Metabolic Fate It is glucogenic g amino acid ٣ Biosynthesis 1. From 2 and
More informationStable Isotope Probing of gut bacteria RNA. Wayne Young. Identifying gut bacteria that can use sialic acid using an RNA-SIP approach
Stable Isotope Probing of gut bacteria RNA Identifying gut bacteria that can use sialic acid using an RNA-SIP approach Wayne Young Food Nutrition & Health Team Food & Bio-based Products Group AgResearch
More informationDiet-microbiome-health interactions in older people
Diet-microbiome-health interactions in older people Paul W. O Toole Prof. Microbial Genomics School of Microbiology, Univ. College Cork, Ireland APC Microbiome Institute, Univ. College Cork, Ireland http://apc.ucc.ie
More informationnumber Done by Corrected by Doctor Dr.Diala
number 32 Done by Mousa Salah Corrected by Bahaa Najjar Doctor Dr.Diala 1 P a g e In the last lecture we talked about the common processes between all amino acids which are: transamination, deamination,
More informationWhy Use Genetic Testing in Practice?
Pure Encapsulations is committed to producing the most complete line of research-based nutritional supplements. Available through health professionals, finished products are pure and hypoallergenic to
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature13421 Supplementary Notes Anthropologic assessment The study population resided in the Mirpur slum of Dhaka, Bangladesh (23.8042 N 90.3667 E) in a catchment
More informationHOW THE MICROBIOME AFFECTS OUR HEALTH
HOW THE MICROBIOME AFFECTS OUR HEALTH THE INTESTINAL BARRIER AND INTESTINAL PERMEABILITY Intestinal Barrier: a functional body Defense from translocation of dietary antigens, bacteria or bacterial endotoxins
More informationThe Gut Microbiome: 101 Justin Carlson University of Minnesota
The Gut Microbiome: 101 Justin Carlson University of Minnesota Where are we now? 360 B.C. 2003 Human Gut Microbes Associated With Obesity Ley et al., Nature. 2006. Consumer Driven Science For Better of
More informationE.coli Core Model: Metabolic Core
1 E.coli Core Model: Metabolic Core 2 LEARNING OBJECTIVES Each student should be able to: Describe the glycolysis pathway in the core model. Describe the TCA cycle in the core model. Explain gluconeogenesis.
More informationINTESTINAL MICROBIOTA EXAMPLES OF INDIVIDUAL ANALYSES
EXAMPLES OF INDIVIDUAL ANALYSES INTESTINAL MICROBIOTA Microbiota in the animal or human intestine has evolved together with the host. Consequently, the gastrointestinal tract could be considered a metacommunity,
More informationSocioeconomic State & Intestinal Microbiota. Ali Keshavarzian, MD Rush University Medical Center Chicago, IL
Socioeconomic State & Intestinal Microbiota Ali Keshavarzian, MD Rush University Medical Center Chicago, IL Socioeconomic Status (SES) SES is a hierarchical social classification associated with different
More informationFolic Acid. Ameer Saadallah Al-Zacko Ahmad Ausama Al-Kazzaz Ahmad Maan Al-Hajar
Folic Acid Ameer Saadallah Al-Zacko Ahmad Ausama Al-Kazzaz Ahmad Maan Al-Hajar Now with Ahmad Maan Al-Hajar Folic acid Folic acid is a water soluble Vitamin which has many forms include folate, vitamin
More informationThe A, B, C s of Bowel Flora
The A, B, C s of Bowel Flora Cynthia L. Sears, M.D. Divisions of Infectious Diseases, Gastroenterology & Tumor Immunology Departments of Medicine, Oncology & Molecular Microbiology Sidney Kimmel Comprehensive
More informationAnything You Can Do I Can Do Better: Divergent Mechanisms to Metabolize Milk Oligosaccharides by Two Bifidobacterial Species. David A.
Anything You Can Do I Can Do Better: Divergent Mechanisms to Metabolize Milk Oligosaccharides by Two Bifidobacterial Species David A. Sela IMGC 2013 This is not our planet Bacteria present by 3.9 bya Archaea
More informationAnalysis of the effect of probiotics on shaping human gut microbiota
Analysis of the effect of probiotics on shaping human gut microbiota Masahira HATTORI Center for Omics and Bioinformatics, The University of Tokyo http://www.cb.k.u-tokyo.ac.jp/hattorilab
More informationHuman Microbiome Research at NIH: Past, Present & Future
Human Microbiome Research at NIH: Past, Present & Future Cindy D. Davis davisci@mail.nih.gov OFFICE OF DIETARY SUPPLEMENTS 1 None Disclosure Slide The Human Microbiome Ø We are a composite of species:
More informationShotgun metaproteomics of the human distal gut microbiota. Present by Lei Chen
Shotgun metaproteomics of the human distal gut microbiota Present by Lei Chen (lc6@indana.edu) Outline Background What are the goals? Materials and Methods Results Discussion Background The human gastrointestinal
More informationMicrobiome in You: Optimizing Gut Bacteria for Better IBD Management
Microbiome in You: Optimizing Gut Bacteria for Better IBD Management KT Park, M.D., M.S. Assistant Professor Co-Director, Stanford Children s Inflammatory Bowel Disease Center Stanford University School
More information-Supplementary Information-
-Supplementary Information- Probiotic Bifidobacterium longum alters gut luminal metabolism through modification of the gut microbial community Hirosuke Sugahara,2,3*, Toshitaka Odamaki, Shinji Fukuda 2,4,
More informationMETABOLISM OF AMINO ACIDS
Dr. M. Sasvari METABOLISM OF AMINO ACIDS 2. The fate of the carbon sceleton 3 N + C R Active C 1 intermediers The folate derivatives structure s Folate (F) - vitamin Folate, 2 F, 4 F Dihydrofolate ( 2
More informationTable S9A: List of taurine regulated genes in Bp K96243 Chr 1 (up regulated >=2 fold) Cluster no GENE ID Start Stop Strand Function
Table S9A: List of taurine regulated genes in Bp K96243 Chr 1 (up regulated >=2 fold) Cluster no GENE ID Start Stop Strand Function 1 BPSL0024 26223 26621 + LrgA family BPSL0025 26690 27412 + hypothetical
More informationThe role of intestinal microbiota in metabolic disease-a novel therapeutic target.
Michael Connolly Department of Food Biosciences, The University of Reading The role of intestinal microbiota in metabolic disease-a novel therapeutic target. University of Reading 2008 www.reading.ac.uk
More informationMicrobiome as a marker for CRC screening
WEO CRC Screening Committee Meeting Microbiome as a marker for CRC screening Dr Sunny H Wong MBChB (Hons), DPhil, MRCP, FHKCP, FHKAM (Medicine) Assistant Professor Institute of Digestive Disease Department
More informationSub-clinical detection of gut microbial biomarkers of obesity and type 2 diabetes
Yassour et al. Genome Medicine (2016) 8:17 DOI 10.1186/s13073-016-0271-6 RESEARCH Open Access Sub-clinical detection of gut microbial biomarkers of obesity and type 2 diabetes Moran Yassour 1,2, Mi Young
More informationDiet, Microbiome and Health Cindy D. Davis
Diet, Microbiome and Health Cindy D. Davis davisci@mail.nih.gov OFFICE OF DIETARY SUPPLEMENTS 1 Outline 1.What is the microbiome? 2.How does it vary over the lifespan? 3.What is the evidence that diet
More informationMicrobe-Host Interactions in Inflammatory Bowel Diseases. Hera Vlamakis Oct 3, 2018
Microbe-Host Interactions in Inflammatory Bowel Diseases Hera Vlamakis Oct 3, 2018 Most of the bacteria in your body are in your gut HEALTH BENEFITS Breakdown of polysaccharides Synthesis of vitamins Colonization
More informationcollected for biochemical and molecular microbiological analyses at baseline, week 4 and
SUPPLEMENTARY FIGURE LEGENDS Figure S1 Study design. Figure was adapted from Paramsothy et al. 5 Blood and stool samples were collected for biochemical and molecular microbiological analyses at baseline,
More informationA STUDY INTO THE HUMAN GUT MICROBIOME A RESEARCH PAPER SUBMITTED TO THE GRADUATE SCHOOL IN PARTIAL FULFILLMENT OF THE REQUIREMENTS
A STUDY INTO THE HUMAN GUT MICROBIOME A RESEARCH PAPER SUBMITTED TO THE GRADUATE SCHOOL IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE MASTER OF ARTS BY CESAR CHAPARRO DR. HEATHER BRUNS ADVISOR
More informationProbiotic action and health and well-being of children. Seppo Salminen Functional Foods Forum Finland
Probiotic action and health and well-being of children Seppo Salminen Functional Foods Forum Finland DEFINITION OF A PROBIOTIC Probiotic:...a living microbial preparation, which beneficially influences
More informationGut Microbiome Essentials
CORE COMPONENTS I: Gut Microbiome Essentials 2016 Tom Fabian, PhD Module Outline 1. Microbiome overview: getting a sense of the microbiome, research, what we know 2. Bacteria: features, functions, communities
More information4/17/2019 DISCLOSURES OBJECTIVES GI MICROBIOME & HEALTH: A REVIEW. Nancy C. Kois, MD, FCAP Contemporary Pathology Services. There are no disclosures
GI MICROBIOME & HEALTH: A REVIEW Nancy C. Kois, MD, FCAP Contemporary Pathology Services DISCLOSURES There are no disclosures OBJECTIVES Definitions: GI microbiota, GI microbiome, probiotic, prebiotic
More informationDysbiosis & Inflammation
MASTERING THE MICROBIOME: Dysbiosis & Inflammation 2017 Tom Fabian, PhD It is reasonable to propose that the composition of the microbiome and its activities are involved in most, if not all, of the biological
More informationAli Keshavarzian MD Rush University Medical Center, Chicago, IL
Ali Keshavarzian MD Rush University Medical Center, Chicago, IL Ulcerative colitis Crohn s disease Optimize Quality of Life Induce remission [treat flare up] Maintain remission [avoid flare up] Prevent
More informationFor more information about how to cite these materials visit
Author: Robert Lyons, Ph.D., 008 License: Unless otherwise noted, this material is made available under the terms of the reative ommons Attribution Share Alike.0 License: http://creativecommons.org/licenses/bysa/.0/
More information7.05 Spring 2004 May 7, Recitation #11
Recitation #11 ontact Information TA: Victor Sai Recitation: Friday, 3-4pm, 2-132 E-mail: sai@mit.edu ffice ours: Friday, 4-5pm, 2-132 Unit 4 Schedule Recitation/Exam Date Topic Recitation #11 Friday,
More informationExamining the effects of pre and probiotics on gut microbiota during the ageing process
Session: Reviewing key ingredients shaping nutrition for healthy ageing Tuesday 22 nd November 2016 Examining the effects of pre and probiotics on gut microbiota during the ageing process Louise R Wilson
More informationGut Microbiota and IBD. Vahedi. H M.D Associate Professor of Medicine DDRI
Gut Microbiota and IBD Vahedi. H M.D Associate Professor of Medicine DDRI 1393.3.1 2 GUT MICROBIOTA 100 Trillion Microbes - 10 times more than cells in our body Collective weight of about 1kg in human
More informationNature Immunology: doi: /ni Supplementary Figure 1
Supplementary Figure 1 NLRP12 is downregulated in biopsy samples from patients with active ulcerative colitis (UC). (a-g) NLRP12 expression in 7 UC mrna profiling studies deposited in NCBI GEO database.
More informationThe role of nutrition in optimum gastrointestinal health
The role of nutrition in optimum gastrointestinal health Kelly A. Tappenden, Ph.D., R.D., FASPEN Kraft Foods Human Nutrition Endowed Professor University Distinguished Teacher-Scholar University of Illinois
More informationSharing Our Bodies: The Symbiosis of Humans and Our Microbiota
Universidade de São Paulo Brasil Sharing Our Bodies: The Symbiosis of Humans and Our Microbiota Christian Hoffmann, PhD School of Pharmaceutical Sciences Dept. of Food Science and Experimental Nutrition
More informationThe Microbiome has Multiple Influences on Human Health
The Microbiome has Multiple Influences on Human Health Clifford Adams 1 and Bettina Gutirrez 2 1 ANOZENE Nutritional Sciences, Fruithoflaan 101, bus 14, 2600 Berchem Antwerp, Belgium. 2 Jennewein Biotechnologie
More informationGoing With Your Gut: The Microbiome and You
Going With Your Gut: The Microbiome and You Robert T. Schooley, MD Professor of Medicine University of California San Diego San Diego, California Learning Objectives After attending this presentation,
More informationAmino acid metabolism I
Amino acid metabolism I Jana Novotná Department of the Medical Chemistry and Clinical Biochemistry The 2nd Faculty of Medicine, Charles Univ. Metabolic relationship of amino acids DIETARY PROTEINS GLYCOLYSIS
More informationThe gut-skin axis in health and disease. Cath O Neill Centre for Dermatology University of Manchester
The gut-skin axis in health and disease Cath O Neill Centre for Dermatology University of Manchester Skin Structure Dermis Der epidermis mis subcutis Can skin structure/function be modified via the gut?
More informationDisappearing microbiota and epidemic obesity
Disappearing microbiota and epidemic obesity Martin J Blaser, MD Departments of Medicine and Microbiology New York University School of Medicine Langone Medical Center Department of Biology, NYU Ancient
More informationPAPER No. : 16 Bioorganic and biophysical chemistry MODULE No. : 25 Coenzyme-I Coenzyme A, TPP, B12 and biotin
Subject Paper No and Title Module No and Title Module Tag 16, Bio organic and Bio physical chemistry 25, Coenzyme-I : Coenzyme A, TPP, B12 and CHE_P16_M25 TABLE OF CONTENTS 1. Learning Outcomes 2. Introduction
More informationFARM MICROBIOLOGY 2008 PART 3: BASIC METABOLISM & NUTRITION OF BACTERIA I. General Overview of Microbial Metabolism and Nutritional Requirements.
FARM MICROBIOLOGY 2008 PART 3: BASIC METABOLISM & NUTRITION OF BACTERIA I. General Overview of Microbial Metabolism and Nutritional Requirements. Under the right physical conditions, every microorganism
More informationMicrobiome and Asthma
제 12 차천식연구회 COPD 연구회공동심포지엄 Microbiome and Asthma 한양대학교병원호흡기알레르기내과 김상헌 Disclosure 내용 1 Lung Microbiome 2 Lung Microbiome and Asthma 3 Gut Microbiome and Asthma Microbiome and Microbiota human microbiome
More informationAmino Acid Metabolism: Amino Acid Degradation & Synthesis
Amino Acid Metabolism: Amino Acid Degradation & Synthesis Dr. Diala Abu-Hassan, DDS, PhD Medical students-first semester All images are taken from Lippincott s Biochemistry textbook except where noted
More informationLinking Long-Term Dietary Patterns with Gut Microbial Enterotypes
Linking Long-Term Dietary Patterns with Gut Microbial Enterotypes Gary D. Wu, 1 * Jun Chen, 2,3 Christian Hoffmann, 4,5 Kyle Bittinger, 4 Ying-Yu Chen, 1 Sue A. Keilbaugh, 1 Meenakshi Bewtra, 1,2 Dan Knights,
More informationBiochemistry Vitamins B6 and B12
HbA NH 2 H 2 O 2 KClO3 Cl 2 O 7 PO 4 CH2O NAOH KMnO 4 M E D I C I N E KING SAUD UNIVERSITY Co 2 COOH MgCl 2 H 2 O Important Extra Information Doctors slides Doctors notes SO 2 HCN CCl 4 CuCl 2 SiCl 4 Biochemistry
More informationMicrobiome GI Disorders
Microbiome GI Disorders Prof. Ram Dickman Neurogastroenterology Unit Rabin Medical Center Israel 1 Key Points Our gut microbiota Were to find them? Symbiosis or Why do we need them? Dysbiosis or when things
More informationBeyond the Scope: The Microbiome & The Future of Gastroenterology
Beyond the Scope: The Microbiome & The Future of Gastroenterology Robynne Chutkan, MD, FASGE Digestive Center for Wellness, LLC MedStar Georgetown University Hospital Rapid Identification of Microbes
More informationFolate Challenges Jürgen König, Emerging Focus Nutrigenomics, Department of Nutritional Sciences, University of Vienna
Jürgen König, Emerging Focus Nutrigenomics, Department of Nutritional Sciences, University of Vienna Folate Challenges Dietary Reference Intakes, Average Requirements, Individual Requirements Bioavailability
More informationFigure 1. Stepwise approach of treating patients with rheumatoid arthritis.
Establish diagnosis early Document baseline disease activity and damage Estimate prognosis Initiate therapy Begin patient education Start DMARD therapy within 3 months Consider NSAID Consider local or
More informationMaternal Obesity Is Associated with Alterations in the Gut Microbiome in Toddlers
Maternal Obesity Is Associated with Alterations in the Gut Microbiome in Toddlers Jeffrey D. Galley 1, Michael Bailey 1,2 *, Claire Kamp Dush 3, Sarah Schoppe-Sullivan 3, Lisa M. Christian 2,4,5,6 1 Division
More informationBeyond the Scope: An Integrative Gastroenterologist s Approach to Digestive Disorders
Beyond the Scope: An Integrative Gastroenterologist s Approach to Digestive Disorders Robynne Chutkan, MD, FASGE Digestive Center for Wellness, LLC MedStar Georgetown University Hospital The real voyage
More informationDO SWEETENERS AFFECT THE GUT MICROBIOME?
DO SWEETENERS AFFECT THE GUT MICROBIOME? What does the science and evidence tell us? Alexandra Lobach, M.Sc., Ph.D. Manager, Toxicology, Chemistry & Regulatory Affairs Food & Nutrition Health, Environmental
More informationThe vital role of the microbiome in human health
The vital role of the microbiome in human health abandoning hygiene is not the way to a healthy microbiome Colin Hill APC Microbiome Institute University College Cork @colinhillucc Mixed messages? We live
More informationGut microbiome interactions; implications for human health
Gut microbiome interactions; implications for human health Knut E. A. Lundin, MD, PhD, Ass. Professor, FACP, FEFIM Dept of Gastroenterology, Oslo University Hospital Rikshospitalet Centre for Immune Regulation,
More informationQuestions on Purine and Pyrimidine Metabolism:
Questions on Purine and Pyrimidine Metabolism: 1. Mention the Origin of Carbon and itrogen Atom in Purine Ring. (2) 2. Sources of various atoms of purine ring. (4) 3. Give an account on salvage pathway.
More informationNext generation of probiotics
Session: Evaluating next generation ingredients to support digestive health Wednesday 23 rd November 2016 Next generation of probiotics Louise R Wilson RD PhD Assistant Science Manager, Yakult UK Ltd LWilson@yakult.co.uk
More informationTeacher Resource for: Gut Microbiota from Twins Discordant for Obesity Modulate Metabolism in Mice.
Teacher Resource for: Gut Microbiota from Twins Discordant for Obesity Modulate Metabolism in Mice. Table of Contents: I. GENERAL USE OF Science in the Classroom a. Student Learning Goals (general) b.
More informationEnzymes what are they?
Topic 11 (ch8) Microbial Metabolism Topics Metabolism Energy Pathways Biosynthesis 1 Catabolism Anabolism Enzymes Metabolism 2 Metabolic balancing act Catabolism Enzymes involved in breakdown of complex
More informationMetabolism Energy Pathways Biosynthesis. Catabolism Anabolism Enzymes
Topics Microbial Metabolism Metabolism Energy Pathways Biosynthesis 2 Metabolism Catabolism Catabolism Anabolism Enzymes Breakdown of complex organic molecules in order to extract energy and dform simpler
More informationAmino Acid Catabolism
Amino Acid atabolism 3-1 Lec #8 To date we have considered the catabolism of carbohydrates and lipids with the object of generating energy in the form of ATP. Both give rise to AcoA which is fed through
More informationRegulation of Enzyme Activity
Regulation of Enzyme Activity Enzyme activity must be regulated so that the proper levels of products are produced at all times and places This control occurs in several ways: - biosynthesis at the genetic
More informationMicrobiome analysis: from concept to completion. Matthew Stoll MD,PhD,MSCS January 26, 2015
Microbiome analysis: from concept to completion Matthew Stoll MD,PhD,MSCS January 26, 2015 We re surrounded by bugs Human body contains 100 trillion microbes Out-number human cells 10:1 Human gut alone:
More informationMethylation. Taking the guesswork out of diagnosis. Proper functioning of the methylation cycle helps to reduce the risk of:
Methylation The methylation cycle is a biochemical pathway that manages or contributes to a wide range of crucial bodily functions. Methylation is not just one specific reaction, there are hundreds of
More informationMetabolism. Chapter 8 Microbial Metabolism. Metabolic balancing act. Catabolism Anabolism Enzymes. Topics. Metabolism Energy Pathways Biosynthesis
Chapter 8 Microbial Metabolism Topics Metabolism Energy Pathways Biosynthesis Catabolism Anabolism Enzymes Metabolism 1 2 Metabolic balancing act Catabolism and anabolism simple model Catabolism Enzymes
More informationLecture 17: Nitrogen metabolism 1. Urea cycle detoxification of NH 3 2. Amino acid degradation
Lecture 17: Nitrogen metabolism 1. Urea cycle detoxification of NH 3 2. Amino acid degradation Reference material Biochemistry 4 th edition, Mathews, Van Holde, Appling, Anthony Cahill. Pearson ISBN:978
More informationOverview of the Microbiome in Health and Disease Cindy D. Davis
Overview of the Microbiome in Health and Disease Cindy D. Davis davisci@mail.nih.gov OFFICE OF DIETARY SUPPLEMENTS 1 Outline 1.What is the microbiome? 2.What is the evidence that diet can influence the
More information