Endocrine Physiology

Transcription

1 Endocrine Physiology

2 1. Introduction to Endocrine Principles Endocrine cell Amount of hormone Receptor levels Chemical messenger Target cell Half life of hormones Carrier proteins Metabolism: activation and inactivation Hormones are Chemical messenger with a half life and a target cell

3 There are TWO major groups of hormones Location of Receptor Classes of Hormones Principle Mechanism of Action Cell surface receptors (plasma membrane) Intracellular receptors (cytoplasm and/or nucleus) Proteins and peptides, catecholamines and eicosanoids Steroids and thyroid hormones Generation of second messengers which alter the activity of other molecules - usually enzymes - within the cell Alter transcriptional activity of responsive genes

4 Peptide and protein hormones consist of assemblages of amino acids

5 Peptidic Hormones can be synthesized as larger pre-prohormones 197 AA pre-proprotein. 5 allatostatins (8-11 AA). Aedes aegypti Allatostatin A 1 Mrpsttpmvllsylafvlclacvaygssalgsssgssdqslfgggagggggsasaesdig 61 ddrgqreisqatfqhmlavrspkynfglgkrryiiedvpgrlphynfglgkrarnnll 121 eydddsapswsedyssliprdgldydgdkdksaekrasayryhfglgkrrvydfglgkrv 181 yedkrlpnrynfglgkr Anopheles gambiae 1 Mlalsayvtlslclsvswslpagggtagssssssndldmddlsrdrvsgqgeistsqfqh 61 mlavrspkynfglgkrryiiedvpgrlphynfglgkrgspmggndyeydglmggnqlg 121 wndndytnlitkdgqfdydaekekdaakrtasgngrgsayryhfglgkrraydfglgkry 181 fdaedfnkrlpnrynfglgkr SPKYNFGLG Aedes 1 SPKYNFGLG Anopheles 1 LPHYNFGLG Aedes 2 LPHYNFGLG Anopheles 2 ASAYRYHFGLG Aedes 3 GSAYRYHFGLG Anopheles 3 RVYDFGLG Aedes 4 RAYDFGLG Anopheles 4 LPNRYNFGLG Aedes 5 LPNRYNFGLG Anopheles 5

6 Amine hormones are derived from amino acids Deiodinases Peripheral activation

7 Peptide and protein hormones act through cell membrane receptors Location of Receptor Classes of Hormones Principle Mechanism of Action Cell surface receptors (plasma membrane) Proteins and peptides, catecholamines and eicosanoids Generation of second messengers which alter the activity of other molecules - usually enzymes - within the cell

8 Peptide and protein hormones act through generation of second messengers

9 Steroid hormones are derived from cholesterol mineralocorticoids glucocorticoids

10 Lypophyllic hormones Location of Receptor Classes of Hormones Principle Mechanism of Action Intracellular receptors (cytoplasm and/or nucleus) Steroids and thyroid hormones Alter transcriptional activity of responsive genes Delay of response

11 Activation of transcription Mechanism of action of Steroid hormones

12 General transcription machinery 1. Direct interaction with DNA elements 2. Cross-talk with another DNA-bound transcription factors 3. Interaction with both DNA elements and others TFs

13 Lypophyllic hormones Phosphoenolpyruvate carboxykinase

14 2. Synthesis, Storage, and Release of Hormones Snapshots of insulin synthesis, processing, and packaging Pre-prohormone

15 3. Types of Endocrine glands and cells

16 4. Control of Endocrine Systems TRH TSH AXIS: One endocrine gland acting on another endocrine gland

17 The vertebrate pituitary gland AXIS: One endocrine gland acting on another endocrine gland Neurohypophysis. Adenohypophysis. Neurosecretory cells Portal system endocrine cells Neural control of neurosecretory cells Action potential --- release hormones Neurosecretory control of endocrine cells Release factors --- synthesize hormones.

18 The vertebrate pituitary gland Adenohypophysis. Melanocyte-stimulating synthesize hormones. Thyroid -stimulating Adrenocorticotropic Effects on endocrine glands. Tropins: support and maintain tissues, regulates activity Luteinizing Follicule-Stim Effects on nonendocrine glands.

19 The vertebrate pituitary gland Neurohypophysis. release hormones Antidiuretic hormone (urine production) Oxytocin (uterus contraction and milk ejection)

20 Both hormonal and neural mechanisms modulate the action of the HPA (Hypot-pituit-adrenal) axis Axis: one endocrine gland (EG) modulating another EG HPA axis CNS Corticotropin releasing adenocorticotropin

21 There is synergism and antagonism among hormones Amplify effect opposite effect

22 The mammalian stress response includes two phases Stress response: respond to a threatening situation + adrenaline + Corticotropin releasing adenocorticotropin Stop Feeding Stop reproduction Increase circulation Increase breathing Increase metabolism Increase activity CNS

23 The mammalian stress response and blood losses Wound and blood loss : blood volume and blood pressure Adrenaline: + Heart and blood pressure

24 The CNS and the immune system interact during the stress response Cytokines Stress helps to fight infection. neuroimmunomodulation Reduces inflammation and modulate immune response.

25 Endocrine control of salt and Water Balance Anti diuretic hormone (Vasopressin) regulates the balance of water Aquaporin-2 is regulated. Aquaporin-3 is constitutive.

26 The renin angiotensin aldosterone system Aldosterone stimulates the conservation of sodium Sodium pumps and channels Angiotensinogen : large protein Angiotensin I : 10 AA Angiotensin II : 8 AA

27 Endocrine & neuroendocrine structures involved in control of insect reproduction and metamorphosis 3 tissues 2 hormones

28 Endocrine control of insect metamorphosis