Drug designing and validation studies on human asthma disease gene NPSR1 using Cheminformatics tools

Size: px
Start display at page:

Download "Drug designing and validation studies on human asthma disease gene NPSR1 using Cheminformatics tools"

Transcription

1 Available online at wwwijntpsorg ISSN: INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES Drug designing and validation studies on human asthma disease gene NPSR1 using Cheminformatics tools RESEARCH ARTICLE Cardilya Grace C *, Hepzibah W and John William S Department of Advanced Zoology and Biotechnology, (SECNARM), Loyola College, Chennai-34 Tamil Nadu Article Info Article history Received 15 May 2012 Revised 18 May 2012 Accepted 14 Jun 2012 Available online 30 Jun 2012 Keywords Protein Modeling, Drug Designing, Drug Docking, Clinical immunology, Pharmacoinformatics Abstract Asthma is defined by the Global Initiative for Asthma as a chronic inflammatory disorder of the airways in which many cells and cellular elements play a role The chronic inflammation is associated with airway hyper responsiveness that leads to recurrent episodes of wheezing, breathlessness, chest tightness and coughing particularly at night or in the early morning These episodes are usually associated with widespread, but variable airflow obstruction within the lung that is often reversible either spontaneously or with treatment" The primary aim of this study is to identify the mutational gene responsible for asthma and the potential drug candidate for the target We finally conclude that the designed drug candidates would prove to be useful for patients affected by chronic inflammatory disease and general inflammatory disease This work would be great use in the field of Clinical immunology and Pharmacoinformatics INTRODUCTION As of 2009, 300 million people worldwide were affected by asthma leading to approximately 250,000 deaths per year [1-4] It is estimated that asthma has a 7-10% prevalence worldwide [5] As of 1998, there was a great disparity in the prevalence of asthma across the world, with a trend toward more developed and westernized countries having higher rates of asthma, [6] with as high as a 20 to 60- fold difference Westernization however does not explain the entire difference in asthma prevalence between countries, and the disparities may also be affected by differences in genetic, social and environmental risk factors [61] Mortality however is most common in low to middle income countries, [7] while symptoms were most prevalent (as much as 20%) in the United Kingdom, Australia, New Zealand, and Republic of Ireland; they were lowest (as low as 2 3%) in Eastern Europe, Indonesia, Greece, Uzbekistan, India, and Ethiopia [8] Asthma affects approximately 7% of the population of the United States [9] and 5% of people in the United Kingdom [10] Asthma causes 4,210 deaths per year in the United States [11][12] In 2005 in the United States asthma affected more than 22 million people including 6 million children [13] It accounted for nearly 1/2 million hospitalizations that same year [14] More boys have asthma than girls, but more women have it than men [15] In England, an estimated 261,400 people were newly diagnosed with asthma in 2005; 57 million people had an asthma diagnosis and were prescribed 326 million asthma-related prescriptions Aim and objectives To find out the mutational genes involved in Human Asthma disease To model the 3D structure and identify the potential drug candidates using Cheminformatics protocols Methodology Tools and database are used: NCBI, BLAST, Ensembl genome browser, CPH server, Chemaxon,Patchdock server, Discovery studio software, Molegro molecular viewer Sequence Retrieval System: The potential gene candidate (NPSR1) was retrieved from NCBI protein database and converted into FASTA format Molecular Modeling: The retrieved protein is applied into CPH 30 server (Advanced Protein modeling server) in order to predict the three dimensional structure and the predicted structure was viewed using RASMOL, MOLSOFT, MOLEGRO MOLECULAR VIEWER and DISCOVERY STUDIO SOFTWARE To whom correspondence should be addressed: Cardilya Grace C address: cardilya@gmailcom VOLUME 2 NUMBER 2 JUN

2 Cheminformatics: Drug Designing and Development: Ligand selection: The suitable chemical compound was identified using NCBI Pubchem compound database The combination and modification of ligand was done using Molinspiration software Molecular Docking: The molecular docking studies were performed using PATCH DOCK server in order to predict the Binding affinities of the de novo ligand and Asthma protein receptors Results Table: 1 NCBI gene database and OMIM Gene name NPSR1 Protein product Neuropeptide S receptor 1 Chr loc Summary 7 This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma Mutations in this gene have also been associated with this disease Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized Protein modeling: Nucleotide Sequence (1116 nt): ATGCCAGCCAACTTCACAGAGGGCAGCTTCGATTCCAGTGGGACCGGGCAGACGCTGGATTCTTCCCCAGTG GCTTGCACTGAAACAGTGACTTTTACTGAAGTGGTGGAAGGAAAGGAATGGGGTTCCTTCTACTACTCCTTTA AGACTGAGCAATTGATAACTCTGTGGGTCCTCTTTGTTTTTACCATTGTTGGAAACTCCGTTGTGCTTTTTTCCA CATGGAGGAGAAAGAAGAAGTCAAGAATGACCTTCTTTGTGACTCAGCTGGCCATCACAGATTCTTTCACAG GACTGGTCAACATCTTGACAGATATTAATTGGCGATTCACTGGAGACTTCACGGCACCTGACCTGGTTTGCCG AGTGGTCCGCTATTTGCAGGTTGTGCTGCTCTACGCCTCTACCTACGTCCTGGTGTCCCTCAGCATAGACAGA TACCATGCCATCGTCTACCCCATGAAGTTCCTTCAAGGAGAAAAGCAAGCCAGGGTCCTCATTGTGATCGCCT GGAGCCTGTCTTTTCTGTTCTCCATTCCCACCCTGATCATATTTGGGAAGAGGACACTGTCCAACGGTGAAGT GCAGTGCTGGGCCCTGTGGCCTGACGACTCCTACTGGACCCCATACATGACCATCGTGGCCTTCCTGGTGTA CTTCATCCCTCTGACAATCATCAGCATCATGTATGGCATTGTGATCCGAACTATTTGGATTAAAAGCAAAACCT ACGAAACAGTGATTTCCAACTGCTCAGATGGGAAACTGTGCAGCAGCTATAACCGAGGACTCATCTCAAAGG CAAAAATCAAGGCTATCAAGTATAGCATCATCATCATTCTTGCCTTCATCTGCTGTTGGAGTCCATACTTCCTG TTTGACATTTTGGACAATTTCAACCTCCTTCCAGACACCCAGGAGCGTTTCTATGCCTCTGTGATCATTCAGAA CCTGCCAGCATTGAATAGTGCCATCAACCCCCTCATCTACTGTGTCTTCAGCAGCTCCATCTCTTTCCCCTGCA GGGAGCAAAGATCACAGGATTCCAGAATGACGTTCCGGGAGAGAACTGAGAGGCATGAGATGCAGATTCTG TCCAAGCCAGAATTCATCTAG Translation (371 aa): MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVVLFSTWRR KKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMK FLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTI WIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPA LNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI 70 VOLUME 2 NUMBER 2 JUN 2012

3 Figure: 1Protein modeling- Discovery studio software 3 D structure of NPSR1 protein Solid ribbon The above picture shows the secondary structure of NPSR1 protein and red indicates helix, Blue indicates sheets, green indicates turns and white indicates the coils regions present in the target Figure: 2Protein modeling- Discovery studio software 3 D structure of NPSR1 protein CPK model VOLUME 2 NUMBER 2 JUN

4 Red Oxygen, White Hydrogen, Grey Carbon, Blue Nitrogen and Yellow Sulphur Figure: 22Cheminformatics Drug designing and development SMILES Epinephrine - Compound Summary (CID 5816) CNCC(C1=CC(=C(C=C1)O)O)O Aspirin - Compound Summary (CID 2244) CC(=O)OC1=CC=CC=C1C(=O)O Hydrogen 2-acetylphenyl 2-(3,4-dihydroxyphenyl)-3-(methylamino)propyl carbonate Figure: 23 MOLINSPIRATION SOFTWARE Calculation of Molecular Properties of de novo ligand Figure: 3 Protein modeling- Discovery studio software 3 D structure of NPSR1 protein Stick model with labels 72 VOLUME 2 NUMBER 2 JUN 2012

5 Red Oxygen, White Hydrogen, Grey Carbon and Blue Nitrogen Figure: 4 Molecular Docking : Patch Dock Results Binding affinities of NPSR1 and Epinephrine (-16322) Figure: 4 1Molecular Docking: Patch Dock Results Binding affinities of NPSR1 and Epinephrine + Aspirin (De Novo) ( ) VOLUME 2 NUMBER 2 JUN

6 Figure: 5Drug Docking - Discovery studio software NPSR1 protein and Epinephrine Ligand protein complex: line model NPSR1 protein and green Stick model Epinephrine Figure: 6Drug Designing - Discovery studio software 3D structure of De novo Ligand Epinephrine and Aspirin in Ball and Stick model with labels 74 VOLUME 2 NUMBER 2 JUN 2012

7 Figure: 7Drug Docking - Discovery studio software NPSR1 protein and Epinephrine +Aspirin Protein surface (yellow) and Ligand Stick model (green) Figure: 8 Drug Docking Molegro molecular viewer software NPSR1 protein and Epinephrine + Aspirin Protein secondary structure view and Ligand spacefill model (green) VOLUME 2 NUMBER 2 JUN

8 Table: 2Molecular Drug Docking Studies NPSR1 Epinephrine 3D 3D docking Epinephrine + Aspirin De novo drug 3D 3D docking Discussion The present investigation focuses on leading human ASTHMA diseases The mutation gene was identified using NCBI gene database and OMIM (Table: 1) The identified gene coded protein sequences were retrieved from NCBI protein database The selected protein sequences are converted into FASTA format in order to predict the protein structural analysis and docking studies The protein structure prediction remains an extremely difficult and unresolved undertaking The two main problems are calculation of protein free energy and finding the global minimum of this energy A protein structure prediction method must explore the space of possible protein structures which is astronomically large These problems can be partially bypassed in "comparative" or homology modeling and fold recognition methods, in which the search space is pruned by the assumption that the protein in question adopts a structure that is close to the experimentally determined structure of another homologous protein On the other hand, the de novo or ab initio protein structure prediction methods must explicitly resolve these problems The 3 D prediction of target protein NPSR1 can be done using CPH 30 server The submitted protein sequences are automatically converted into 3D structures and best models are downloaded and viewed with help of molecular visualization tools Figure ( 1 and 2) shows the 3D structure of the target cancer proteins Pubchem is a database of chemical molecules and their activities against biological assays The system is maintained by the National Center for Biotechnology Information (NCBI), a component of the National Library of Medicine, which is part of the United States National Institutes of Health (NIH) Using Pubchem compound databases the ligand 1 (Epinephrine) and ligand 2 (Aspirin) are collected (Figure: 3 and 6) Molinspiration offers broad range of cheminformatics software tools supporting molecule manipulation and processing, including SMILES and SDfile conversion, normalization of molecules, generation of tautomers, molecule fragmentation, calculation of various molecular properties needed in QSAR, molecular modelling and drug design, high quality molecule depiction, molecular database tools supporting substructure and similarity searches (Figure: 22 and 23 ) Docking is frequently used to predict the binding orientation of small molecule drug candidates to their protein targets in order to predict the affinity and activity of the small molecule Hence docking plays an important role in the rational design of drugs Given the biological and pharmaceutical significance of molecular docking, considerable efforts have been directed towards improving the methods used to predict docking PatchDock algorithm is inspired by object recognition and image segmentation techniques used in Computer Vision Docking can be compared to assembling a jigsaw puzzle When solving the puzzle we try to match two pieces by picking one piece and searching for the complementary one We concentrate on the patterns that are unique for the puzzle element and look for the matching patterns in the rest of the pieces PatchDock employs a similar technique Given two molecules, their surfaces are divided into patches according to the surface shape These patches correspond to patterns that visually distinguish between puzzle pieces Once the patches are identified, they can be superimposed using shape matching algorithms Filtering and Scoring - the candidate complexes from the previous step are examined We discard all complexes with unacceptable penetrations of the atoms of the receptor to the atoms of the ligand Finally, the remaining candidates are ranked according to a geometric shape complementarity score Figure (5, 7 and 8) represents the ligand receptor complex form, Table : 2 shows the Patch dock results Conclusion Computer-assisted drug design uses computational chemistry to discover, enhance, or study drugs and related biologically active molecules The most fundamental goal is to predict whether a given molecule will bind to a target and if so how strongly Molecular mechanics or molecular dynamics are most often used to predict the conformation of the small molecule and to model conformational 76 VOLUME 2 NUMBER 2 JUN 2012

9 changes in the biological target that may occur when the small molecule binds to it There are two major findings in this research investigation The first finding is that the potential protein target was identified in different cancers and, the second finding is that the best drug candidate was identified Ligand 1 (Epinephrine) has anti asthma properties and 2 (Aspirin) has anti inflammatory property We conclude that designed de novo drug candidate rapidly reduces the effect of asthma and inflammatory Finally, we conclude that these two ligands are combined and designed which form potential inhibitors of Asthma and inflammatory diseases References 1 GINA 2009; 2 2 Fanta, CH "Asthma" New England Journal of Medicine 2009; 360 (10): DOI:101056/NEJMra PMID "World Health Organization Fact Sheet Fact sheet No 307: Asthma" 2009 Retrieved Braman SS The global burden of asthma Chest 2006; 130: 4S 12S DOI:101378/chest1301_suppl4SPMID Lazarus SC "Clinical practice Emergency treatment of asthma" N Engl J Med 2010; 363(8): DOI:101056/NEJMcp PMID "Worldwide variation in prevalence of symptoms of asthma, allergic rhino conjunctivitis, and atopic eczema: ISAAC The International Study of Asthma and Allergies in Childhood (ISAAC) Steering Committee" Lancet 351 (9111): 1998; DOI:101016/S (97) Gold, DR, Wright R "Population disparities in asthma" Annul Rev Public Health 2005; 26: 89 13DOI:101146/annurevpublhealth PMID World Health Organization "WHO: Asthma" Archived from the original on 15 December 2007 Retrieved Worldwide variation in prevalence of symptoms of asthma, allergic rhino conjunctivitis, and atopic eczema: ISAAC The International Study of Asthma and Allergies in Childhood (ISAAC) Steering Committee" Lancet 351 (9111): April 1998 DOI:101016/S (97) PMID Anderson, HR; Gupta R, Strachan DP, Limb ES "50 years of asthma: UK trends from 1955 to 2004"Thorax 2007; 62 (1): DOI:101136/thx PMC PMID Lazarus SC "Clinical practice Emergency treatment of asthma" N Engl J Med 2010; 363(8): DOI:101056/NEJMcp Getahun D, Demissie K, Rhoads GG "Recent trends in asthma hospitalization and mortality in the United States"Journal of asthma 2005; 42(5): DOI:101081/JAS NHLBI Guideline 2007; 1 14 Hayden, Merrill "Asthma Guide" Simpson CR, Sheikh A "Trends in the epidemiology of asthma in England: a national study of 333,294 patients" J R Soc Med 2010; 103(3): DOI:101258/jrsm PMID VOLUME 2 NUMBER 2 JUN

Molecular modelling and insilico drug docking studies on breast cancer target protein (TNRC9) using cheminformatics software and tools

Molecular modelling and insilico drug docking studies on breast cancer target protein (TNRC9) using cheminformatics software and tools Available online at www.ijntps.org ISSN: 2277 2782 INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES Molecular modelling and insilico drug docking studies on breast cancer target protein

More information

Comparative Docking Studies on Neurological and Psychological disorders Genes (BDNF and CLCN2) using Cheminformatics Protocols.

Comparative Docking Studies on Neurological and Psychological disorders Genes (BDNF and CLCN2) using Cheminformatics Protocols. Available online at www.ijntps.org ISSN: 2277 2782 INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES RESEARCH ARTICLE Comparative Docking Studies on Neurological and Psychological disorders

More information

Identification of potential ligand molecule and drug docking studies on autoimmune thyroid disease (Human) using chem informatics techniques

Identification of potential ligand molecule and drug docking studies on autoimmune thyroid disease (Human) using chem informatics techniques Available online at www.ijntps.org ISSN: 2277 2782 INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES Identification of potential ligand molecule and drug docking studies on autoimmune thyroid

More information

What is Asthma? Chronic disease of the airways that may cause Wheezing Breathlessness Chest tightness Night time or early morning coughing

What is Asthma? Chronic disease of the airways that may cause Wheezing Breathlessness Chest tightness Night time or early morning coughing Asthma What is Asthma? Chronic disease of the airways that may cause Wheezing Breathlessness Chest tightness Night time or early morning coughing Episodes are usually associated with widespread, but

More information

THE NHLBI GUIDELINES: WHERE DO WE STAND AND WHAT IS THE NEW DIRECTION FROM THE NAEPP?

THE NHLBI GUIDELINES: WHERE DO WE STAND AND WHAT IS THE NEW DIRECTION FROM THE NAEPP? THE NHLBI GUIDELINES: WHERE DO WE STAND AND WHAT IS THE NEW DIRECTION FROM THE NAEPP? Peter S. Creticos, MD ABSTRACT In 1991 and 1997, the National Heart, Lung, and Blood Institute s National Asthma Education

More information

Identification of single de novo drug candidate for dengue and filaria on Aedes aegypti and Culex quinquefasciatus mosquitoes using insilico Protocols

Identification of single de novo drug candidate for dengue and filaria on Aedes aegypti and Culex quinquefasciatus mosquitoes using insilico Protocols Available online at www.ijntps.org ISSN: 2277 2782 INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES RESEARCH ARTICLE Identification of single de novo drug candidate for dengue and filaria

More information

Systems Pharmacology Respiratory Pharmacology. Lecture series : General outline

Systems Pharmacology Respiratory Pharmacology. Lecture series : General outline Systems Pharmacology 3320 2017 Respiratory Pharmacology Associate Professor Peter Henry (Rm 1.34) Peter.Henry@uwa.edu.au Division of Pharmacology, School of Biomedical Sciences Lecture series : General

More information

ADULT ASTHMA GUIDE SUMMARY. This summary provides busy health professionals with key guidance for assessing and treating adult asthma.

ADULT ASTHMA GUIDE SUMMARY. This summary provides busy health professionals with key guidance for assessing and treating adult asthma. ADULT ASTHMA GUIDE SUMMARY This summary provides busy health professionals with key guidance for assessing and treating adult asthma. Its source document Asthma and Respiratory Foundation NZ Adult Asthma

More information

Respiratory diseases in Ostrołęka County

Respiratory diseases in Ostrołęka County Respiratory diseases in Ostrołęka County 4400 persons underwent examination 950 persons were given referrals to more detailed investigation 600 persons were examined so far The results of more detailed

More information

Diagnosis and Management of Asthma in Children based on the British Thoracic Society and Scottish Intercollegiate Guidelines Network September 2016

Diagnosis and Management of Asthma in Children based on the British Thoracic Society and Scottish Intercollegiate Guidelines Network September 2016 Diagnosis and Management of Asthma in Children based on the British Thoracic Society and Scottish Intercollegiate Guidelines Network September 2016 Diagnosis: There is no lower limit to the age at which

More information

Computer Aided Docking Studies on Anticancer Drugs for Breast Cancer

Computer Aided Docking Studies on Anticancer Drugs for Breast Cancer International Journal of Information & Computation Technology. ISSN 0974-2239 Volume 2, Number 1 (2012), pp. 49-55 International Research Publications House http://www. ripublication.com Computer Aided

More information

Food allergy in children. nice bulletin. NICE Bulletin Food Allergy in Chlidren.indd 1

Food allergy in children. nice bulletin. NICE Bulletin Food Allergy in Chlidren.indd 1 nice bulletin Food allergy in children NICE provided the content for this booklet which is independent of any company or product advertised NICE Bulletin Food Allergy in Chlidren.indd 1 23/01/2012 11:04

More information

Asthma: a major pediatric health issue Rosalind L Smyth

Asthma: a major pediatric health issue Rosalind L Smyth Asthma: a major pediatric health issue Rosalind L Smyth University of Liverpool, Institute of Child Health, Alder Hey Children s Hospital, Liverpool L12 2AP, UK Corresponding author: Rosalind L Smyth (e-mail:

More information

Who Is at Risk for Asthma? Who develope asthma?

Who Is at Risk for Asthma? Who develope asthma? Keya Ghosh What is Asthma? Disease that inflames and narrows the airways. Asthma causes recurring periods of wheezing (a whistling sound when you breathe), chest tightness, shortness of breath, and coughing.

More information

Body mass index, allergic rhinitis and asthma in children

Body mass index, allergic rhinitis and asthma in children Original Articles Body mass index, allergic rhinitis and asthma in children M A M Fernando 1, P H R S Senathilake 2, B J C Perera 3 Sri Lanka Journal of Child Health, 2004; 33: 102-5 (Key words: Body mass

More information

Play acting Asthma attack

Play acting Asthma attack 1 ASTHMA Date: 16/10/06 By: ismile Health Info Inforeach Communications Sdn Bhd. Tel: 03-42946368 You cough, wheeze and feel tightness in your chest. Suddenly, your airways narrow and you gasp for breath.

More information

Health professionals. 8Asthma. and Wheezing in the First Years of Life. A guide for health professionals

Health professionals. 8Asthma. and Wheezing in the First Years of Life. A guide for health professionals Health professionals 8Asthma and Wheezing in the First Years of Life A guide for health professionals Asthma and Wheezing in the First Years of Life An information paper for health professionals The aim

More information

Asthma Disparities: A Global View

Asthma Disparities: A Global View Asthma Disparities: A Global View Professor Innes Asher Department of Paediatrics: Child and Youth Health, The University of Auckland, Auckland, New Zealand. mi.asher@auckland.ac.nz Invited lecture, Scientific

More information

Study of dynamic lung parameters in bronchial Asthma

Study of dynamic lung parameters in bronchial Asthma 20; 4(1): 312-317 ISSN Print: 2394-7500 ISSN Online: 2394-5869 Impact Factor: 5.2 IJAR 20; 4(1): 312-317 www.allresearchjournal.com Received: 20-11-2017 Accepted: 21-12-2017 Dr. Madhuchhanda Pattnaik Associate

More information

RESEARCH ARTICLE. M. P Nithya, 1* T. Radha 1 and M. Balaji 2

RESEARCH ARTICLE. M. P Nithya, 1* T. Radha 1 and M. Balaji 2 Available online at www.ijntps.org ISSN: 2277 2782 INTERNATIONAL JOURNAL OF NOVEL TRENDS IN PHARMACEUTICAL SCIENCES Study of In Silico Drug Docking for Tegumental H17G Protein and Oncosphere TSO45-2A Protein

More information

Trends in the prevalence of Beijing children s asthma and allergies over 20 years

Trends in the prevalence of Beijing children s asthma and allergies over 20 years Trends in the prevalence of Beijing children s asthma and allergies over 20 years Fang Qu 1, Yinping Zhang 1*, Jan Sundell 1 1 Institute of Built Environment, Department of Building Science, Tsinghua University,

More information

Connecting Health & Housing: Asthma and the Home. Presented by: The California-Nevada Public Health Training Center

Connecting Health & Housing: Asthma and the Home. Presented by: The California-Nevada Public Health Training Center Connecting Health & Housing: Asthma and the Home Presented by: The California-Nevada Public Health Training Center Funded by Grant #UB6HP20202 from the Health Resources and Services Administration, U.S.

More information

Allergy and Immunology Review Corner: Chapter 75 of Middleton s Allergy Principles and Practice, 7 th Edition, edited by N. Franklin Adkinson, et al.

Allergy and Immunology Review Corner: Chapter 75 of Middleton s Allergy Principles and Practice, 7 th Edition, edited by N. Franklin Adkinson, et al. Allergy and Immunology Review Corner: Chapter 75 of Middleton s Allergy Principles and Practice, 7 th Edition, edited by N. Franklin Adkinson, et al. Chapter 75: Approach to Infants and Children with Asthma

More information

Does rhinitis. lead to asthma? Does sneezing lead to wheezing? What allergic patients should know about the link between allergic rhinitis and asthma

Does rhinitis. lead to asthma? Does sneezing lead to wheezing? What allergic patients should know about the link between allergic rhinitis and asthma Does rhinitis lead to asthma? Does sneezing lead to wheezing? What allergic patients should know about the link between allergic rhinitis and asthma For a better management of allergies in Europe Allergy

More information

Pathology of Asthma Epidemiology

Pathology of Asthma Epidemiology Asthma A Presentation on Asthma Management and Prevention What Is Asthma? A chronic disease of the airways that may cause Wheezing Breathlessness Chest tightness Nighttime or early morning coughing Pathology

More information

Prince Edward Island Asthma Trends

Prince Edward Island Asthma Trends Prince Edward Island Asthma Trends 2001-2011 November 2014 Population Health Assessment and Surveillance Unit, Chief Public Health Office, Department of Health and Wellness Dr. Carol McClure, Chronic Disease

More information

ASTHMA-COPD OVERLAP SYNDROME 2018: What s All the Fuss?

ASTHMA-COPD OVERLAP SYNDROME 2018: What s All the Fuss? ASTHMA-COPD OVERLAP SYNDROME 2018: What s All the Fuss? Randall W. Brown, MD MPH AE-C Association of Asthma Educators Annual Conference July 20, 2018 Phoenix, Arizona FACULTY/DISCLOSURES Randall Brown,

More information

Journal of Chemical and Pharmaceutical Research, 2015, 7(12): Research Article

Journal of Chemical and Pharmaceutical Research, 2015, 7(12): Research Article Available online www.jocpr.com Journal of Chemical and Pharmaceutical Research, 2015, 7(12):1082-1086 Research Article ISSN : 0975-7384 CODEN(USA) : JCPRC5 Determination of three dimensional structure

More information

Medicine Dr. Kawa Lecture 1 Asthma Obstructive & Restrictive Pulmonary Diseases Obstructive Pulmonary Disease Indicate obstruction to flow of air

Medicine Dr. Kawa Lecture 1 Asthma Obstructive & Restrictive Pulmonary Diseases Obstructive Pulmonary Disease Indicate obstruction to flow of air Medicine Dr. Kawa Lecture 1 Asthma Obstructive & Restrictive Pulmonary Diseases Obstructive Pulmonary Disease Indicate obstruction to flow of air through the airways. As asthma, COPD ( chronic bronchitis

More information

A llergic disorders are common and represent an important

A llergic disorders are common and represent an important Thorax tx38844 Module 1 11/8/06 15:15:19 Topics: 196 Thorax Online First, published on September 1, 2006 as 10.1136/thx.2004.038844 1 EPIDEMIOLOGY Time trends in allergic disorders in the UK R Gupta, A

More information

COPD, Asthma, Or Something In Between? Sharon R. Rosenberg Assistant Professor of Medicine Northwestern University December 4, 2013

COPD, Asthma, Or Something In Between? Sharon R. Rosenberg Assistant Professor of Medicine Northwestern University December 4, 2013 COPD, Asthma, Or Something In Between? Sharon R. Rosenberg Assistant Professor of Medicine Northwestern University December 4, 2013 None Disclosures Definitions Asthma Asthma is a chronic inflammatory

More information

A llergic disorders are common and represent an important

A llergic disorders are common and represent an important 91 REVIEW Time trends in allergic disorders in the UK R Gupta, A Sheikh, D P Strachan, H R Anderson... See end of article for authors affiliations... Correspondence to: Ms R Gupta, Division of Community

More information

Molecular Docking Studies of Flavonoids of Noni Fruit (Morinda citrifolia L.) to Peroxisome Proliferator-Activated Receptor-Gamma (PPARγ)

Molecular Docking Studies of Flavonoids of Noni Fruit (Morinda citrifolia L.) to Peroxisome Proliferator-Activated Receptor-Gamma (PPARγ) 3rd International Conference on Computation for Science and Technology (ICCST-3) Molecular Docking Studies of Flavonoids of Noni Fruit (Morinda citrifolia L.) to Peroxisome Proliferator-Activated Receptor-Gamma

More information

Life-long asthma and its relationship to COPD. Stephen T Holgate School of Medicine University of Southampton

Life-long asthma and its relationship to COPD. Stephen T Holgate School of Medicine University of Southampton Life-long asthma and its relationship to COPD Stephen T Holgate School of Medicine University of Southampton Definitions COPD is a preventable and treatable disease with some significant extrapulmonary

More information

The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve

The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve The Deciphering Development Disorders (DDD) project: What a genomic approach can achieve RCP ADVANCED MEDICINE, LONDON FEB 5 TH 2018 HELEN FIRTH DM FRCP DCH, SANGER INSTITUTE 3,000,000,000 bases in each

More information

The Asthma Guidelines: Diagnosis and Assessment of Asthma

The Asthma Guidelines: Diagnosis and Assessment of Asthma The Asthma Guidelines: Diagnosis and Assessment of Asthma Christopher H. Fanta, M.D. Partners Asthma Center Brigham and Women s Hospital Harvard Medical School Objectives Know how the diagnosis of asthma

More information

Identification of mirnas in Eucalyptus globulus Plant by Computational Methods

Identification of mirnas in Eucalyptus globulus Plant by Computational Methods International Journal of Pharmaceutical Science Invention ISSN (Online): 2319 6718, ISSN (Print): 2319 670X Volume 2 Issue 5 May 2013 PP.70-74 Identification of mirnas in Eucalyptus globulus Plant by Computational

More information

Omalizumab (Xolair ) ( Genentech, Inc., Novartis Pharmaceuticals Corp.) September Indication

Omalizumab (Xolair ) ( Genentech, Inc., Novartis Pharmaceuticals Corp.) September Indication ( Genentech, Inc., Novartis Pharmaceuticals Corp.) September 2003 Indication The FDA recently approved Omalizumab on June 20, 2003 for adults and adolescents (12 years of age and above) with moderate to

More information

Asthma. Jill Waldron Respiratory Specialist Nurse

Asthma. Jill Waldron Respiratory Specialist Nurse Asthma Jill Waldron Respiratory Specialist Nurse Asthma morbidity 15 20% of children In a class of c30 children likely to be 4-54 children with asthma In infancy more common in boys but becomes more common

More information

Asthma COPD Overlap (ACO)

Asthma COPD Overlap (ACO) Asthma COPD Overlap (ACO) Dr Thomas Brown Consultant Respiratory Physician Thomas.Brown@porthosp.nhs.uk Dr Hitasha Rupani Consultant Respiratory Physician Hitasha.rupani@porthosp.nhs.uk What is Asthma

More information

Asthma. - A chronic inflammatory disorder which causes recurrent episodes of wheezing, breathlessness, cough and chest tightness.

Asthma. - A chronic inflammatory disorder which causes recurrent episodes of wheezing, breathlessness, cough and chest tightness. Obstructive diseases Asthma - A chronic inflammatory disorder which causes recurrent episodes of wheezing, breathlessness, cough and chest tightness. - Characterized by Intermittent and reversible (the

More information

RESPIRATORY CARE IN GENERAL PRACTICE

RESPIRATORY CARE IN GENERAL PRACTICE RESPIRATORY CARE IN GENERAL PRACTICE Definitions of Asthma and COPD Asthma is due to inflammation of the air passages in the lungs and affects the sensitivity of the nerve endings in the airways so they

More information

COPYRIGHTED MATERIAL. Definition and Pathology CHAPTER 1. John Rees

COPYRIGHTED MATERIAL. Definition and Pathology CHAPTER 1. John Rees CHAPTER 1 Definition and Pathology John Rees Sherman Education Centre, Guy s Hospital, London, UK OVERVIEW Asthma is an overall descriptive term but there are a number of more or less distinct phenotypes

More information

Asthma in Children with Sickle Cell Disease

Asthma in Children with Sickle Cell Disease December 18, 2018 Asthma in Children with Sickle Cell Disease Robyn Cohen, MD, MPH Director, Division of Pediatric Pulmonology and Allergy Associate Professor of Pediatrics Boston University/Boston Medical

More information

Pathway diagrams Annex F

Pathway diagrams Annex F Pathway diagrams Annex F Fig 1 Asthma: The patient journey Asthma is diagnosed Making the diagnosis of asthma Confirming the diagnosis may depend on history, response to treatment, measurement of airflow

More information

Cases of Asthma Among Under-Five in Two Selected Hospitals in South-Southern Nigeria

Cases of Asthma Among Under-Five in Two Selected Hospitals in South-Southern Nigeria Health Sciences Research 2015; 2(3): 14-18 Published online July 10, 2015 (http://www.aascit.org/journal/hsr) ISSN: 2375-379X Cases of Asthma Among Under-Five in Two Selected Hospitals in South-Southern

More information

Presented by the California Academy of Family Physicians 2013/California Academy of Family Physicians

Presented by the California Academy of Family Physicians 2013/California Academy of Family Physicians Family Medicine and Patient-Centered Asthma Care Presented by the California Academy of Family Physicians Faculty: Hobart Lee, MD Disclosures: Jeffrey Luther, MD, Program Director, Memorial Family Medicine

More information

Diagnosis, Treatment and Management of Asthma

Diagnosis, Treatment and Management of Asthma Diagnosis, Treatment and Management of Asthma Asthma is a complex disorder characterized by variable and recurring symptoms, airflow obstruction, bronchial hyperresponsiveness, and an underlying inflammation.

More information

Available on the Prince Edward Island Department of Health and Wellness Website:

Available on the Prince Edward Island Department of Health and Wellness Website: September 2011 Chief Public Health Office Epidemiology Unit Available on the Prince Edward Island Department of Health and Wellness Website: www.gov.pe.ca/health Key Messages Key Messages The proportion

More information

Speaker Disclosure. Identification and Diagnosis of Asthma. Definition of Asthma. Objectives 11/9/2017

Speaker Disclosure. Identification and Diagnosis of Asthma. Definition of Asthma. Objectives 11/9/2017 Speaker Disclosure Identification and Diagnosis of Asthma Isabel L. Virella Lowell, MD, Associate Professor, Pulmonology and Sleep Medicine, University of Alabama at Birmingham Isabel Virella-Lowell, MD

More information

Diet, Obesity and Asthma: evidence based advice on healthy eating for asthma A/Prof Lisa Wood

Diet, Obesity and Asthma: evidence based advice on healthy eating for asthma A/Prof Lisa Wood Diet, Obesity and Asthma: evidence based advice on healthy eating for asthma A/Prof Lisa Wood Centre for Asthma and Respiratory Disease University of Newcastle and Hunter Medical Research Institute NSW

More information

Supplementary Appendix

Supplementary Appendix Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Bisgaard H, Hermansen MN, Buchvald F, et al. Childhood asthma

More information

Neuraminidase and hamagglutinin were found to be the molecular targets in swine flu. Studies of these proteins were

Neuraminidase and hamagglutinin were found to be the molecular targets in swine flu. Studies of these proteins were Available Online through ISSN: 0975-766X CODEN: IJPTFI Research Article www.ijptonline.com ANALYSIS OF ANTI-VIRAL COMPOUNDS ON THE PROTEIN MOLECULES WHICH CAUSE SWINE FLU OF H1N1 SUBTYPE Jayalakshmi. T*

More information

Evolution of asthma from childhood. Carlos Nunes Center of Allergy and Immunology of Algarve, PT

Evolution of asthma from childhood. Carlos Nunes Center of Allergy and Immunology of Algarve, PT Evolution of asthma from childhood Carlos Nunes Center of Allergy and Immunology of Algarve, PT allergy@mail.telepac.pt Questionnaire data Symptoms occurring once or several times at follow-up (wheeze,

More information

Annex II. Scientific conclusions

Annex II. Scientific conclusions Annex II Scientific conclusions 5 Scientific conclusions Beclometasone dipropionate (BDP) is a glucocorticoid and a prodrug of the active metabolite, beclometasone-17-monopropionate. Beclometasone dipropionate

More information

Asthma Update A/Prof. John Abisheganaden. Senior Consultant, Dept Of Respiratory & Crit Care Medicine Tan Tock Seng Hospital

Asthma Update A/Prof. John Abisheganaden. Senior Consultant, Dept Of Respiratory & Crit Care Medicine Tan Tock Seng Hospital Asthma Update - 2013 A/Prof. John Abisheganaden Senior Consultant, Dept Of Respiratory & Crit Care Medicine Tan Tock Seng Hospital Asthma A complex syndrome Multifaceted disease Heterogeneous Genetic and

More information

ASTHMA RESOURCE PACK Section 3. Chronic Cough Guidelines

ASTHMA RESOURCE PACK Section 3. Chronic Cough Guidelines ASTHMA RESOURCE PACK Section 3 Chronic Cough Guidelines NHS Fife Guidelines for the Management of Chronic Cough in Adults In this section: 1. Introduction 2. Scope Guidelines for Management of Chronic

More information

Asthma. Guide to Good Health. Healthy Living Guide

Asthma. Guide to Good Health. Healthy Living Guide Asthma Guide to Good Health Healthy Living Guide Asthma Chronic Fatigue Syndrome (CFS) Chronic Obstructive Pulmonary Disease (COPD) Coronary Artery Disease (CAD) Depression Hyperlipidemia Hypertension

More information

On completion of this chapter you should be able to: discuss the stepwise approach to the pharmacological management of asthma in children

On completion of this chapter you should be able to: discuss the stepwise approach to the pharmacological management of asthma in children 7 Asthma Asthma is a common disease in children and its incidence has been increasing in recent years. Between 10-15% of children have been diagnosed with asthma. It is therefore a condition that pharmacists

More information

Breast cancer. Risk factors you cannot change include: Treatment Plan Selection. Inferring Transcriptional Module from Breast Cancer Profile Data

Breast cancer. Risk factors you cannot change include: Treatment Plan Selection. Inferring Transcriptional Module from Breast Cancer Profile Data Breast cancer Inferring Transcriptional Module from Breast Cancer Profile Data Breast Cancer and Targeted Therapy Microarray Profile Data Inferring Transcriptional Module Methods CSC 177 Data Warehousing

More information

spontaneously or under optimum treatment (2,3). Asthma can be classify as early onset or

spontaneously or under optimum treatment (2,3). Asthma can be classify as early onset or The importance of post exercise peak expiratory flow rate & plasma IgE as a diagnostic tests for Mossa M. Marbut*, Jawad Ali Salih*, Abdul- Ghani M. Al-Samarai**. * Department of physiology, College of

More information

Allergic Rhinitis: Effects on Quality of Life and Co-morbid Conditions

Allergic Rhinitis: Effects on Quality of Life and Co-morbid Conditions Disclosures : Effects on Quality of Life and Co-morbid Conditions Nycomed Pharmaceutical Sepracor Pharmaceutical Michael S. Blaiss, MD Clinical Professor of Pediatrics and Medicine University of Tennessee

More information

Biology 2E- Zimmer Protein structure- amino acid kit

Biology 2E- Zimmer Protein structure- amino acid kit Biology 2E- Zimmer Protein structure- amino acid kit Name: This activity will use a physical model to investigate protein shape and develop key concepts that govern how proteins fold into their final three-dimensional

More information

Prediction of micrornas and their targets

Prediction of micrornas and their targets Prediction of micrornas and their targets Introduction Brief history mirna Biogenesis Computational Methods Mature and precursor mirna prediction mirna target gene prediction Summary micrornas? RNA can

More information

Asthma Management for the Athlete

Asthma Management for the Athlete Asthma Management for the Athlete Khanh Lai, MD Assistant Professor Division of Pediatric Pulmonary and Sleep Medicine University of Utah School of Medicine 2 nd Annual Sports Medicine Symposium: The Pediatric

More information

ASTHMA CARE FOR CHILDREN BASKET OF CARE SUBCOMMITTEE Report to: Minnesota Department of Health. June 22, 2009

ASTHMA CARE FOR CHILDREN BASKET OF CARE SUBCOMMITTEE Report to: Minnesota Department of Health. June 22, 2009 This document is made available electronically by the Minnesota Legislative Reference Library as part of an ongoing digital archiving project. http://www.leg.state.mn.us/lrl/lrl.asp ASTHMA CARE FOR CHILDREN

More information

Avg PM10. Avg Low Temp

Avg PM10. Avg Low Temp Geography 532 Geography of Environmental Health Dr. Paul Marr Name: Ex 16- Seasonality, Time Delay, and Disease (10 pts) Below are asthma cases per month for the years 1992-1994. The table also includes

More information

ASTHMA. Epidemiology. Pathophysiology. Diagnosis. IAP UG Teaching slides

ASTHMA. Epidemiology. Pathophysiology. Diagnosis. IAP UG Teaching slides BRONCHIAL ASTHMA ASTHMA Epidemiology Pathophysiology Diagnosis 2 CHILDHOOD ASTHMA Childhood bronchial asthma is characterized by Airway obstruction which is reversible Airway inflammation Airway hyper

More information

PHARMACOPHORE MODELING

PHARMACOPHORE MODELING CHAPTER 9 PHARMACOPHORE MODELING 9.1 PHARMACOPHORES AS VIRTUAL SCREENING TOOLS The pharmacophore concept has been widely used over the past decades for rational drug design approaches and has now been

More information

The impact of respiratory disease in New Zealand: 2018 update

The impact of respiratory disease in New Zealand: 2018 update The impact of respiratory disease in New Zealand: 2018 update Dr Lucy Telfar Barnard Jane Zhang This report was prepared for the Asthma and Respiratory Foundation NZ Contents 1. List of Figures... 5 2.

More information

Project Manual Bio3055. Cholesterol Homeostasis: HMG-CoA Reductase

Project Manual Bio3055. Cholesterol Homeostasis: HMG-CoA Reductase Project Manual Bio3055 Cholesterol Homeostasis: HMG-CoA Reductase Bednarski 2003 Funded by HHMI Cholesterol Homeostasis: HMG-CoA Reductase Introduction: HMG-CoA Reductase is an enzyme in the cholesterol

More information

International Journal of Medical Research & Health Sciences

International Journal of Medical Research & Health Sciences International Journal of Medical Research & Health Sciences www.ijmrhs.com Volume 2 Issue 3 July - Sep Coden: IJMRHS Copyright @2013 ISSN: 2319-5886 Received: 23 th May 2013 Revised: 24 th Jun 2013 Accepted:

More information

2.1 Matter and Organic Compounds

2.1 Matter and Organic Compounds 2.1 Matter and Organic Compounds Lesson Objectives Define elements and compounds. Explain why carbon is essential to life on Earth. Describe the structure and function of the four major types of organic

More information

In silico approach of compounds in Cissus quadrangularis targeting multiproteins as anticancer agents

In silico approach of compounds in Cissus quadrangularis targeting multiproteins as anticancer agents Research Article In silico approach of compounds in Cissus quadrangularis targeting multiproteins as anticancer agents C. N. Hemalatha 1, Elancheziyan K 1, D. Pavithra 2, M. Vijey Aanandhi 3 * ABSTRACT

More information

Asthma 2015: Establishing and Maintaining Control

Asthma 2015: Establishing and Maintaining Control Asthma 2015: Establishing and Maintaining Control Webinar for Michigan Center for Clinical Systems Improvement (Mi-CCSI) Karen Meyerson, MSN, APRN, NP-C, AE-C June 16, 2015 Asthma Prevalence Approx. 26

More information

BRONCHIAL THERMOPLASTY

BRONCHIAL THERMOPLASTY Review Article 155 BRONCHIAL THERMOPLASTY Prince James* and Richa Gupta* (Received on 4.5.2010; Accepted after revision on 5.9.2011) Summary: Even with the use of maximum pharmacological treatment, asthma

More information

Lecture 10 More about proteins

Lecture 10 More about proteins Lecture 10 More about proteins Today we're going to extend our discussion of protein structure. This may seem far-removed from gene cloning, but it is the path to understanding the genes that we are cloning.

More information

Hands-On Ten The BRCA1 Gene and Protein

Hands-On Ten The BRCA1 Gene and Protein Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such

More information

Health and the Domestic Environment. Accidents Mental health Respiratory health Cardiovascular health. Xcess winter mortality

Health and the Domestic Environment. Accidents Mental health Respiratory health Cardiovascular health. Xcess winter mortality Health and the Domestic Environment Accidents Mental health Respiratory health Cardiovascular health Xcess winter mortality Lung Health and the Domestic Environment Indoor environment health effects: Asthma

More information

Bioinformatics Laboratory Exercise

Bioinformatics Laboratory Exercise Bioinformatics Laboratory Exercise Biology is in the midst of the genomics revolution, the application of robotic technology to generate huge amounts of molecular biology data. Genomics has led to an explosion

More information

R. Masekela. Paediatric Pulmonologist and Allergist

R. Masekela. Paediatric Pulmonologist and Allergist R. Masekela Paediatric Pulmonologist and Allergist Outline Definitions i i Biomass fuels Atopy Respiratory tract Environmental tobacco smoke (ETS) Respiratory tract. HIV Atopy Traffic related air pollutants

More information

Chapter Effects of Smoke on the Respiratory System Part 2 pages

Chapter Effects of Smoke on the Respiratory System Part 2 pages Chapter 18.1 Effects of Smoke on the Respiratory System Part 2 pages 417-419 Hemoglobin has 4 separate protein chains. Each protein chain has a single iron atom (Fe 3+ ). Each iron atom can bind to a single

More information

Dual-Controller Asthma Therapy: Rationale and Clinical Benefits

Dual-Controller Asthma Therapy: Rationale and Clinical Benefits B/1 Dual-Controller Asthma Therapy: Rationale and Clinical Benefits MODULE B The 1997 National Heart, Lung, and Blood Institute (NHLBI) Expert Panel guidelines on asthma management recommend a 4-step approach

More information

Differential diagnosis

Differential diagnosis Differential diagnosis The onset of COPD is insidious. Pathological changes may begin years before symptoms appear. The major differential diagnosis is asthma, and in some cases, a clear distinction between

More information

Science in the News: Asthma

Science in the News: Asthma Science in the News: Asthma Spring has returned to the United States. The sky is blue, the grass is green and many plants are flowering. Spring can be a beautiful time of year. But it is especially troublesome

More information

Glen Ellyn Pharmacy Complementary Asthma Management Program Initial Visit

Glen Ellyn Pharmacy Complementary Asthma Management Program Initial Visit Asthma Project Goals: Decrease hospitalizations Decrease use of asthma medications Increase peak flow readings Improve quality of life Decrease doctor visits Page 1 of 10 Page 2 of 10 Patient Name: Patient

More information

Identification of polyphenolic compound inhibitors for 1, 3 β D- glucan synthase in the treatment of dermatophytoses by molecular docking

Identification of polyphenolic compound inhibitors for 1, 3 β D- glucan synthase in the treatment of dermatophytoses by molecular docking International Journal of Advanced Research in Medical Sciences 2017 Volume 1 Issue 1 Pages: 1-5 Original Research Paper Identification of polyphenolic compound inhibitors for 1, 3 β D- glucan synthase

More information

HOMEWORK II and Swiss-PDB Viewer Tutorial DUE 9/26/03 62 points total. The ph at which a peptide has no net charge is its isoelectric point.

HOMEWORK II and Swiss-PDB Viewer Tutorial DUE 9/26/03 62 points total. The ph at which a peptide has no net charge is its isoelectric point. BIOCHEMISTRY I HOMEWORK II and Swiss-PDB Viewer Tutorial DUE 9/26/03 62 points total 1). 8 points total T or F (2 points each; if false, briefly state why it is false) The ph at which a peptide has no

More information

Flow of Talk. Need for ICON in Childhood Asthma. WISC : ICAAI Symposium Highlights of Airway Diseases 12/7/2012

Flow of Talk. Need for ICON in Childhood Asthma. WISC : ICAAI Symposium Highlights of Airway Diseases 12/7/2012 /7/ WISC :. ICAAI Symposium Highlights of Airway Diseases Pediatric Asthma in India Dr.H. Paramesh MD, FAAP(USA), FIAP,FIAMS, FIAA, FCAAI Director. Pulmonologist, Environmentalist, Lakeside Hospital, Bangalore

More information

Bronchial asthma. E. Cserháti 1 st Department of Paediatrics. Lecture for english speaking students 5 February 2013

Bronchial asthma. E. Cserháti 1 st Department of Paediatrics. Lecture for english speaking students 5 February 2013 Bronchial asthma E. Cserháti 1 st Department of Paediatrics Lecture for english speaking students 5 February 2013 Epidemiology of childhood bronchial asthma Worldwide prevalence of 7-8 and 13-14 years

More information

Prevalence of Asthma among University Students and Workers in Khartoum State, Sudan

Prevalence of Asthma among University Students and Workers in Khartoum State, Sudan Prevalence of Asthma among University Students and Workers in Khartoum State, Sudan Azza O Alawad 1, Khalil A.KH.H 2, Tarig H Merghani 3 1 Department of Physiology, Faculty of Medicine, University of Al-Neelain;

More information

Get Healthy Stay Healthy

Get Healthy Stay Healthy Asthma Management WHAT IS ASTHMA? Asthma causes swelling and inflammation in the breathing passages that lead to your lungs. When asthma flares up, the airways tighten and become narrower. This keeps the

More information

RESPIRATORY BLOCK. Bronchial Asthma. Dr. Maha Arafah Department of Pathology KSU

RESPIRATORY BLOCK. Bronchial Asthma. Dr. Maha Arafah Department of Pathology KSU RESPIRATORY BLOCK Bronchial Asthma Dr. Maha Arafah Department of Pathology KSU marafah@ksu.edu.sa Jan 2018 Objectives Define asthma (BA) Know the two types of asthma 1. Extrinsic or atopic allergic 2.

More information

SPIROMETRY TECHNIQUE. Jim Reid New Zealand

SPIROMETRY TECHNIQUE. Jim Reid New Zealand Jim Reid New Zealand The Basics Jim Reid Spirometry measures airflow and lung volumes, and is the preferred lung function test in COPD. By measuring reversibility of obstruction, it is also diagnostic

More information

Asthma in Pediatric Patients. DanThuy Dao, D.O., FAAP. Disclosures. None

Asthma in Pediatric Patients. DanThuy Dao, D.O., FAAP. Disclosures. None Asthma in Pediatric Patients DanThuy Dao, D.O., FAAP Disclosures None Objectives 1. Discuss the evaluation and management of asthma in a pediatric patient 2. Accurately assess asthma severity and level

More information

Antigen Receptor Structures October 14, Ram Savan

Antigen Receptor Structures October 14, Ram Savan Antigen Receptor Structures October 14, 2016 Ram Savan savanram@uw.edu 441 Lecture #8 Slide 1 of 28 Three lectures on antigen receptors Part 1 (Today): Structural features of the BCR and TCR Janeway Chapter

More information

Diseases caused by Smoking

Diseases caused by Smoking Name: Class: Date: Diseases caused by Smoking Biology Gr11A Diseases caused by Smoking Unless you're living in a cave under the heart of Kentucky tobacco country, you know that smoking isn't exactly the

More information

Revised Protocol: Criteria for Designating Substances as. Occupational Asthmagens on the AOEC List of. Exposure Codes

Revised Protocol: Criteria for Designating Substances as. Occupational Asthmagens on the AOEC List of. Exposure Codes Revised Protocol: Criteria for Designating Substances as Occupational Asthmagens on the AOEC List of Exposure Codes Revised September 2008 1 I. Introduction This is a project to evaluate the current AOEC

More information

INSILICO DOCKING AND INTERACTION ANALYSIS OF ELLAGIC ACID AND CURCUMIN DERIVATIVES AGAINST HUMAN CANCER

INSILICO DOCKING AND INTERACTION ANALYSIS OF ELLAGIC ACID AND CURCUMIN DERIVATIVES AGAINST HUMAN CANCER ISSN: 0976-2876 (Print) ISSN: 2250-0138(Online) INSILICO DOCKING AND INTERACTION ANALYSIS OF ELLAGIC ACID AND CURCUMIN DERIVATIVES AGAINST HUMAN CANCER NAYANA MOHAN a AND M.S. LATHA b1 ab Department of

More information