CURRENT MOLECULAR DIAGNOSTICS IN HEMATOONCOLOGY
|
|
- Anne Rogers
- 5 years ago
- Views:
Transcription
1 Third Slovenian congress of hematology and transfusion medicne, Podcetrtek, April 08 Third Slovenian congress of hematology and transfusion medicne, Podcetrtek, April 08 CURRENT MOLECULAR DIAGNOSTICS IN HEMATOONCOLOGY Rajko Kusec, MD, PhD Departments of Haematology and Clinical chemistry Dubrava University hospital Zagreb
2 Clinical Value Of Molecular Diagnostic Markers R.K., Portoroz 2004 LEUKEMIA BCR/ABL (Q-PCR)! PML/RARα RUNX1/ETO TEL/RUNX1 CBFβ-SMMHC E2A/PBX1 MLL/AF4 FLT3-ITD NPM mutations? WT1 expression? FIP1L1-PDGFRα JAK2 V617F (Q-PCR)! LYMPHOMA: BCL2/IgH (Follicular) BCL1/IgH (Mantle) (FISH>PCR) NPM/ALK (ALCL) (FISH>PCR) API1/MALT? (MALT) B-,T-lymph CLONALITY TESTS:! IgHorL TCRγ MYELOMA: IgH/MMSET?!
3 Genetic And Molecular Testing In Ph + CML Consensus Mayo Clinic- Portland - M.D.Anderson STANDARD CYTOGENETICS FISH Q-RT-PCR At diagnosis BM PB Imatinib or IFNα therapy BM PB YES NO Every 3-6 mo to CCR, THEN NO NO YES NO NO NO OR NO YES, 3-6 mo YES, 3-6 mo After HSCT BM Every 3-6 mo as indicated NO NO PB NO YES, 6 mo-2y YES, 6 mo-2y Tefferi et al, Mayo Clin Proc, 2005
4 CML tumour mass size and diagnostic limits for MRD Clinical disease Partial cytogenetic remission leukem. cells Complete cytog. remission (CCR) Q-RT-PCR positiv nested Molec. remission 10 0
5 1 0,1 LEVELS OF MOLECULAR RESPONSE FISH 0,01 0,001 0,0001 0,00001 (Bcr-Abl/Abl) Minimal Molecular Response Major Moleculari Response PCR negative PCR start mo Bcr/Abl stand. curve Bcr/Abl First sample Abl Bcr/Abl Abl Follow up sample Bcr/Abl Abl stand. curve Abl Relative quantification- log response absolute quantification
6 MRD levels in Dubrava Uni hospital patients on Imatinib Not cytg or molec resp. Cytog. remiss bcr-abl/abl=1% Major mol. R. bcr.abl/abl<0,1% PCR negat mo
7 More than 40 different Abl KD mutations ~10% 22 GIMEMA WP-CML n = 477 pts resistant to imatinib P-loop catalytic domain activation loop V289A M343T H396R/P M244V L364I D276G E281A/K M351T L387M/F L248V T277A L384M E279K F359V/I S417Y/F G250E E255K/V T315I E355G/D F382L Q252R/H Y253F/H E292V E453G/K V379I F311L/I F317L E459K/Q A380T F486S
8 Which mutations to test? 1,8 1,6 Gašparović bcr-abl FT increasing 1,4 1,2 Bcr-Abl/Abl KS 1 0,8 Skup1 0,6 0,4 0, Br. uzorka DdeI RFLP-PCR for T315I (this case - no mutation) Hochhaus et al. Leukemia 2002;16;2190
9 Mutations in the MPDs JAK2 Exon 12 mutations V617F V617F + + PV PV V617F - MPL - ET MPL W515 V617F + ET V617F + IMF V617F - MPL - IMF MPLW515
10 JAK2 Exon14 point mutation detected V617F FERM SH2 JH2 Kinase Hs Cf Mm Rn Gg (G T) FFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFV FFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV FFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV FFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV FFEAASMMSQLSYKHLVLNYGVCVCGEENILVQEYV
11 SINGLE GENE FOR THREE DISEASES?!? JAK2 V617F >95% Polycythaemia vera JAK2 V617F ~50% IMF/OMS JAK2 V617F ~50% Essential thrombocythaemia
12 Disproportion of 20q deleted and JAK2 mutated cells del(20q) 100% JAK2 14% Two patients (1 PV and 1ET): V617F+ granulocytes = 14% 20q deleted grans = 100% Kralovics et al, Blood, 2006
13 Fusion gene FIP1L1-PDGFRα is novel genetic marker of Chronic Eosinophilic Leukemia FIP1L1 PDGFRα intr.7-10 eks.12 4q12 Cen Tel deletion 800 Kpb fusion gene FIP1L1-PDGFRα
14 RT-PCR test for FIP1L1-PDGFRα transcript M EOL bp 24y, BM: 34% mbl-eo PB: WBC 29,4 (eo 6,0); Hb 91; Plts 182
15 Male, 50 years, sent to the haematologist for absolute eosinophilia of 2,58 x10 9 /L (WBC 15,58), haemoglobin 172 g/l, Hct 0,49, plts 300x10 9 /L spleen not palpable scarse clinical symptoms RT-PCR for H4-PDGFRβ assay after Schwaller J.et al. Blood 2001;97:3910
16 PROPOSAL FOR DIAGNOSTIC WORKUP AND THERAPY OF HYPEREOSINOPHILIA Gotlib,et al. Blood 2004;103:2879
17 M. Myeloma associated cytogenetic/genetic mutations Fonseca, R. Blood 2007;109:
18 Clinical Characteristics of MMSET-IgH + Patients (N=10) Age 64,5 (52-75y) Gender M=5 F=5 D-S stage CS1= 2 CS2=1 CS3=5 (B=1) 1 PCL Paraprotein type IgA=2, IgG=5 LC=3(2λ) Skeletal disease 0=2, 1=2, 2=2, 3=3 Extramedulary plasmacytic tumour Metabolic (Ca ) 1/ PCL (3/10) & 1 MDS/AML Dubrava Univ hosp
19
20 MOLECULAR TESTING OF T- AND B-CELL CLONALITY REACTIVE LYMPHADENOPATHY LYMPHOMA Ig or TCR genes PCR = POLYCLONAL = MONOCLONAL
21 DIAGNOSTIC EXAMPLE Clinical problem: Persisting gastric mucosa lesion, PHD: suspect lymphoid neoplasm - Maltoma TEST 1 IgH gene rearrangement CD3 region TEST 2 IgH gene rearrangement BIOMED2 design Additional molecular tests: FISH t(11;18)(q21;q21) RT-PCR (API2-MALT) polyclonal clonal Merkur Uni Hosp Zagreb 05
Form 2012 R3.0: Chronic Myelogenous Leukemia (CML) Pre-Infusion Data
Form 2012 R3.0: Chronic Myelogeus Leukemia (CML) Pre-Infusion Data Key Fields Sequence Number: Date Received: - - CIBMTR Center Number: CIBMTR Research ID: Event date: - - HCT type: (check all that apply)
More informationA 34-year old women came because of abdominal discomfort. Vital sign was stable. Spleen tip was palpable.
1 Case 1 A 34-year old women came because of abdominal discomfort. Vital sign was stable. Spleen tip was palpable. CBC and bone marrow aspiration and biopsy were done. Chromosome study showed she had t(9;22)
More informationCurrent Techniques in Molecular Biology Friedel Nollet, Ph.D.
Current Techniques in Molecular Biology Friedel Nollet, Ph.D. Molecular Biology and Cytometry course May 16-17, 2013 Mol, SCK-CEN, Belgium Sanger DNA sequencing Kary Mullis received a Nobel Prize in chemistry
More informationWelcome to Master Class for Oncologists. Session 3: 9:15 AM - 10:00 AM
Welcome to Master Class for Oncologists Session 3: 9:15 AM - 10:00 AM Miami, FL December 18, 2009 Myeloproliferative Neoplasms: Bringing Order to Complexity and Achieving Optimal Outcomes Speaker: Andrew
More informationULTRA-DEEP SEQUENCING OF THE BCR-ABL KINASE DOMAIN FOR BETTER THERAPEUTIC TAILORING OF PHILADELPHIA CHROMOSOME-POSITIVE LEUKEMIA PATIENTS
ULTRA-DEEP SEQUENCING OF THE BCR-ABL KINASE DOMAIN FOR BETTER THERAPEUTIC TAILORING OF PHILADELPHIA CHROMOSOME-POSITIVE LEUKEMIA PATIENTS Simona Soverini, PhD Department of Experimental, Diagnostic and
More informationDiagnostic Molecular Pathology of Myeloid Neoplasms
Diagnostic Molecular Pathology of Myeloid Neoplasms Beirut, Lebanon Tuesday November 29, 2011: Pre-congress workshop Adam Bagg University of Pennsylvania Philadelphia, USA Myeloid neoplasms Myeloproliferative
More informationLAL: significato clinico e biologico delle mutazioni di Bcr-Abl
LAL: significato clinico e biologico delle mutazioni di Bcr-Abl Simona Soverini Dipartimento di Ematologia e Scienze Oncologiche L. e A. Seràgnoli Università di Bologna The vast majority of Ph+ ALL patients
More information74y old Female with chronic elevation of Platelet count. August 18, 2005 Faizi Ali, MD Hematopathology Fellow
74y old Female with chronic elevation of Platelet count August 18, 2005 Faizi Ali, MD Hematopathology Fellow Clinical History Patient is a 74y old otherwise healthy Caucasian female with no major complaint
More informationCML Treatment Failure: More Threatening Than It Appears. Mutation Testing
CML Treatment Failure: More Threatening Than It Appears Mutation Testing Content Mutations and treatment failure Single mutations Compound mutations Mutation testing Guideline recommendations Summary 2
More informationMRD in CML (BCR-ABL1)
MRD in CML (BCR-ABL1) Moleculaire Biologie en Cytometrie cursus Barbara Denys LAbo Hematologie UZ Gent 6 mei 2011 2008 Universitair Ziekenhuis Gent 1 Myeloproliferative Neoplasms o WHO classification 2008:
More information[COMPREHENSIVE GENETIC ASSAY PANEL ON
2014 SN GENELAB AND RESEARCH CENTER DR. SALIL VANIAWALA, PH.D [COMPREHENSIVE GENETIC ASSAY PANEL ON MYELOPROLIFERATIVE NEOPLASMS] SN Genelab presents one of the most comprehensive genetic assay panel for
More informationBeyond the CBC Report: Extended Laboratory Testing in the Evaluation for Hematologic Neoplasia Disclosure
Beyond the CBC Report: Extended Laboratory Testing in the Evaluation for Hematologic Neoplasia Disclosure I am receiving an honorarium from Sysmex for today s presentation. 1 Determining the Etiology for
More informationOpportunities for Optimal Testing in the Myeloproliferative Neoplasms. Curtis A. Hanson, MD
Opportunities for Optimal Testing in the Myeloproliferative Neoplasms Curtis A. Hanson, MD 2013 MFMER slide-1 DISCLOSURES: Relevant Financial Relationship(s) None Off Label Usage None 2013 MFMER slide-2
More informationObjectives. Morphology and IHC. Flow and Cyto FISH. Testing for Heme Malignancies 3/20/2013
Molecular Markers in Hematologic Malignancy: Ways to locate the needle in the haystack. Objectives Review the types of testing for hematologic malignancies Understand rationale for molecular testing Marcie
More informationSupervisor: Prof. Dr. P Vandenberghe Dr. C Brusselmans
Contribution of molecular diagnosis in eosinophilia/hypereosinophilia Eosinophilia Hypereosinophilia Hypereosinophilic syndrome Immune mediated hypereosinophilia Chronic eosinophilic leukemia (NOS)/ Idiopathic
More informationMPL W515L K mutation
MPL W515L K mutation BCR-ABL genotyping The exact chromosomal defect in Philadelphia chromosome is a translocation. Parts of two chromosomes, 9 and 22, switch places. The result is a fusion gene, created
More informationDiagnostic Approach for Eosinophilia and Mastocytosis. Curtis A. Hanson, M.D.
Diagnostic Approach for Eosinophilia and Mastocytosis Curtis A. Hanson, M.D. 2014 MFMER slide-1 DISCLOSURES: Relevant Financial Relationship(s) None Off Label Usage None 2014 MFMER slide-2 Molecular Classification
More informationscreening procedures Disease resistant to full-dose imatinib ( 600 mg/day) or intolerant to any dose of imatinib
Table S1. Study inclusion and exclusion criteria Inclusion criteria Aged 18 years Signed and dated informed consent form prior to protocol-specific screening procedures Cytogenetic- or PCR-based diagnosis
More informationGENETIC MARKERS IN LYMPHOMA a practical overview. P. Heimann Dpt of Medical Genetics Erasme Hospital - Bordet Institute
GENETIC MARKERS IN LYMPHOMA a practical overview P. Heimann Dpt of Medical Genetics Erasme Hospital - Bordet Institute B and T cell monoclonalities Rearrangement of immunoglobin and TCR genes may help
More informationMolecular Diagnostics of Myeloid and Lymphoid Neoplasms
Molecular Diagnostics of Myeloid and Lymphoid Neoplasms Molecular Pathology: Principles in Clinical Practice - 2012 John Greg Howe Ph.D. Department of Laboratory Medicine Yale University School of Medicine
More informationJAK2 V617F analysis. Indication: monitoring of therapy
JAK2 V617F analysis BCR-ABL genotyping The exact chromosomal defect in Philadelphia chromosome is a translocation. Parts of two chromosomes, 9 and 22, switch places. The result is a fusion gene, created
More informationA. ILEA 1* A. M. VLADAREANU 2 E. NICULESCU-MIZIL 3
Bulletin of the Transilvania University of Braşov Series VI: Medical Sciences Vol. 9 (58) No. 1-2016 THE SIMULTANEOUS OCCURRENCE OF THE BCR-ABL TRANSLOCATION AND THE Jak2V617F MUTATION. DETECTION AND DYNAMICS
More informationTemplate for Reporting Results of Biomarker Testing for Myeloproliferative Neoplasms
Template for Reporting Results of Biomarker Testing for Myeloproliferative Neoplasms Version: MPNBiomarkers 1.0.0.2 Protocol Posting Date: June 2017 This biomarker template is NOT required for accreditation
More informationIntegrated Diagnostic Approach to the Classification of Myeloid Neoplasms. Daniel A. Arber, MD Stanford University
Integrated Diagnostic Approach to the Classification of Myeloid Neoplasms Daniel A. Arber, MD Stanford University What is an integrated approach? What is an integrated approach? Incorporating all diagnostic
More informationSchool of Pathology and Laboratory Medicine: Current and New Research Interests
School of Pathology and Laboratory Medicine: Current and New Research Interests W/Professor Wendy Erber Current Research Interests Viral immunology and immunogenetics Bone pathology and cell signalling
More informationCML CML CML. tyrosine kinase inhibitor CML. 22 t(9;22)(q34;q11) chronic myeloid leukemia CML ABL. BCR-ABL c- imatinib mesylate CML CML BCR-ABL
1 Key Wordschronic myeloid leukemiaimatinib mesylate tyrosine kinase inhibitor chronic myeloid leukemia CML imatinib mesylate CML CML CML CML Ph 10 1 30 50 3 5 CML α IFNα Ph Ph cytogenetic response CRmajor
More informationMolecular Detection of BCR/ABL1 for the Diagnosis and Monitoring of CML
Molecular Detection of BCR/ABL1 for the Diagnosis and Monitoring of CML Imran Mirza, MD, MS, FRCPC Pathology & Laboratory Medicine Institute Sheikh Khalifa Medical City, Abu Dhabi, UAE. imirza@skmc.ae
More informationCase #1. 65 yo man with no prior history presented with leukocytosis and circulating blasts: Bone marrow biopsy was performed
Case #1 65 yo man with no prior history presented with leukocytosis and circulating blasts: WBC 187.4K/uL ; Hgb 10.0gm/dL; Platelet 68K/uL Neutrophil % 25.0% Lymphocyte % 38.0% Monocyte % 12.0% Metamyelocyte
More informationCurrent Monitoring for CML: Goals and. Jorge Cortes, MD Chief, CML & AML Section Department of Leukemia MD Anderson Cancer Center
Current Monitoring for CML: Goals and Principles Jorge Cortes, MD Chief, CML & AML Section Department of Leukemia MD Anderson Cancer Center Survival in Early Chronic Phase CML MDACC 2009 The Philadelphia
More informationJohn L Frater, MD Jeffery M Klco, MD, PhD Department of Pathology and Immunology Washington University School of Medicine St Louis, Missouri
Myeloproliferative Neoplasms: New Approaches to Diagnosis and Disease Monitoring John L Frater, MD Jeffery M Klco, MD, PhD Department of Pathology and Immunology Washington University School of Medicine
More informationThe development of clonality testing for lymphomas in the Bristol Genetics Laboratory. Dr Paula Waits Bristol Genetics Laboratory
The development of clonality testing for lymphomas in the Bristol Genetics Laboratory Dr Paula Waits Bristol Genetics Laboratory Introduction The majority of lymphoid malignancies belong to the B cell
More informationWHO Classification of Myeloid Neoplasms with Defined Molecular Abnormalities
WHO Classification of Myeloid Neoplasms with Defined Molecular Abnormalities Robert W. McKenna, M.D. 1/2009 WHO Classification of Myeloid Neoplasms (4th Edition)--2008 Incorporates new information that
More informationMolecular Diagnostics Centre
Directorate of Central Manchester Haematology Service Molecular Diagnostics Centre Haemato-Oncology User Guide 2014 Page 1 of 13 Directorate of CONTENTS About Us 3 Contact Details 3 Location 3 Postal Address
More informationManagement of CML in blast crisis. Lymphoma Tumor Board November 27, 2015
Management of CML in blast crisis Lymphoma Tumor Board November 27, 2015 Chronic Phase CML - 2. Peter Maslak, ASH Image Bank 2011; 2011-2455 Copyright 2011 American Society of Hematology. Copyright restrictions
More informationPatterns of Lymphoid Neoplasia in Peripheral Blood. Leon F. Baltrucki, M.D. Leon F. Baltrucki, M.D. Disclosure
Patterns of Lymphoid Neoplasia in Peripheral Blood Leon F. Baltrucki, M.D. Leon F. Baltrucki, M.D. Disclosure Dr Baltrucki has received an honorarium for his participation as a faculty presenter in this
More informationCost-Effective Strategies in the Workup of Hematologic Neoplasm. Karl S. Theil, Claudiu V. Cotta Cleveland Clinic
Cost-Effective Strategies in the Workup of Hematologic Neoplasm Karl S. Theil, Claudiu V. Cotta Cleveland Clinic In the past 12 months, we have not had a significant financial interest or other relationship
More informationThe rational use of molecular studies in leukemias and lymphomas
what why how The rational use of molecular studies in leukemias and lymphomas the future highlight pitfalls for example summarize utility what Rearrangements - physiologic -pathologic Mutations Additions
More informationwhat why how for example The rational use of molecular studies in leukemias and lymphomas the future highlight pitfalls summarize utility
what why how The rational use of molecular studies in for example leukemias and lymphomas the future highlight pitfalls summarize utility what Molecular targets Rearrangements - physiologic - pathologic
More informationElisabeth Koller 3rd Medical Dept., Center for Hematology and Oncology, Hanusch Hospital, Vienna, Austria
Elisabeth Koller 3rd Medical Dept., Center for Hematology and Oncology, Hanusch Hospital, Vienna, Austria Incidence Diagnosis Prognostic factors Treatment Induction therapy - HSCT Indications for HSCT
More informationMolecular Genetic Testing for the Diagnosis of Haematological Malignancies
Molecular Genetic Testing for the Diagnosis of Haematological Malignancies Dr Anthony Bench Haemto-Oncology Diagnostic Service Cambrıdge Unıversıty Hospitals NHS Foundatıon Trust Cambridge UK Molecular
More informationBiologia molecolare delle malattie mieloproliferative croniche Ph1-negative tipiche
41 CONGRESSO NAZIONALE SIE Bologna 14-17 Ottobre 2007 Biologia molecolare delle malattie mieloproliferative croniche Ph1-negative tipiche Alessandro M. Vannucchi Dip.. di Ematologia, Università degli Studi
More informationMolecular techniques in a case of concurrent BCR-ABL1 positive CML and CMML
reprinted from november 2014 pathology laboratory medicine laboratory management Molecular techniques in a case of concurrent BCR-ABL1 positive CML and CMML CAP TODAY and the Association for Molecular
More informationWhen to change therapy? Andreas Hochhaus Universitätsklinikum Jena, Germany
When to change therapy? Andreas Hochhaus Universitätsklinikum Jena, Germany Chromosome 22 Chromosome 9 e1 1b m-bcr M-bcr e1 e2 b1 b5 5 3 BCR ABL 5 3 1a a2 a3 μ -bcr e19 a11 e1a2 b2a2 b3a2 e19a2 p190 bcr-abl
More informationMolecular Markers. Marcie Riches, MD, MS Associate Professor University of North Carolina Scientific Director, Infection and Immune Reconstitution WC
Molecular Markers Marcie Riches, MD, MS Associate Professor University of North Carolina Scientific Director, Infection and Immune Reconstitution WC Overview Testing methods Rationale for molecular testing
More informationSupplementary Figure 1. FACS analysis of cells infected with TY93/H5N1 GFP-627E,
Supplementary Figure 1. FACS analysis of cells infected with TY93/H5N1 GFP-627E, TY93/H5N1 GFP-627K, or the TY93/H5N1 PB2(588-759) virus library. To establish our GFP- FACS screening platform, we compared
More informationIRIS 8-Year Update. Management of TKI Resistance Will KD mutations matter? Sustained CCyR on study. 37% Unacceptable Outcome 17% 53% 15%
Management of TKI Resistance Will KD mutations matter? IRIS 8-Year Update 17% 53% 5% 15% 37% Unacceptable Outcome No CCyR Lost CCyR CCyR Other 3% 7% Safety Lost-regained CCyR Sustained CCyR on study Deininger
More informationRecommended Timing for Transplant Consultation
REFERRAL GUIDELINES Recommended Timing for Transplant Consultation Published jointly by the National Marrow Donor Program /Be The Match and the American Society for Blood and Marrow Transplantation BeTheMatchClinical.org
More informationEosinophilia: A Diagnostic Approach and Test Utilization Strategies for Bone Marrow Evaluation
Eosinophilia: A Diagnostic Approach and Test Utilization Strategies for Bone Marrow Evaluation American Society for Clinical Pathology 2014 Annual Meeting Presented by: Matthew T. Howard, MD Assistant
More information2013 AAIM Pathology Workshop
2013 AAIM Pathology Workshop John Schmieg, M.D., Ph.D. None Disclosures 1 Pathology Workshop Objectives Define the general philosophy of reviewing pathology reports Review the various components of Bone
More informationIS MUTATION ANALYSIS OF BCR-ABL OF ANY VALUE IN CLINICAL MANAGEMENT OF CML PATIENTS? David Marin, Imperial College London
IS MUTATION ANALYSIS OF BCR-ABL OF ANY VALUE IN CLINICAL MANAGEMENT OF CML PATIENTS? David Marin, Imperial College London Tell me generals, are we politicians necessary? I have to admit defeat before starting
More informationHypereosinophili c syndrome
Hypereosinophili c syndrome Eosinophilia Eosinophilia is commonly defined as an elevated percentage of eosinophils, with an absolute eosinophil count > 500 cells per cubic millimeter Secondary Primary
More informationBCR-ABL1 positive Myeloid Sarcoma Nicola Austin
BCR-ABL1 positive Myeloid Sarcoma Nicola Austin Cytocell UK & Ireland User Group Meeting Jesus College, Cambridge 4 th - 5 th April 2017 Myeloid Sarcoma WHO Classification Tumours of Haematopoietic and
More information1.Basis of resistance 2.Mechanisms of resistance 3.How to overcome resistance. 13/10/2017 Sara Redaelli
Dott.ssa Sara Redaelli 13/10/2017 1.Basis of resistance 2.Mechanisms of resistance 3.How to overcome resistance Tumor Heterogeneity: Oncogenic Drivers in NSCLC The Promise of Genotype-Directed Therapy
More informationCase Workshop of Society for Hematopathology and European Association for Haematopathology
Case 148 2007 Workshop of Society for Hematopathology and European Association for Haematopathology Robert P Hasserjian Department of Pathology Massachusetts General Hospital Boston, MA Clinical history
More informationLeukocytosis - Some Learning Points
Leukocytosis - Some Learning Points Koh Liang Piu Department of Hematology-Oncology National University Cancer Institute National University Health System Objectives of this talk: 1. To provide some useful
More informationUpdates in Molecular Hematology Gregory J. Tsongalis, Ph.D.
Updates in Molecular Hematology Gregory J. Tsongalis, Ph.D. Professor of Pathology Director, Molecular Pathology Dartmouth Medical School Dartmouth Hitchcock Medical Center Norris Cotton Cancer Center
More informationMyeloproliferative Disorders - D Savage - 9 Jan 2002
Disease Usual phenotype acute leukemia precursor chronic leukemia low grade lymphoma myeloma differentiated Total WBC > 60 leukemoid reaction acute leukemia Blast Pro Myel Meta Band Seg Lymph 0 0 0 2
More informationADx Bone Marrow Report. Patient Information Referring Physician Specimen Information
ADx Bone Marrow Report Patient Information Referring Physician Specimen Information Patient Name: Specimen: Bone Marrow Site: Left iliac Physician: Accession #: ID#: Reported: 08/19/2014 - CHRONIC MYELOGENOUS
More informationCurrent Prognostication in Primary Myelofibrosis
Current Prognostication in Primary Myelofibrosis Francisco Cervantes Hematology Department, Hospital Clínic, Barcelona, Spain Florence, April 2011 Survival in PMF No. patients: 1,054 Median Srv (95% CI):
More informationSESSION III: Chronic myeloid leukemia PONATINIB. Gianantonio Rosti, MD, Department of Hematology, University of Bologna, Italy
SESSION III: Chronic myeloid leukemia PONATINIB Gianantonio Rosti, MD, Department of Hematology, University of Bologna, Italy Ponatinib A Pan-BCR-ABL Inhibitor Rationally designed inhibitor of BCR- ABL
More informationChronic Myelogenous Leukemia in a 66-Year-Old Male with Concurrent Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma
Chronic Myelogenous Leukemia in a 66-Year-Old Male with Concurrent Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma Linda J. Szymanski, DO, 1 Hashem Ayyad, MD, 1 Kedar Inamdar, MD, PhD 1* CLINICAL
More informationTemplate for Reporting Results of Biomarker Testing for Myeloproliferative Neoplasms
Template for Reporting Results of Biomarker Testing for Myeloproliferative Neoplasms Template web posting date: December 2014 Authors Todd W. Kelley, MD, FCAP University of Utah and ARUP Laboratories,
More informationRole of FISH in Hematological Cancers
Role of FISH in Hematological Cancers Thomas S.K. Wan PhD,FRCPath,FFSc(RCPA) Honorary Professor, Department of Pathology & Clinical Biochemistry, Queen Mary Hospital, University of Hong Kong. e-mail: wantsk@hku.hk
More informationPhenoPath. Diagnoses you can count on B CELL NON-HODGKIN LYMPHOMA
PhenoPath Diagnoses you can count on B CELL NON-HODGKIN LYMPHOMA C urrent diagnosis of B cell non-hodgkin lymphoma (B-NHL) is based on the 2008 WHO Classification of Tumours of Haematopoietic and Lymphoid
More informationThe patient had a mild splenomegaly but no obvious lymph node enlargement. The consensus phenotype obtained from part one of the exercise was:
Case History An 86 year old male was admitted to hospital with chest infection. Haematological examination subsequently revealed the following: Hb- 11.0 g/dl; WBC- 67.1 x 10^9/l; PLT- 99 x10^9/l; RBC-
More informationMolecular Diagnostics for Myeloproliferative Neoplasms. Noah Brown, MD April 16, 2015
Molecular Diagnostics for Myeloproliferative Neoplasms Noah Brown, MD April 16, 2015 Outline 1. Brief MPN Introduction 2. When/How Should Molecular Testing be Performed? 3. JAK2 V617F Mutation Testing
More informationMolecular Diagnosis. Nucleic acid based testing in Oncology
Molecular Diagnosis Nucleic acid based testing in Oncology Objectives Describe uses of NAT in Oncology Diagnosis, Prediction, monitoring. Genetics Screening, presymptomatic testing, diagnostic testing,
More informationDisclosure BCR/ABL1-Negative Classical Myeloproliferative Neoplasms
Disclosure BCR/ABL1-Negative Classical Myeloproliferative Neoplasms Sonam Prakash declares affiliation with Incyte Corporation: Advisor for Hematopathology Publications Steering Committee Sonam Prakash,
More informationNucleic Acid Testing - Oncology. Molecular Diagnosis. Gain/Loss of Nucleic Acid. Objectives. MYCN and Neuroblastoma. Molecular Diagnosis
Nucleic Acid Testing - Oncology Molecular Diagnosis Nucleic acid based testing in Oncology Gross alterations in DNA content of tumors (ploidy) Gain/Loss of nucleic acids Markers of Clonality Oncogene/Tumor
More informationCase Presentation. Attilio Orazi, MD
Case Presentation Attilio Orazi, MD Weill Cornell Medical College/ NYP Hospital Department of Pathology and Laboratory Medicine New York, NY United States History 60 year old man presented with anemia
More informationMolecular Hematopathology
Molecular Hematopathology Charles E. Hill, MD, PhD Emory University School of Medicine April 2013 The Association for Molecular Pathology Education. Innovation and Improved Patient Care. Advocacy. www.amp.org
More informationIf unqualified, Complete remission is considered to be Haematological complete remission
Scroll right to see the database codes for Disease status and Response Diagnosis it refers to Disease status or response to treatment AML ALL CML CLL MDS or MD/MPN or acute leukaemia secondary to previous
More informationExtramedullary precursor T-lymphoblastic transformation of CML at presentation
Extramedullary precursor T-lymphoblastic transformation of CML at presentation Neerja Vajpayee, Constance Stein, Bernard Poeisz & Robert E. Hutchison Clinical History 30 year old man presented to the emergency
More informationPost-ASH 2015 CML - MPN
Post-ASH 2015 CML - MPN Fleur Samantha Benghiat, MD, PhD Hôpital Erasme, Brussels 09.01.2016 1. CML CML 1st line ttt Prognosis Imatinib Nilotinib Response Discontinuation Dasatinib Low RISK PROFILE High
More informationIf unqualified, Complete remission is considered to be Haematological complete remission
Scroll right to see the database codes for Disease status and Response Diagnosis it refers to Disease status or response to treatment AML ALL CML CLL MDS or MD/MPN or acute leukaemia secondary to previous
More informationVenice Meeting Highlights: Key lessons. Conclusions Michele Baccarani Rüdiger Hehlmann
Venice Meeting Highlights: Key lessons Conclusions Michele Baccarani Rüdiger Hehlmann CML therapy in the imatinib era CML prognosis has improved dramatically Cellular and molecular biology studies help
More informationThe BCR-ABL1 fusion. Epidemiology. At the center of advances in hematology and molecular medicine
At the center of advances in hematology and molecular medicine Philadelphia chromosome-positive chronic myeloid leukemia Robert E. Richard MD PhD rrichard@uw.edu robert.richard@va.gov Philadelphia chromosome
More informationREPORT. of Medicine, University Hospital Schleswig-Holstein, Campus Kiel, Kiel, Germany;
REPORT NCI First International Workshop on the Biology, Prevention, and Treatment of Relapse after Allogeneic Hematopoietic Stem Cell Transplantation: Report from the Committee on Disease-Specific Methods
More information"Calreticulin Mutation Analysis in Iranian patients suffering from Essential thrombocythemia and Primary Myelofibrosis
"Calreticulin Mutation Analysis in Iranian patients suffering from Essential thrombocythemia and Primary Myelofibrosis Dr Behzad Poopak, DCLS PhD. Associate professor of fhematology Islamic Azad University
More informationPresenter Disclosure Information
Welcome to Master Class for Oncologists Session 3: 2: PM 3:3 PM Pasadena, CA May 1, 21 Myeloproliferative Neoplasms 21 Speaker: Ayalew Tefferi Mayo Clinic, Rochester, MN Presenter Disclosure Information
More informationMolecular Markers in Acute Leukemia. Dr Muhd Zanapiah Zakaria Hospital Ampang
Molecular Markers in Acute Leukemia Dr Muhd Zanapiah Zakaria Hospital Ampang Molecular Markers Useful at diagnosis Classify groups and prognosis Development of more specific therapies Application of risk-adjusted
More informationHypereosinophilic Syndrome. Fellow: Eunpi Cho Faculty Discussant: Michael Linenberger
Hypereosinophilic Syndrome Fellow: Eunpi Cho Faculty Discussant: Michael Linenberger Case 19 yo M admitted to Evergreen Hospital after cardiac arrest. Troponin 8.41, BNP 12,087 Utox pos for amphetamines
More information"Molecular Monitoring Strategies to Track Response to BCR-ABL Kinase Inhibitors in CML"
Association of Molecular Pathology USCAP Companion Meeting Sunday, February 12, 2006 7:00 PM Dan Jones, MD, PhD Associate Professor Medical Director, Molecular Diagnostic Laboratory Division of Pathology
More informationCase Report Synchronous Occurrence of Chronic Myeloid Leukemia and Mantle Cell Lymphoma
Hindawi Case Reports in Hematology Volume 2017, Article ID 7815095, 4 pages https://doi.org/10.1155/2017/7815095 Case Report Synchronous Occurrence of Chronic Myeloid Leukemia and Mantle Cell Lymphoma
More informationDisclosure: Objectives/Outline. Leukemia: Genealogy of Pathology Practice: Old Diseases New Expectations. Nothing to disclose.
RC1 Leukemia: Genealogy of Pathology Practice: Old Diseases New Expectations RC2 Disclosure: Nothing to disclose Henry Moon Lecture: UCSF Annual Conference Kathryn Foucar, MD kfoucar@salud.unm.edu May
More informationCharacterization of MPL-mutated myeloid neoplasms: a review of 224 MPL+ cases
Article Characterization of MPL-mutated myeloid neoplasms: a review of 224 MPL+ cases Keming Lin 1,*, Gang Xu 1, Jie-Gen Jiang 1, Mayuko Imai 1, Zhao Wu 1, Paris Petersen 1, Kim Janatpour 1, and Bashar
More informationWhat Can We Expect from Imatinib? CML Case Presentation. Presenter Disclosure Information. CML Case Presentation (cont)? Session 2: 8:15 AM - 9:00 AM
Welcome to Master Class for Oncologists Session 2: 8:15 AM - 9: AM Miami, FL December 18, 29 Chronic Myelocytic Leukemia: Imatinib and Beyond Speaker: Daniel J. DeAngelo, MD, PhD Dana-Farber Cancer Institute
More informationMolecular Pathology of Lymphoma (Part 1) Rex K.H. Au-Yeung Department of Pathology, HKU
Molecular Pathology of Lymphoma (Part 1) Rex K.H. Au-Yeung Department of Pathology, HKU Lecture outline Time 10:00 11:00 11:15 12:10 12:20 13:15 Content Introduction to lymphoma Review of lymphocyte biology
More informationMYELOPROLIFERATIVE NEOPLASMS
9 : 2 MYELOPROLIFERATIVE NEOPLASMS Introduction William Dameshek in 1951 introduced the term Myeloproliferative disorders (MPD). This included polycythemia vera (PV), essential thrombocythemia (ET), primary
More informationHematopathology Case Study
www.medfusionservices.com Hematopathology Case Study CV3515-14 JUNE Clinical Presentation: Clinical Information: A 42 year old male with history of chronic myelogenous leukemia (CML) presents with an elevated
More informationPolycythemia Vera and other Myeloproliferative Neoplasms. A.Mousavi
Polycythemia Vera and other Myeloproliferative Neoplasms A.Mousavi Chronic MPNs Multipotent hematopoietic progenitor cell is origin. Overproduction of one or more formed element of blood cells without
More informationIntroduction to Cancer
Introduction to Cancer Clonal Evolution Theory of Tumor Development,2,2,,2,2,,2, Numbers represent sequential mutations to cellular genes Oncogenes and Tumor Suppresser Genes On Oncogenes Tumor Suppresser
More informationMethylation status of SOCS1 and SOCS3 in BCR-ABL negative and. JAK2V617F negative chronic myeloproliferative disorders.
Methylation status of SOCS1 and SOCS3 in BCR-ABL negative and JAK2V617F negative chronic myeloproliferative disorders. To the Editor BCR-ABL negative Chronic Myeloproliferative Disorders (s) are a heterogeneous
More informationAcute Leukemia. Sebastian Giebel. Geneva 03/04/
Acute Leukemia (including ALL) Sebastian Giebel Geneva 03/04/2012 www.ebmt.org Acute leukemias: EBMT survey 2 AML: EBMT survey Gratwohl A, et al. Bone Marrow Transplant 2009 3 Acute leukemias: INCIDENCE
More informationLymphoma Case Scenario 1
Lymphoma Case Scenario 1 HISTORY: A 23-year-old healthy female presented with a month-long history of persistent headache of increasing severity. She noted episodic nausea and vomiting in association with
More informationTransplants for MPD and MDS
Transplants for MPD and MDS The question is really who to transplant, with what and when. Focus on myelofibrosis Jeff Szer Royal Melbourne Hospital Myelodysplasia Little needs to be said Despite new therapies
More informationOncology Cytogenetics Diagnostic Service - User Guide 2014
Oncology Cytogenetics Diagnostic Service - User Guide 2014 Contact details Address: Cytogenetics Department 5 th Floor Tower Wing Guy s Hospital Great Maze Pond London SE1 9RT General enquiries 0207 188
More informationOxford BRC Haemato-Molecular Diagnostic Service
Short User Guide Oxford BRC Haemato-Molecular Diagnostic Service The Oxford University Hospitals NHS trust s department of Haematology provides a comprehensive molecular diagnostic service for a range
More information