Dulaglutide: designed with patients in mind
|
|
- Ralph Bradley
- 5 years ago
- Views:
Transcription
1 31 st Panhellenic Annual Congress of the Hellenic Association for the Study & Education of Diabetes Mellitus Thessaloniki 11 th, November 2017 Dulaglutide: designed with patients in mind Imre Pavo MD PhD Eli Lilly Diabetes Medical Research
2 Disclosures Imre Pavo is full time employee and shareholder of Eli Lilly and Co.
3 GLP-1 Has a Broad Range of Biological Activity Cardiovascular System 1 Cardiovascular risk factors Weight Blood pressure Lipid profile Intestine Brain Appetite 1 Satiety 2 Stomach Gastric emptying 1 Liver Glucose production 2 GLP-1 Direct actions Indirect actions Muscle and Adipose Tissue Glucose uptake 2 Pancreas Insulin secretion 1 Glucagon secretion 3 1. Smilowitz et al. Circulation. 2014;129(22): Gupta. Indian J Endocrinol Metab. 2013;17(3): Kalra S, et al. Indian J Endocrinol Metab. 2016;20(2):
4 GLP-1 RAs: Key Efficacy and Safety GLP-1 RAs HbA 1c Effective in lowering HbA 1c 1,2,3 Weight Potential for weight loss 1,2,3 Hypoglycaemia Low potential for incidents 1,2 GI adverse events Nausea, diarrhoea, and vomiting that are mild to moderate in severity and transient in nature 2,4 1. Karagiannis T, et al. Diabetes Obes Metab. 2015;17(11): Liu FP, et al. J Diabetes. 2015;7(3): Singh S, et al. Diabetes Obes Metab. 2017;19(2): Prasad-Reddy L, et al. Drugs Context. 2015;9(4). DOI: /dic
5 Comparison of Human GLP-1 and Exendin-4 Backbone GLP-1 Analog Human GLP-1 His Ala Glu Gly Thr Phe Thr Ser Asp Val 7 9 Ser Lys Glu Ala Ala Gln Gly Glu Leu Tyr Ser Phe 36 Ile Ala Trp Leu Val Lys Gly Arg 53% homology His Gly Glu Gly Thr Phe Thr Ser Asp Leu Exendin-4 backbone (Exenatide) GLP-1=glucagon-like peptide-1 1. Baggio et al. Gastroenterol 2007;132: Eng et al. J Biol Chem 1992;267: Ser Arg Leu Val Ala Glu Glu Glu Met Gln Lys Phe Ile Glu Trp Leu Lys Asn Lys Gly Gly Pro Ser Ser Gly Ser Pro Pro Pro Ala
6 Overview of Approved GLP 1 Receptor Agonists GLP-1 receptor agonists subcutaneously administered peptides Human GLP-1 backbone Exendin-4 backbone Weekly Once daily Weekly Once daily or Twice daily Albiglutide Liraglutide Exenatide Exenatide Twice daily Dulaglutide Lixisenatide Once daily GLP-1=glucagon-like peptide-1 Madsbad et al. Diabetes Obes Metab 2011;13(5):
7 Approved GLP-1 RAs Structure and Half-life Exenatide BID Liraglutide Exenatide QW Lixisenatide Albiglutide Dulaglutide DPP-4 Resistant to DPP-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS DPP-4 HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG C-16 free fatty acid derivative Albumin via a glutamoyl spacer DPP-4 DPP-4 Partial resistant to DPP-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Resistant to DPP-4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK DPP-4 Resistant to DPP-4 Poly (D,L lactic-co-glycolic acid) microspheres Resistant to DPP-4 HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR DPP-4 Resistant to DPP-4 HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG Recombinant fusion protein linked to human albumin Albumin Modified IgG4 Fc domain Modified IgG4 Fc domain t 1/2 = hours and renal filtration t 1/2 = hours and multiple organ filtration Steady state over 6-7 weeks and renal filtration t 1/2 = ~3 hours and renal filtration t 1/2 = ~ 5 days and multiple organ filtration t 1/2 = ~5 days
8 Topics Dulaglutide molecule Overview of dulaglutide PK / PD and clinical pharmacology Overview of AWARD trials AWARD-5: an adaptive seamless dose finding study
9 Dulaglutide: A GLP-1 IgG Fusion Protein A GLP-1 analog Heavy chain Light chain Antigen binding site Linker Fab domain Modified IgG4 Fc domain Fc domain B NH 2 G 8 IgG 22 H G E G T F T S D V S S Y L E E Q 36 G G G G G G K V L W A I F E K A A S G G G G S G G G G S A Modified IgG4 Color code in B is representative of region color in A 1. Umpierrez et al. Diabetes Obes Metab 2011;13: Kuritzky et al. Postgrad Med 2014;126: Glaesner et al. Diabetes Metab Res Rev 2010;26: Fc domain COOH
10 Dulaglutide has Extended Activity 1 Allows once-weekly administration 1,2 Removed and replaced alanine at position 8 with glycine resulting in resistance to DPP-4 degradation 3 Fused 2 GLP-1 analogues to the Fc portion of an IgG4 antibody resulting in decreased renal clearance and increased time-action profile 4-5 Inserted optimized amino acid linker resulting in improved binding 1,4 Linker GLP-1 analogue Modified IgG4 Fc domain Fc-fusion protein molecules are used currently to treat a wide range of disease states, such as rheumatoid arthritis, organ rejection, and macular degeneration 6 1. Data on file, Eli Lilly and Company and/or one of its subsidiaries 2. Sivaraman et al. Br J Diabetes Vasc Dis 2013;13: Umpierrez et al. Diabetes Obes Metab 2011;13: Pabreja et al. Br J Pharmacol 2014;171: Madsbad et al. Diabetes Obes Metab 2011;13: Glaesner et al. Diabetes Metab Res Rev 2010;26:287-96
11 Dulaglutide is Soluble Eliminates the need for reconstitution and allows delivery via a small-gauge needle (29G) 1 Fc fusion-enhanced solubility 2 In addition to other changes, modified glycine at position 22 in the GLP-1 analogue to glutamic acid results in further enhanced solubility 3 Linker GLP-1 analogue Modified IgG4 Fc domain 1. Matfin et al. J Diabetes Sci Technol 2015;9: Czajkowsky et al. EMBO Mol Med 2012;4:
12 Dulaglutide has Low Potential for Immunogenicity 1 IgG4 selected to minimize potential for cell-mediated toxicity 1,2 Mutations inserted into the IgG4 to minimize potential cytotoxicity 1 Replacing an arginine residue with glycine in the GLP-1 analogue eliminate a potential T-cell epitope 1 Linker GLP-1 analogue Modified IgG4 Fc domain 1. Data on file, Eli Lilly and Company and/or one of its subsidiaries 2. Glaesner et al. Diabetes Metab Res Rev 2010;26: Nirula et al. Current Opin Rheumatol 2011;23:119-24
13 Schematic Presentation of Dulaglutide Structure Dulaglutide is a recombinant GLP-1 Fc fusion protein consisting of 2 identical chains, each containing a human GLP-1 analog sequence linked to a modified human immunoglobulin G4 (IgG4) heavy chain by a small peptide linker 1,2 GLP-1 Analog It is approved for the treatment of type 2 diabetes and its main features are: Linker Extended plasma half-life (~5 days) 3,4 Minimal renal clearance Low immunogenic potential Once weekly dosing Solution injection: no reconstitution needed Modified IgG4 Fc Domain 1. Glaesner et al. Diabetes Metab Res Rev 2010;26: Kuritzky et al. Postgrad Med 2014; Trulicity [Prescribing Information]. Indianapolis, IN: Lilly USA, LLC; Trulicity [Summary of Product Characteristics]. Houten, The Netherlands: Eli Lilly and Company; 2016
14 Dulaglutide Is Delivered via a Ready-to-Use Pen Characteristics of the ready-to-use pen Steps to use: uncap, place and unlock, press and hold 1 Provides dose confirmation 1 Dose delivery (5-10 seconds) 1 Automatically retracts needle following injection 1 Small (29G, 5 mm injection depth 2 ), hidden needle 1 In a Phase 3 study, 99% of people found the pen easy to use 2 1. Trulicity [Summary of Product Characteristics]. Houten, The Netherlands: Eli Lilly and Company; Matfin et al. J Diabetes Sci Technol 2015;9:1071-9
15 Topics Dulaglutide molecule Overview of dulaglutide PK / PD and clinical pharmacology Overview of AWARD trials AWARD-5: an adaptive seamless dose finding study
16 Dulaglutide Pharmacokinetics Summary Steady-state plasma concentrations were achieved between 2 to 4 weeks after onceweekly administration 1,2 Elimination half-life of 4.5 to 4.7 days for both doses makes dulaglutide suitable for onceweekly administration 1,2 Renal impairment USPI: no dose adjustment of dulaglutide is needed 1 SmPC: no dosage adjustment is required in patients with mild/moderate renal impairment 2. Not recommended in patients with severe renal impairment (egfr [by CKD-EPI] < 30 ml/min/1.73 m 2 ) or end-stage renal disease 2 Hepatic impairment: no dose adjustment of dulaglutide is needed 2, however needs to be used with caution 1 No dosage adjustment recommended based on PK for co-administration with 2 lisinopril ethinylestradiol S-warfarin metoprolol atorvastatin R-warfarin digoxin metformin sitagliptin norelgestromin acetaminophen 1. Trulicity [Prescribing Information]. Indianapolis, IN: Lilly USA, LLC; Trulicity [Summary of Product Characteristics]. Houten, The Netherlands: Eli Lilly and Company; 2016
17 Dulaglutide Pharmacodynamics Summary Dulaglutide increases first-and second-phase insulin secretion in patients with type 2 diabetes compared with placebo Dulaglutide stimulates glucose-dependent insulin secretion and reduces glucagon secretion Dulaglutide causes a delay of gastric emptying. The delay is largest after the first dose and diminishes with subsequent doses In a thorough QTc study, dulaglutide did not produce QTc prolongation at supratherapeutic doses of 4 and 7 mg Trulicity [Prescribing Information]. Indianapolis, IN: Lilly USA, LLC; 2017
18 Topics Dulaglutide molecule Overview of dulaglutide PK / PD and clinical pharmacology Overview of AWARD trials AWARD-5: an adaptive seamless dose finding study
19 Dulaglutide Clinical Trial Program Monotherapy 2-Drug Combinations 1st Injectable Therapy 3-Drug Combinations More Complex Strategies Combination With Insulin AWARD-3 3 vs metformin Drug-naïve or washout from 1 OAM AWARD-5 5,6,7 vs sitagliptin Add-on to metformin AWARD-6 8 vs liraglutide Add-on to metformin AWARD-8 10 vs placebo Add-on to SU AWARD-1 1 vs exenatide BID Add-on to metformin and TZD AWARD-2 2 vs insulin glargine Add-on to metformin and SU AWARD-10 9 vs placebo Add-on to SGLT2i with or without metformin AWARD-4 4 vs insulin glargine Both with mealtime insulin lispro with or without metformin AWARD-7 9 vs insulin glargine in CKD Both with mealtime insulin lispro AWARD-9 11 vs placebo Both with titrated insulin glargine with or without metformin More than 5000 patients have been enrolled in Phase 3 clinical trials The AWARD program spans the continuum of care One additional study (long-term cardiovascular outcomes), REWIND, is ongoing 1. Wysham et al. Diabetes Care 2014;37: Giorgino et al. Diabetes Care 2014;38: Umpierrez et al. Diabetes Care 2014;37: Blonde et al. Lancet 2015;385: Nauck et al. Diabetes Care 2014;37: Weinstock et al. Diabetes Obes Metab 2015;17: Skrivanek et al. Diabetes Obes Metab 2014;16(8): Dungan et al. Lancet 2014;384: Data on file. Dulaglutide Clinical Overview. 10. Dungan et al. Diabetes Obes Metab 2016;18: Pozzilli et al. Diabetes Obes Metab Mar 14. doi: /dom [Epub ahead of print]
20 Topics Dulaglutide molecule Overview of dulaglutide PK / PD and clinical pharmacology Overview of AWARD trials AWARD-5: an adaptive seamless dose finding study
21 AWARD-5 Study Design: Dose-Finding to 104 Weeks Safety Follow-up Key inclusion criteria T2D ( 6 months) HbA1c >8.0% (64 mmol/mol) and 9.5% (80 mmol/mol) on diet and exercise alone or HbA1c 7.0% (53 mmol/mol) and 9.5% (80 mmol/mol) on OAM monotherapy or combination therapy (metformin plus another OAM) Metformin a Lead Study in period week -11b 0 Dose finding c Dulaglutide 0.25 mg Dulaglutide 0.5 mg Dulaglutide 1.0 mg Dulaglutide 2.0 mg Dulaglutide 3.0 mg Placebo d 52-Week Analysis Dulaglutide 0.75 mg once weekly Dulaglutide 1.5 mg once weekly 104-Week Analysis Sitagliptin 100 mg once daily Sitagliptin 100 mg once daily Treatment period Randomization Primary Time Point Final Time Point Stage 1 Stage 2 a Metformin background concomitant therapy from lead-in period through treatment period ( 1500 mg/day); b Lead-in period lasted from 2 weeks up to 11 weeks; c The dose-finding period (indicated by the pink area) ended at the Decision Point (April 29, 2009) resulting in different exposures within and across treatment groups. All patients on non-selected arms were discontinued regardless of length of participation in the study; d After 26 weeks, patients in the placebo arm transitioned to Sitagliptin (100 mg/day) in a blinded fashion 1. Skrivanek et al. Diabetes Obes Metab 2014;16(8): Geiger et al. J Diabetes Sci Technol 2012;6: Skrivanek et al. J Diabetes Sci Technol 2012; 6:
22 AWARD-5 Dose Finding Stage 1-3 Objective: identify a dulaglutide dose with an optimal efficacy and safety profile, and possibly one lower dose a using an adaptive design Patients were adaptively randomized to dulaglutide doses and evaluated biweekly based on predefined dose decision rules Adaptive randomization and dose selection was facilitated by a clinical utility index (CUI) of HbA1c vs sitagliptin at 52 weeks and weight, pulse rate and diastolic blood pressure vs placebo at 26 weeks The decisions made by the algorithm were based on the posterior probability distributions of the CUI; with an adaptive potential decision point a In case of an observed, unforeseen safety signal with the optimal dose during subsequent clinical development 1. Skrivanek et al. Diabetes Obes Metab 2014;16: Nauck et al. Diabetes Care 2014;37: Weinstock et al. Diabetes Obes Metab 2015;17:849-58
23 Dose-Response Model and CUI ΘPR (bpm) Clinical Utility Index Skrivanek et al. Diabetes Obes Metab 2014;16:748-56
24 Summary and Conclusions for the Dose Finding Stage of AWARD-5 Efficacy Optimal dose: Dulaglutide 1.5 mg Second dose: Dulaglutide 0.75 mg This second dose was the next highest dose with an acceptable CUI 0.6 and 50% of the maximum utility dose to ensure minimal overlap of dulaglutide exposure Safety GI adverse events (nausea, diarrhea, and vomiting) and urinary tract infection were the most common adverse events reported Conclusions This adaptive design successfully identified safe and efficacious doses, once weekly dulaglutide 1.5 mg and 0.75 mg, that were selected for further investigation in the Phase 3 program with a relatively small sample size and limited exposure to make the dose decision Skrivanek et al. Diabetes Obes Metab 2014;16:748-56
Lilly Diabetes: Pipeline Update
Lilly Diabetes: Pipeline Update June 16, 2014 Safe Harbor Provision This presentation contains forward-looking statements that are based on management's current expectations, but actual results may differ
More informationThe Highlights of the AWARD Clinical Program FRANCESCO GIORGINO
The Highlights of the AWARD Clinical Program FRANCESCO GIORGINO DEPARTMENT OF EMERGENCY AND ORGAN TRANSPLANTATION SECTION OF INTERNAL MEDICINE, ENDOCRINOLOGY, ANDROLOGY AND METABOLIC DISEASES Disclaimer
More informationSelecting GLP-1 RA Treatment
Selecting GLP-1 RA Treatment Dr Felicity Kaplan March 2017 Objectives Review the progressive nature of type 2 diabetes Understand the need for timely treatment intensification Examine the place of GLP-1
More informationGLP 1 agonists Winning the Losing Battle. Dr Bernard SAMIA. KCS Congress: Impact through collaboration
GLP 1 agonists Winning the Losing Battle Dr Bernard SAMIA KCS Congress: Impact through collaboration CONTACT: Tel. +254 735 833 803 Email: kcardiacs@gmail.com Web: www.kenyacardiacs.org Disclosures I have
More informationGLP-1 agonists. Ian Gallen Consultant Community Diabetologist Royal Berkshire Hospital Reading UK
GLP-1 agonists Ian Gallen Consultant Community Diabetologist Royal Berkshire Hospital Reading UK What do GLP-1 agonists do? Physiology of postprandial glucose regulation Meal ❶ ❷ Insulin Rising plasma
More informationSTRATEGIES FOR SUSTAINING EXPOSURE OF PEPTIDE THERAPEUTICS: CASE STUDIES
STRATEGIES FR SUSTAINING EXPSURE F PEPTIDE THERAPEUTICS: CASE STUDIES ASIA TIDES KYT JAPAN 23 FEBRUARY 2017 CHRISTPHER A. RHDES, PH.D. PRESENTATIN UTLINE Delivery Technologies for Sustained Exposure of
More informationAchieving and maintaining good glycemic control is an
Glycemic Efficacy, Weight Effects, and Safety of Once-Weekly Glucagon-Like Peptide-1 Receptor Agonists Yehuda Handelsman, MD, FACP, FNLA, FASPC, MACE; Kathleen Wyne, MD, PhD, FACE, FNLA; Anthony Cannon,
More informationDulaglutide (LY ) for the treatment of type 2 diabetes
Expert Review of Clinical Pharmacology ISSN: 1751-2433 (Print) 1751-2441 (Online) Journal homepage: http://www.tandfonline.com/loi/ierj20 (LY-2189265) for the treatment of type 2 diabetes André J. Scheen
More informationProfessor Rudy Bilous James Cook University Hospital
Professor Rudy Bilous James Cook University Hospital Rate per 100 patient years Rate per 100 patient years 16 Risk of retinopathy progression 16 Risk of developing microalbuminuria 12 12 8 8 4 0 0 5 6
More informationZ. Skrivanek 1, B. L. Gaydos 1,J.Y.Chien 1,M.J.Geiger 2,M.A.Heathman 1, S. Berry 3, J. H. Anderson 4, T. Forst 5, Z. Milicevic 1 & D.
Diabetes, Obesity and Metabolism 16: 748 756, 2014. 2014 John Wiley & Sons Ltd original article Dose-finding results in an adaptive, seamless, randomized trial of once-weekly dulaglutide combined with
More informationMetformin although effective has become obsolete
Metformin although effective has become obsolete Does not address core needs as well as other agents (ominous octet) Does not address metabolic parameters (blood pressure, Hgb A1C) as well as other agents
More informationANNEX I SUMMARY OF PRODUCT CHARACTERISTICS
ANNEX I SUMMARY OF PRODUCT CHARACTERISTICS 1 This medicinal product is subject to additional monitoring. This will allow quick identification of new safety information. Healthcare professionals are asked
More informationGLUCAGON LIKE PEPTIDE (GLP) 1 AGONISTS FOR THE TREATMENT OF TYPE 2 DIABETES, WEIGHT CONTROL AND CARDIOVASCULAR PROTECTION.
GLUCAGON LIKE PEPTIDE (GLP) 1 AGONISTS FOR THE TREATMENT OF TYPE 2 DIABETES, WEIGHT CONTROL AND CARDIOVASCULAR PROTECTION. Patricia Garnica MS, ANP-BC, CDE, CDTC Inpatient Diabetes Nurse Practitioner North
More informationMultiple Factors Should Be Considered When Setting a Glycemic Goal
Multiple Facts Should Be Considered When Setting a Glycemic Goal Patient attitude and expected treatment effts Risks potentially associated with hypoglycemia, other adverse events Disease duration Me stringent
More information2/9/2016. The Evolving Armamentarium for Type 2 Diabetes: Incorporating New Classes in the Treatment of Our Patients. Objectives: Pharmacists
WAYNE STATE UNIVERSITY COLLEGE OF PHARMACY & HEALTH SCIENCES FEBRUARY 28, 2016 The Evolving Armamentarium for Type 2 Diabetes: Clinical Assistant Professor, Department of Pharmacy Practice Ambulatory Care
More informationManagement of Type 2 Diabetes
Management of Type 2 Diabetes Pathophysiology Insulin resistance and relative insulin deficiency/ defective secretion Not immune mediated No evidence of β cell destruction Increased risk with age, obesity
More informationInjectable GLP 1 therapy: weight loss effects seen in obesity with and without diabetes
Injectable GLP 1 therapy: weight loss effects seen in obesity with and without diabetes Dr Masud Haq Consultant Lead in Diabetes & Endocrinology Maidstone & Tunbridge Wells NHS Trust & The London Preventative
More informationINJECTABLE THERAPY FOR THE TREATMENT OF DIABETES
INJECTABLE THERAPY FOR THE TREATMENT OF DIABETES ARSHNA SANGHRAJKA DIABETES SPECIALIST PRESCRIBING PHARMACIST OBJECTIVES EXPLORE THE TYPES OF INSULIN AND INJECTABLE DIABETES TREATMENTS AND DEVICES AVAILABLE
More informationThe first stop for professional medicines advice
London Medicines Evaluation Network Overview: Glucagon-Like Peptide-1 receptor analogues The first stop for professional medicines advice 1 London Medicines Evaluation Network Overview: Glucagon-Like Peptide-1
More informationNew Drug Evaluation: Dulaglutide
Copyright 2012 Oregon State University. All Rights Reserved Drug Use Research & Management Program Oregon State University, 500 Summer Street NE, E35, Salem, Oregon 97301-1079 Phone 503-947-5220 Fax 503-947-1119
More informationGLP-1 receptor agonists for type 2 diabetes currently available in the U.S.
GLP-1 receptor agonists for type 2 diabetes currently available in the U.S. GLP-1 agonists are a class of antidiabetic agents that mimic the actions of the glucagon-like peptide. GLP-1 is one of several
More informationGLP-1. GLP-1 is produced by the L-cells of the gut after food intake in two biologically active forms It is rapidly degraded by DPP-4.
GLP-1 GLP-1 is produced by the L-cells of the gut after food intake in two biologically active forms It is rapidly degraded by DPP-4 Food intake éinsulin Gut églucose uptake Pancreas Beta cells Alpha cells
More informationdulaglutide 0.75mg and 1.5mg solution for injection in pre-filled pen (Trulicity ) SMC No. (1110/15) Eli Lilly and Company Ltd.
dulaglutide 0.75mg and 1.5mg solution for injection in pre-filled pen (Trulicity ) SMC No. (1110/15) Eli Lilly and Company Ltd. 04 December 2015 The Scottish Medicines Consortium (SMC) has completed its
More informationGLP-1 (glucagon-like peptide-1) Agonists (Byetta, Bydureon, Tanzeum, Trulicity, Victoza ) Step Therapy and Quantity Limit Criteria Program Summary
OBJECTIVE The intent of the GLP-1 (glucagon-like peptide-1) s (Byetta/exenatide, Bydureon/ exenatide extended-release, Tanzeum/albiglutide, Trulicity/dulaglutide, and Victoza/liraglutide) Step Therapy
More informationEarly treatment for patients with Type 2 Diabetes
Israel Society of Internal Medicine Kibutz Hagoshrim, June 22, 2012 Early treatment for patients with Type 2 Diabetes Eduard Montanya Hospital Universitari Bellvitge-IDIBELL CIBERDEM University of Barcelona
More informationTREATMENTS FOR TYPE 2 DIABETES. Susan Henry Diabetes Specialist Nurse
TREATMENTS FOR TYPE 2 DIABETES Susan Henry Diabetes Specialist Nurse How can we improve outcomes in Type 2 diabetes? Earlier diagnosis Better patient education Stress central role of lifestyle management
More informationHow to apply novel outcome data. to clinical practice. Preventing Cardiovascular Disease in Patients with T2DM
Preventing Cardiovascular Disease in Patients with T2DM How to apply novel outcome data with GLP-1 RA to clinical practice Lars Rydén Department of Medicine K2 Karolinska Institutet Stockholm, Sweden Ljubljana
More informationDr Matthew Coghlan Novo Nordisk
Dr Matthew Coghlan Novo Nordisk Preventing diabetes and its complications Matthew Coghlan PhD Senior Director Search & Evaluation Global Drug Discovery Novo Nordisk A/S Obesity rates worldwide are increasing
More informationChief of Endocrinology East Orange General Hospital
Targeting the Incretins System: Can it Improve Our Ability to Treat Type 2 Diabetes? Darshi Sunderam, MD Darshi Sunderam, MD Chief of Endocrinology East Orange General Hospital Age-adjusted Percentage
More informationInsulin Initiation and Intensification. Disclosure. Objectives
Insulin Initiation and Intensification Neil Skolnik, M.D. Associate Director Family Medicine Residency Program Abington Memorial Hospital Professor of Family and Community Medicine Temple University School
More informationDept of Diabetes Main Desk
Dept of Diabetes Main Desk 01202 448060 Glucose management in Type 2 Diabetes in Adults The natural history of type 2 diabetes is for HbA1c to deteriorate with time. A stepwise approach to treatment is
More informationPractical Strategies for the Clinical Use of Incretin Mimetics CME/CE. CME/CE Released: 09/15/2009; Valid for credit through 09/15/2010
Practical Strategies for the Clinical Use of Incretin Mimetics CME/CE Robert R. Henry, MD Authors and Disclosures CME/CE Released: 09/15/2009; Valid for credit through 09/15/2010 Introduction Type 2 diabetes
More informationGlucagon-like peptide-1 (GLP-1) Agonists Drug Class Prior Authorization Protocol
Glucagon-like peptide-1 (GLP-1) Agonists Drug Class Prior Authorization Protocol Line of Business: Medicaid P&T Approval Date: February 21, 2018 Effective Date: April 1, 2018 This policy has been developed
More informationDisclosure. Learning Objectives. Case. Diabetes Update: Incretin Agents in Diabetes-When to Use Them? I have no disclosures to declare
Disclosure Diabetes Update: Incretin Agents in Diabetes-When to Use Them? I have no disclosures to declare Spring Therapeutics Update 2011 CSHP BC Branch Anar Dossa BScPharm Pharm D CDE April 20, 2011
More informationexenatide 2mg powder and solvent for prolonged-release suspension for injection (Bydureon ) SMC No. (748/11) Eli Lilly and Company Limited
exenatide 2mg powder and solvent for prolonged-release suspension for injection (Bydureon ) SMC No. (748/11) Eli Lilly and Company Limited 09 December 2011 The Scottish Medicines Consortium (SMC) has completed
More informationScottish Medicines Consortium
Scottish Medicines Consortium liraglutide 6mg/mL prefilled pen for injection (3mL) (Victoza ) Novo Nordisk Ltd. No. (585/09) 06 November 2009 The Scottish Medicines Consortium (SMC) has completed its assessment
More informationIncredible Incretins Abby Frye, PharmD, BCACP
Incredible Incretins Abby Frye, PharmD, BCACP Objectives & Disclosures Review the pathophysiology of T2DM and the impact of the incretin system Describe the defining characteristics of the available glucagonlike
More informationHow can we improve outcomes in Type 2 diabetes?
How can we improve outcomes in Type 2 diabetes? Earlier diagnosis Better patient education Stress central role of lifestyle management Identify and treat all risk factors Use rational pharmacological therapy
More informationUpdate on GLP-1 Agonists in Type 2 Diabetes is supported by an educational grant from Novo Nordisk Inc. It has been accredited by the American
Update on GLP-1 Agonists in Type 2 Diabetes is supported by an educational grant from Novo Nordisk Inc. It has been accredited by the American Association of Diabetes Educators (AADE) for nurses, dietitians,
More informationThis program applies to Commercial, GenPlus and Health Insurance Marketplace formularies.
OBJECTIVE The intent of the GLP-1 (glucagon-like peptide-1) Agonists [Adlyxin (lixisenatide), Byetta (exenatide), Bydureon (exenatide extended-release), Tanzeum (albiglutide), Trulicity (dulaglutide),
More informationApproaches to Addressing Incretin Deficiency. Non-Insulin Injectable Agents. Incretin Mimetics. Exendin-4 in the Gila Monster
Non-Insulin Injectable Agents Approaches to Addressing Incretin Deficiency Longer-acting analogs? (Incretin mimetics) GLP-1 Analogs Inhibition of inactivation? (Incretin enhancers) DPP-4 Inhibitors Drucker
More informationAlbiglutide, a Once-Weekly GLP-1RA, for the Treatment of Type 2 Diabetes
St. Onge et al. Medical Research Archives, vol. 5, issue 11, November 2017 issue Page 1 of 10 REVIEW ARTICLE Albiglutide, a Once-Weekly GLP-1RA, for the Treatment of Type 2 Diabetes Erin St. Onge 1*, Shannon
More informationGlucose Control drug treatments
Glucose Control drug treatments It should be noted that glitazones are under suspicion of precipitating acute cardiac events and current recommendations contraindicate the use of glitazones in patients
More informationADA Analyst Presentation Saturday 9 th June
ADA Analyst Presentation Saturday 9 th June Carlo Russo Senior Vice-President & Albiglutide Team Leader, GSK Property of GlaxoSmithKline Agenda Welcome & introduction to the Harmony Clinical Programme
More informationCurrent Status of Incretin Based Therapies in Type 2 Diabetes
Current Status of Incretin Based Therapies in Type 2 Diabetes DR.M.Mukhyaprana Prabhu Professor of Internal Medicine Kasturba Medical College, Manipal, Manipal University, India 2 nd International Endocrine
More informationBeyond A1C. Non-glycemic Effects of GLP-1 Receptor Agonists. Olga Astapova MD, PhD Luis Chavez MD URMC Endocrinology Fellows
Beyond A1C Non-glycemic Effects of GLP-1 Receptor Agonists Olga Astapova MD, PhD Luis Chavez MD URMC Endocrinology Fellows Disclosures No conflicts of interest. Learning Objectives 1. Understand the physiological
More informationTranslating GLP-1 trial outcomes to cardiology practice
Translating GLP-1 trial outcomes to cardiology practice Which patients will benefit? Lars Rydén Senior Professor Department of Medicine K2 Karolinska Institutet Stockholm, Sweden Munich August 27, 2018
More informationYOU HAVE DIABETES. Angie O Connor Community Diabetes Nurse Specialist 25th September 2013
YOU HAVE DIABETES Angie O Connor Community Diabetes Nurse Specialist 25th September 2013 Predicated 2015 figures are already met 1 in 20 have diabetes:1in8 over 60years old Definite Diagnosis is key Early
More informationNew and Emerging Therapies for Type 2 DM
Dale Clayton MHSc, MD, FRCPC Dalhousie University/Capital Health April 28, 2011 New and Emerging Therapies for Type 2 DM The science of today, is the technology of tomorrow. Edward Teller American Physicist
More informationDM-2 Therapy Update: GLP-1, SGLT-2 Inhibitors, and Inhaled Insulin, Oh My!
DM-2 Therapy Update: GLP-1, SGLT-2 Inhibitors, and Inhaled Insulin, Oh My! Kevin M. Pantalone, DO, ECNU, CCD Associate Staff Director of Clinical Research Department of Endocrinology Endocrinology and
More informationUpdate on Therapies for Type 2 Diabetes: Angela D. Mazza, DO July 31, 2015
Update on Therapies for Type 2 Diabetes: 2015 Angela D. Mazza, DO July 31, 2015 Objectives To present the newer available therapies for the management of T2D To discuss the advantages and disadvantages
More informationSemaglutide the new kid on the block in the field of glucagonlike peptide-1 receptor agonists?
Editorial Page 1 of 5 Semaglutide the new kid on the block in the field of glucagonlike peptide-1 receptor agonists? Cristian Guja 1,2, Rucsandra Dănciulescu Miulescu 1,2 1 National Institute of Diabetes,
More information1. Describe the relationship of dietary protein and the health of major body systems.
Food Explorations Lab I: The Building Blocks STUDENT LAB INVESTIGATIONS Name: Lab Overview In this investigation, you will be constructing animal and plant proteins using beads to represent the amino acids.
More informationLAB#23: Biochemical Evidence of Evolution Name: Period Date :
LAB#23: Biochemical Evidence of Name: Period Date : Laboratory Experience #23 Bridge Worth 80 Lab Minutes If two organisms have similar portions of DNA (genes), these organisms will probably make similar
More informationBYETTA exenatide injection
BYETTA exenatide injection DESCRIPTION BYETTA (exenatide) is a synthetic peptide that has incretin-mimetic actions and was originally identified in the lizard Heloderma suspectum. BYETTA enhances glucose-dependent
More informationEXENATIDE (BYETTA ) PROTOCOL, 5mcg and 10mcg SC injection pre-filled pens
EXENATIDE (BYETTA ) PROTOCOL, 5mcg and 10mcg SC injection pre-filled pens This document should be read in conjunction with the current Summary of Product Characteristics http://www.medicines.org.uk 1.
More informationAdlyxin. (lixisenatide) New Product Slideshow
Adlyxin (lixisenatide) New Product Slideshow Introduction Brand name: Adlyxin Generic name: Lixisenatide Pharmacological class: Glucagon-like peptide-1 (GLP-1) receptor agonist Strength and Formulation:
More informationNewer and Expensive treatment of diabetes. Endocrinology Visiting Associate Professor Institute of Medicine TUTH
Newer and Expensive treatment of diabetes Jyoti Bhattarai MD Endocrinology Visiting Associate Professor Institute of Medicine TUTH Four out of every five people with diabetes now live in developing countries.
More informationIncretin-based Therapies for Type 2 Diabetes Comparisons Between Glucagon-like Peptide-1 Receptor Agonists and Dipeptidyl Peptidase-4 Inhibitors
Incretin-based Therapies for Type 2 Diabetes Comparisons Between Glucagon-like Peptide-1 Receptor Agonists and Dipeptidyl Peptidase-4 Inhibitors Timothy Bailey, MD, FACE, CPI Director, AMCR Institute,
More informationSafety profile of Liraglutide: Recent Updates. Mohammadreza Rostamzadeh,M.D.
Safety profile of Liraglutide: Recent Updates Mohammadreza Rostamzadeh,M.D. Pancreatitis: Victoza post-marketing experience: spontaneous reports of pancreatitis For the majority of the cases, there is
More informationGLP-1 Receptor Agonists and SGLT-2 Inhibitors. Debbie Hicks
GLP-1 Receptor Agonists and SGLT-2 Inhibitors Debbie Hicks Prescribing and Adverse Event reporting information is available at this meeting from the AstraZeneca representative The views expressed by the
More informationAmino Acids. Amino Acids. Fundamentals. While their name implies that amino acids are compounds that contain an NH. 3 and CO NH 3
Fundamentals While their name implies that amino acids are compounds that contain an 2 group and a 2 group, these groups are actually present as 3 and 2 respectively. They are classified as α, β, γ, etc..
More informationTreatment Options for Diabetes: An Update
Treatment Options for Diabetes: An Update A/Prof. Marg McGill Manager, Diabetes Centre Dr. Ted Wu Staff Specialist Endocrinologist Diabetes Centre Centre of Health Professional Education Education Provider
More informationRole of incretins in the treatment of type 2 diabetes
Role of incretins in the treatment of type 2 diabetes Jens Juul Holst Department of Medical Physiology Panum Institute University of Copenhagen Denmark Diabetes & Obesity Spanish Society of Internal Medicine
More informationSee 17 for PATIENT COUNSELING INFORMATION and Medication Guide. Revised: 02/2013
HIGHLIGHTS OF PRESCRIBING INFORMATION These highlights do not include all the information needed to use BYETTA safely and effectively. See full prescribing information for BYETTA. Injection Initial U.S.
More informationGLP-1 Agonists for Diabetes
Applies to all products administered or underwritten by Blue Cross and Blue Shield of Louisiana and its subsidiary, HMO Louisiana, Inc.(collectively referred to as the Company ), unless otherwise provided
More informationPresented By: Creative Educational Concepts, Inc. Lexington, KY
Disclaimer This slide deck in its original and unaltered format is for educational purposes and is current as of April 2015. The content and views presented in this educational activity are those of the
More informationPRODUCT INFORMATION VICTOZA. liraglutide
Victoza_pi6a.docx Page 1 of 21 PRODUCT INFORMATION VICTOZA liraglutide NAME OF THE MEDICINE Victoza (liraglutide (rys)) solution for injection. Liraglutide (rys) has the molecular formula C 172 H 265 N
More informationVICTOSA and Renal impairment DR.R.S.SAJAD
VICTOSA and Renal impairment DR.R.S.SAJAD February 2019 Main effect of GLP-1 is : Stimulating glucose dependent insulin release from the pancreatic islets. Slow gastric emptying Inhibit inappropriate
More informationOBESITY IN TYPE 2 DIABETES
OBESITY IN TYPE 2 DIABETES Ashley Crowl, PharmD, BCACP Assistant Professor University of Kansas Objectives Review how to manage obesity in patients with type-2 diabetes mellitus Compare antiobesity agents
More informationDrugs used in Diabetes. Dr Andrew Smith
Drugs used in Diabetes Dr Andrew Smith Plan Introduction Insulin Sensitising Drugs: Metformin Glitazones Insulin Secretagogues: Sulphonylureas Meglitinides Others: Acarbose Incretins Amylin Analogues Damaglifozin
More informationDrug Use Criteria: Glucagon-Like Peptide 1 Receptor Agonists
Texas Vendor Drug Program Drug Use Criteria: Glucagon-Like Peptide 1 Receptor Agonists Publication History Developed February 2006. Revised September 2018; September 2016; June 2015; October 2013; December
More informationGlucagon-like polypeptide agonists in type 2 diabetes mellitus: efficacy and tolerability, a balance
580257TAE0010.1177/2042018815580257Therapeutic Advances in Endocrinology and MetabolismSH Tella and MS Rendell research-article2015 Therapeutic Advances in Endocrinology and Metabolism Review Glucagon-like
More informationFrancesca Porcellati
XX Congresso Nazionale AMD Razionali e Benefici dell Aggiunta del GLP-1 RA Short-Acting all Insulina Basale Francesca Porcellati Dipartimento di Medicina Interna, Sezione di Medicina Interna, Endocrinologia
More informationNATIONAL INSTITUTE FOR HEALTH AND CARE EXCELLENCE. Single Technology Appraisal. Canagliflozin in combination therapy for treating type 2 diabetes
NATIONAL INSTITUTE FOR HEALTH AND CARE EXCELLENCE Single Technology Appraisal Canagliflozin in combination therapy for Final scope Remit/appraisal objective To appraise the clinical and cost effectiveness
More informationOriginal. Shizuka Kaneko 1), Tomonori Oura 2), Akiko Matsui 2), Tomotaka Shingaki 2) and Masakazu Takeuchi 2)
2017, 64 (12), 1165-1172 Original Efficacy and safety of subgroup analysis stratified by baseline HbA1c in a Japanese phase 3 study of dulaglutide 0.75 mg compared with insulin glargine in patients with
More informationFARXIGA (dapagliflozin) Jardiance (empagliflozin) tablets. Synjardy (empagliflozin and metformin hydrochloride) tablets. GLUCOPHAGE* (metformin)
Type 2 Medications Drug Class How It Works Brand and Generic Names Manufacturers Usual Starting Dose The kidneys filter sugar and either absorb it back into your body for energy or remove it through your
More informationDiabetes: Three Core Deficits
Diabetes: Three Core Deficits Fat Cell Dysfunction Impaired Incretin Function Impaired Appetite Suppression Obesity and Insulin Resistance in Muscle and Liver Hyperglycemia Impaired Insulin Secretion Islet
More informationDiabetes and Current Therapeutics
Diabetes and Current Therapeutics MacMillan Group Meeting April 4, 2012 Scott Simonovich Definition and World Prevalence Diabetes mellitus Metablic disease in which abnormally high blood glucose levels
More informationBYDUREON (exenatide extended-release) for injectable suspension, for subcutaneous use Initial U.S. Approval: 2005
US-19553 HIGHLIGHTS OF PRESCRIBING INFORMATION These highlights do not include all the information needed to use BYDUREON safely and effectively. See full prescribing information for BYDUREON. BYDUREON
More informationWhat s New in Diabetes Medications. Jena Torpin, PharmD
What s New in Diabetes Medications Jena Torpin, PharmD 1 Objectives Discuss new medications in the management of diabetes Understand the mechanism of the medications discussed Understand the side effects
More informationErtugliflozin (Steglatro ) 5 mg daily. May increase to 15 mg daily. Take in the morning +/- food. < 60: Do not initiate; discontinue therapy
Sodium-glucose Cotransporter-2 (SGLT2) s Inhibit SGLT in proximal renal tubules, reducing reabsorption of filtered glucose from tubular lumen Lowers renal threshold for glucose à increase urinary excretion
More informationAdvances in Outpatient Diabetes Care: Algorithms for Care and the Role of Injectable Therapies. Module D
Advances in Outpatient Diabetes Care: Algorithms for Care and the Role of Injectable Therapies Module D 1 Learning Objectives Apply the principles of the comprehensive diabetes algorithms to patients with
More informationEFFECTIVE SHARE CARE AGREEMENT. FOR THE off license use of GLP1 mimetics in combination with insulin IN DUDLEY
Specialist details Patient identifier Name Tel: EFFECTIVE SHARE CARE AGREEMENT FOR THE off license use of GLP1 mimetics in combination with insulin IN DUDLEY The aim of Effective Shared Care Guidelines
More informationNewer Drugs in the Management of Type 2 Diabetes Mellitus
Newer Drugs in the Management of Type 2 Diabetes Mellitus Dr. C. Dinesh M. Naidu Professor of Pharmacology, Kamineni Institute of Medical Sciences, Narketpally. 1 Presentation Outline Introduction Pathogenesis
More informationGLP-1 RECEPTOR AGONIST SHOULD I TRY IT? VERONICA BRADY, PHD, BC-ADM, CDE PROJECT ECHO JUNE 21, 2018
GLP-1 RECEPTOR AGONIST SHOULD I TRY IT? VERONICA BRADY, PHD, BC-ADM, CDE PROJECT ECHO JUNE 21, 2018 SOMETHING TO CONSIDER IF YOU COULD PRESCRIBE A MEDICATION FOR YOUR PATIENT WITH DIABETES THAT: DECREASED
More informationNew Treatments for Type 2 diabetes. Nandini Seevaratnam April 2016 Rushcliffe Patient Forum
New Treatments for Type 2 diabetes Nandini Seevaratnam April 2016 Rushcliffe Patient Forum Overview Growing population of Type 2 diabetes Basic science on what goes wrong Current treatments Why there is
More informationAgenda. Indications Different insulin preparations Insulin initiation Insulin intensification
Insulin Therapy F. Hosseinpanah Obesity Research Center Research Institute for Endocrine sciences Shahid Beheshti University of Medical Sciences November 11, 2017 Agenda Indications Different insulin preparations
More informationBIOCHEMISTRY REVIEW. Overview of Biomolecules. Chapter 4 Protein Sequence
BIOCHEMISTRY REVIEW Overview of Biomolecules Chapter 4 Protein Sequence 2 3 4 Are You Getting It?? A molecule of hemoglobin is compared with a molecule of lysozyme. Which characteristics do they share?
More informationSummary. Introduction REVIEW ARTICLE. Johan Jendle 1 * George Grunberger 2 Thomas Blevins 3 Francesco Giorgino 4 Ryan T. Hietpas 5 Fady T.
REVIEW ARTICLE DIABETES/METABOLISM RESEARCH AND REVIEWS Diabetes Metab Res Rev 2016; 32: 776 790. Published online 15 May 2016 in Wiley Online Library (wileyonlinelibrary.com).2810 Efficacy and safety
More informationPRODUCT INFORMATION VICTOZA. liraglutide
Victoza pi8.docx Page 1 of 23 NAME OF THE MEDICINE PRODUCT INFORMATION VICTOZA liraglutide Victoza (liraglutide (rys)) 6 mg/ml solution for injection in a pre-filled pen. Liraglutide (rys) has the molecular
More informationDR. SUBHASH K. WANGNOO
Photograph DR. SUBHASH K. WANGNOO M.D, D.M, FRCP (London) Senior Consultant, Endocrinologist & Diabetologist Apollo Centre for Obesity, Diabetes and Endocrinology Indraprastha Apollo Hospital, Sarita Vihar,
More informationExploring Non-Insulin Therapies in Type 1 Diabetes
Exploring Non-Insulin Therapies in Type 1 Diabetes Susan Cornell, BS, PharmD, CDE, FAPhA, FAADE Associate Professor Midwestern University - Chicago College of Pharmacy Disclosures Dr. Cornell: Advanced
More informationThere have been important changes in diabetes care which may not be covered in undergraduate textbooks.
Diabetes Clinical update There have been important changes in diabetes care which may not be covered in undergraduate textbooks. Changes in the diagnosis of diabetes a) HbA1C Since 2011, World Health Organisation
More informationThe Many Faces of T2DM in Long-term Care Facilities
The Many Faces of T2DM in Long-term Care Facilities Question #1 Which of the following is a risk factor for increased hypoglycemia in older patients that may suggest the need to relax hyperglycemia treatment
More informationNew York State Medicaid Prescriber Education Program
New York State Medicaid Prescriber Education Program Metformin as a first-line medication Treating type 2 diabetes mellitus Key messages 1) Metformin should be used as a first-line medication in almost
More informationNon-insulin treatment in Type 1 DM Sang Yong Kim
Non-insulin treatment in Type 1 DM Sang Yong Kim Chosun University Hospital Conflict of interest disclosure None Committee of Scientific Affairs Committee of Scientific Affairs Insulin therapy is the mainstay
More informationEli Lilly and Company Investment Community Meeting
Eli Lilly and Company Investment Community Meeting October 3, 2013 8:30 a.m. 12:30 p.m. Safe Harbor Provision This presentation contains forward-looking statements that are based on management's current
More informationMANAGEMENT OF TYPE 2 DIABETES
MANAGEMENT OF TYPE 2 DIABETES 3 Month trial of lifestyle changes. Refer to DESMOND structured education programme. Set glycaemic target HbA1c < 7.0% (53mmol/mol) or individualised If HbA1c > 53mmol/mol
More informationChemical Nature of the Amino Acids. Table of a-amino Acids Found in Proteins
Chemical Nature of the Amino Acids All peptides and polypeptides are polymers of alpha-amino acids. There are 20 a- amino acids that are relevant to the make-up of mammalian proteins (see below). Several
More information