SMPD 287 Spring 2015 Bioinformatics in Medical Product Development. Final Examination
|
|
- Dulcie Valerie Stevenson
- 5 years ago
- Views:
Transcription
1 Final Examination You have a choice between A, B, or C. Please your solutions, as a pdf attachment, by May 13, In the subject of the , please use the following format: firstname_lastname_x were X is either A, B, or C, depending on your choice. [A] From: Discovering Genomics, Proteomics, & Bioinformatics Chapter One, Section 1.1: First Patients Objectives: 1) Discover the complexity of apparently simple genetic diseases. 2) Use online bioinformatics tools to uncover new information. 3) Visualize protein connections and 3D structures. You are going to answer discovery questions 1 to 14 from Section One of What is wrong with my child? Skip the Math Minute 1.1, pages 7 and 8. Problem 1 Phase I: Clinical Presentation and Phase II: Family Pedigree DQ1: Spend about 5 to 10 minutes, as mentioned in the book. Not more. DQ2: To get to Genes and Disease From NCBI s main page Click on Genes & Expression under Resource List (A-Z) on the left hand side of the page Scroll down and click on Genes and Disease (By performing the following we can get to DMD: Click on Muscle and Bone from the new page Scroll down and click on Duchenne muscular dystrophy ) Alternatively: Go to wps.aw.com/bc_campbell_genomics_2/ Click on Genes and Diseases under Links DQ3: Do not spend more than 10 minutes, as mentioned in the book. DQ4: Do not spend more than 10 minutes, as mentioned in the book. Terms to know: histology Problem 2 Phase III: Karyotyping and Linkage Analysis Answer discovery questions 5 to 8. Terms to know: RFLP markers 2015 Sami Khuri 1
2 Problem 3 Phase IV: DNA Sequence Analysis Answer discovery questions 9 to 12. For discovery questions 10, 11, and 12, follow the instructions given in the hand-out. DQ10: Go to wps.aw.com/bc_campbell_genomics_2/ Click on locus of interest under Data From the new page Genetic Disease Sequences, scroll down and copy the sequence found under: Sequence which was conserved in all family members : NICKECPIIGFRYRSLKHFNYDICQSCFF. Go to the BLAST webpage at NCBI Click on protein blast under Basic BLAST Paste the sequence in the window Scroll down and choose Show results in a new window Click on the blue BLAST button. Inspect the top 20 to 25 hits and the bottom 20 to 25 hits. a) Do most of the top hits yield dystrophin in different species? Is the e-value significant? b) Do most of the bottom hits yield utrophin in different species? Is the e-value significant? c) What is the accession number of the top hit? When was it last updated? DQ11: Go to wps.aw.com/bc_campbell_genomics_2/ Click on PDB under Links. Alternatively, go to Enter the code 1dxx and click on the search button. Click on Protein Workshop (on the right hand side of the page). From the new page with title: RSCB PDB Protein Workshop (powdered by the MBT): 1DXX, click on the Visibility button. Click on the small + sign next to Chain A to view the amino acids with their positions. Scroll to 54 LEU and click on it. This will put a small mark on the graph. You might have to rotate the molecule with the mouse to be able to see the position of leucine on the graph. Recall that instead of Leucine (in position 54), BB and GG have Arginine (see Table 1.1). In what kind of secondary structure of the protein does this mutation lie? Now choose Labels from Select your tool Choose Label by residues from Change the tool s options, if necessary Sami Khuri 2
3 Click once more on 54 Leu to see the position of leucine on the molecule. DQ12: In this exercise, we will do the same as DQ11, except that we will highlight the sequence DVQKKTFTKW from position 15 to 24, instead of just amino acid leucine in position 54. We will use two methods: Protein Workshop and Sequence details. A) Protein Workshop Go to wps.aw.com/bc_campbell_genomics_2/ Click on locus of interest under Data From the new page Genetic Disease Sequences, scroll down and copy the sequence found under: Find this sequence. Go once again to wps.aw.com/bc_campbell_genomics_2/ Click on PDB under Links. Alternatively, go to Enter the code 1dxx and click on the Search button. Click on Protein Workshop (on the right-hand side of the page). From the new page with title: PDB Protein Workshop (powdered by the MBT): 1DXX, click on the Visibility button. Click on the small + sign next to Chain A to view the amino acids with their positions. Scroll to 15 ASP click on it, push the shift key and click on 24 TRP. This will choose all the amino acids from position 15 to 24 and will put small marks on the graph. You might have to rotate the molecule with mouse to be able to see the position of the 10 amino acids on the graph. a) In what kind of secondary structure of the protein does this mutation lie? Go once again to wps.aw.com/bc_campbell_genomics_2/ Click on PDB under Links. Alternatively, go to Enter the code 1dxx and click on the search button. From the new page, click on Sequence tab from the menu bar in the upper half of the page. Scroll down and inspect the sequence. b) What kind of secondary structure of the protein does the peptide help form? Problem 4 Answer discovery questions 13 and 14. DQ13: Do not spend too much time on this question. Just try to formulate an educated guess. DQ14: Do not spend too much time on this question. Just try to formulate an educated guess. Terms to know: dystrophin 2015 Sami Khuri 3
4 Chapter One, Section 1.2: The Next Step in Understanding the Disease - Continuation Objectives: 1) Discover the complexity of apparently simple genetic diseases. 2) Use online bioinformatics tools to uncover new information. 3) Visualize protein connections and 3D structures. 4) Understand the value of a model research organism. 5) Recognize diagrams of interacting components as circuit diagrams. You are going to answer discovery questions 24 to 32 from Section Two of What is wrong with my child? Read pages 13 to 20 (up to DQ 32) and answer the discovery questions as you go along. Skip Math Minute 1.3. Problem 5 Solve Discovery Questions 24 to 29. DQ28: Go to NCBI at: Select Protein from the Search drop-down menu. Enter the word sarcoglycan and hit the blue Search button to search the protein database. From the new page, you will see Homo sapiens (113) on the right hand side of the page. Click on (113) to get the human sarcoglycans. How many different human sarcoglycan genes are there? You know there are at least four, but can you find more sarcoglycans? Terms to know: penetrance Problem 6 Solve Discovery Questions 30, 31, and 32. DQ32: Follow the instructions in the textbook. If you want to narrow down the number of hits, try dystrophy* AND signal. Terms to know: consanguineous, founder effect, digenic Sami Khuri 4
5 [B] Thalassemia Beta Thalassemia by Antonio Cao and Renzo Galanello, was published in Genetics in Medicine in 2010 (vol. 12, issue 2, pages 61-76). 1) Explain in your own words Figure 1 and Figure 2 one paragraph for each figure. 2) Explain in your own words Figure 4. Fully explain every single part of Fig 4. 3) Figure 3 of the article gives the mutations of the β globin gene associated with the phenotypes in the β-thalassemias in the Mediterranean Region and in the Asian Region. Choose 3 mutations from each region (6 mutations in all) that were not covered in the class, and for each mutation (as was done in the course): a) locate the mutation on the sequence, b) explain what consequences on the protein it might have (as was done in the course). 4) Recall the upper half of Table 1 of Changes in the Epidemiology of Thalassemia in North America: A New Minority Disease by Elliott P. Vichinsky, et al. we studied in class. Where do you think the majority of the patients reported in Table 1 originally come from? [C] Origin of HIV We are going to build phylogenetic trees with 12 sequences from HIV1, HIV2 and SIV. The sequences are from NCBI. The table lists, from left to right: Num: the number representing the order in which the sequences were obtained from NCBI Isolate: the isolate names of the genomes as given by NCBI Accession Number: GenBank accession numbers of the whole genomes Length in base pairs: the length of the genome Posted Entry Date: the date found in the corresponding database entry Organism: the organism to which the genome belongs. Num Isolate Accession Length in Posted Entry Date Organism Number base pairs 1 HIV1_ELI K FEB-2002 Human 2 HIV1_BRU K AUG-1993 Human 3 HIV1_MAL X APR-2005 Human 4 HIV1_NDK M AUG-1993 Human 5 HIV2_D205 X NOV-2006 Human 6 HIV2_ROD M MAY-1996 Human 7 HIV2_ST M MAY-1996 Human 8 HIV2_UCI L AUG-1993 Human 9 SIV_Mm251 M NOV-2000 Macaque 10 SIV_CPZ X APR-2005 Chimpanzee 11 SIV_AGM M MAR-2006 Af. green monkey 12 SIV_SMM X APR-2005 Sooty mangabey mk Sami Khuri 5
6 Three files, env_protein_sequences.txt, gag_protein_sequences.txt, and pol_protein_sequences.txt containing the amino acid sequences for the env, gag and pol proteins from the 12 isolates were created. In other words: o env_protein_sequences.txt contains 12 env protein sequences, one from each of the 12 genomes found in the table. o gag_protein_sequences.txt contains 12 gag protein sequences, one from each of the 12 genomes found in the table. o pol_protein_sequences.txt contains 12 pol protein sequences, one from each of the 12 genomes found in the table. Part A: Retrieve env_protein_sequences.txt and copy all 12 sequences. Go to and paste all 12 sequences in the window. Click on More options under STEP 2 and open the dropdown window under OUTPUT FORMAT. Choose PHYLIP from the pull-down menu. We need to have the resulting alignment in the phylip format for subsequent steps. Click on Submit of STEP 3 to align the 12 env protein sequences and wait for the result. The new page contains the actual alignment. The multiple sequence alignment is preceded by 2 numbers: o The first number represents the number of sequences (rows). In our example: 12. o The second represents the total number of columns in the alignment. In our example: 950. Use Download Alignment File to save the alignment under clustaloenv.txt on your desktop. In a new window: Go We are going to use the PHYLIP package to construct phylogenetic trees. Click on phylogeny under Programs Click on distance and then on protdist. The protdist program from the PHYLIP package will compute the pairwise distances of the 12 sequences from the multiple sequence alignment Sami Khuri 6
7 Copy the entire content of the clustalo-env.txt you obtained above, including the first row with the two numbers, and paste it in the Phylip protdist window. o Alternatively, you can choose the upload button under Alignment File by clicking on it and then clicking on Browse to upload clustalo-env.txt. Then choose clustalo-env.txt from the drop-down window next to select and click on select. The contents of clustalo-env.txt should appear in the display window. Enter your address in the appropriate window, after clicking on set at the top of the PHYLIP page, on the right-hand side. Scroll down to Bootstrap options and choose Yes in the box to the right of Perform a bootstrap before analysis?. Type 1 in the window to the right of Random number seed (must be odd). The random seed is used to get randomness in the bootstrap algorithm. Keep the default value of 100 for the number of replicates. We want the package to calculate distance matrices for the 100 bootstrap replicates (the 100 problem instances that are randomly generated). Scroll up to the top of the page and click on the Run button. You might be prompted to validate your submission. Do it please. You will get a new page, and will have to wait (sometimes up to a few minutes) until you see an output file, protdist.outfile under Outfile (PhylipDistanceMatrix). You will also get messages from PHYLIP. The protdist.outfile file will be used as input file to PHYLIP s neighbor. Go to the row right underneath the protdist.outfile window (that starts with full screen ) and choose neighbor (inflile) from the drop-down window right before further analysis. Click on further analysis to obtain a new page. From the new page, click on advanced options Scroll down to Bootstrap options : o Choose Yes for Analyze multiple data sets (M) o Type 100 for How many data sets 2015 Sami Khuri 7
8 o Type 1 in the Random number seed for multiple dataset (must be odd) window o Choose Yes for Computer a consensus tree Scroll back up and click on Run. From the new page, you will have several different output files under results. We are interested in the very first one: consense.outfile. If you scroll down in that window, you will see the consensus tree produced by the 100 bootstrap runs. We would like to save consensus.outfile (in a readable format). Click on full screen right underneath the Consense output file Save the resulting page under env consensus Open the file you have just saved: env_consensus_outfile, and scroll down to see the consensus tree with the bootstrap values for each branch. Part B: 1) Repeat the procedure described in part A with gag_hiv_siv_sequences.txt and save the resulting consensus trees under gag_consense_outfile.txt. 2) Repeat the procedure described in part A with pol_hiv_siv_sequences.txt and save the resulting consensus trees under pol_consense_outfile.txt. Part C: Study carefully the three consensus trees and answer the following questions: 1) What do the trees show with regards to the HIV and SIV relationships? 2) Why do SIV s cluster with both HIV-1 and HIV-2? 3) Which HIV type, HIV-1 or HIV-2, is more closely related to the SIV from the sooty mangabey? Which type is more closely related to the SIV from the chimpanzee? What does this tell you about the origin of HIV-1 and HIV-2? This project was adapted from The Origin and Evolution of HIV from Siv Andersson s laboratory at Uppsala University, Sweden Sami Khuri 8
Hands-On Ten The BRCA1 Gene and Protein
Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such
More informationTerm Definition Example Amino Acids
Name 1. What are some of the functions that proteins have in a living organism. 2. Define the following and list two amino acids that fit each description. Term Definition Example Amino Acids Hydrophobic
More informationStudent Handout Bioinformatics
Student Handout Bioinformatics Introduction HIV-1 mutates very rapidly. Because of its high mutation rate, the virus will continue to change (evolve) after a person is infected. Thus, within an infected
More informationBioinformatics Laboratory Exercise
Bioinformatics Laboratory Exercise Biology is in the midst of the genomics revolution, the application of robotic technology to generate huge amounts of molecular biology data. Genomics has led to an explosion
More informationExploring HIV Evolution: An Opportunity for Research Sam Donovan and Anton E. Weisstein
Microbes Count! 137 Video IV: Reading the Code of Life Human Immunodeficiency Virus (HIV), like other retroviruses, has a much higher mutation rate than is typically found in organisms that do not go through
More informationProject Manual Bio3055. Cholesterol Homeostasis: HMG-CoA Reductase
Project Manual Bio3055 Cholesterol Homeostasis: HMG-CoA Reductase Bednarski 2003 Funded by HHMI Cholesterol Homeostasis: HMG-CoA Reductase Introduction: HMG-CoA Reductase is an enzyme in the cholesterol
More informationa. From the grey navigation bar, mouse over Analyze & Visualize and click Annotate Nucleotide Sequences.
Section D. Custom sequence annotation After this exercise you should be able to use the annotation pipelines provided by the Influenza Research Database (IRD) and Virus Pathogen Resource (ViPR) to annotate
More informationSection D. Identification of serotype-specific amino acid positions in DENV NS1. Objective
Section D. Identification of serotype-specific amino acid positions in DENV NS1 Objective Upon completion of this exercise, you will be able to use the Virus Pathogen Resource (ViPR; http://www.viprbrc.org/)
More informationSection B. Comparative Genomics Analysis of Influenza H5N2 Viruses. Objective
Section B. Comparative Genomics Analysis of Influenza H5N2 Viruses Objective Upon completion of this exercise, you will be able to use the Influenza Research Database (IRD; http://www.fludb.org/) to: Search
More informationModule 3. Genomic data and annotations in public databases Exercises Custom sequence annotation
Module 3. Genomic data and annotations in public databases Exercises Custom sequence annotation Objectives Upon completion of this exercise, you will be able to use the annotation pipelines provided by
More informationProject Manual Bio3055. Apoptosis: Superoxide Dismutase I
Project Manual Bio3055 Apoptosis: Superoxide Dismutase I Bednarski 2003 Funded by HHMI Apoptosis: Superoxide Dismutase I Introduction: Apoptosis is another name for programmed cell death. It is a series
More informationModule 3: Pathway and Drug Development
Module 3: Pathway and Drug Development Table of Contents 1.1 Getting Started... 6 1.2 Identifying a Dasatinib sensitive cancer signature... 7 1.2.1 Identifying and validating a Dasatinib Signature... 7
More informationName: Due on Wensday, December 7th Bioinformatics Take Home Exam #9 Pick one most correct answer, unless stated otherwise!
Name: Due on Wensday, December 7th Bioinformatics Take Home Exam #9 Pick one most correct answer, unless stated otherwise! 1. What process brought 2 divergent chlorophylls into the ancestor of the cyanobacteria,
More informationCreating YouTube Captioning
Creating YouTube Captioning Created June, 2017 Upload your video to YouTube Access Video Manager Go to Creator Studio by clicking the option from your account icon located in the topright corner of the
More informationFor all of the following, you will have to use this website to determine the answers:
For all of the following, you will have to use this website to determine the answers: http://blast.ncbi.nlm.nih.gov/blast.cgi We are going to be using the programs under this heading: Answer the following
More informationMaking a Room Reservation with Service Requests in Virtual EMS
Making a Room Reservation with Service Requests in Virtual EMS Step 1: Pull up Virtual EMS by navigating from any browser to schedule.ucdenver.edu/virtualems. Step 2: Navigate to My Account>>Log In>>Enter
More informationATLANTIS WebOrder. ATLANTIS ISUS User guide
ATLANTIS WebOrder ATLANTIS ISUS User guide Contents ATLANTIS WebOrder Entering an ATLANTIS ISUS order 3 ATLANTIS ISUS implant suprastructures 4 ATLANTIS ISUS Bar 5 ATLANTIS ISUS Bridge 7 ATLANTIS ISUS
More informationAggregate Report Instructions
Version 2018_v4 Workplace Health Solutions Center for Workplace Health Research & Evaluation Version 2018_v4 Table of Contents Purpose.....3 Data Privacy....3 About Life's Simple 7....4 Table 1. Life's
More informationBlueBayCT - Warfarin User Guide
BlueBayCT - Warfarin User Guide December 2012 Help Desk 0845 5211241 Contents Getting Started... 1 Before you start... 1 About this guide... 1 Conventions... 1 Notes... 1 Warfarin Management... 2 New INR/Warfarin
More information1. Go to and click on the GAPMINDER WORLD tab. What is the first thing you notice? (There are no wrong answers.)
1. Go to WWW.GAPMINDER.ORG and click on the GAPMINDER WORLD tab. What is the first thing you notice? (There are no wrong answers.) 2. What do the colors on the graph represent? Red: Lt. Blue: Dk. Blue
More informationWeb-based tools for Bioinformatics; A (free) introduction to (freely available) NCBI, MUSC and Worldwide.
Page 1 of 32 Web-based tools for Bioinformatics; A (free) introduction to (freely available) NCBI, MUSC and Worldwide. When and Where---Wednesdays 1-2pm Room 438 Library Admin Building Beginning September
More informationIMPaLA tutorial.
IMPaLA tutorial http://impala.molgen.mpg.de/ 1. Introduction IMPaLA is a web tool, developed for integrated pathway analysis of metabolomics data alongside gene expression or protein abundance data. It
More informationOneTouch Reveal Web Application. User Manual for Healthcare Professionals Instructions for Use
OneTouch Reveal Web Application User Manual for Healthcare Professionals Instructions for Use Contents 2 Contents Chapter 1: Introduction...4 Product Overview...4 Intended Use...4 System Requirements...
More informationSteps to Creating a New Workout Program
Steps to Creating a New Workout Program Step 1: Log into lab website: https://fitnessandhealthpromotion.ca/ a. If you have never logged in, use your FOL username without the @fanshaweonline.ca portion
More informationGoing Nowhere Fast: Lentivirus genetic sequence evolution does not correlate with phenotypic evolution.
Going Nowhere Fast: Lentivirus genetic sequence evolution does not correlate with phenotypic evolution. Brian T. Foley, PhD btf@lanl.gov HIV Genetic Sequences, Immunology, Drug Resistance and Vaccine Trials
More informationBatch Upload Instructions
Last Updated: Jan 2017 Workplace Health Solutions Center for Workplace Health Research & Evaluation Workplace Health Achievement Index 1 P A G E Last Updated: Jan 2017 Table of Contents Purpose.....Err
More informationTo begin using the Nutrients feature, visibility of the Modules must be turned on by a MICROS Account Manager.
Nutrients A feature has been introduced that will manage Nutrient information for Items and Recipes in myinventory. This feature will benefit Organizations that are required to disclose Nutritional information
More informationREADME file for GRASTv1.0.pl
README file for GRASTv.0.pl Genome Reduction Analysing Software Tool (GRAST). Produced by Christina Toft and Mario A. Fares Date 03/04/06 Reference and more information: Toft, C and Fares, MA (2006). GRAST:
More informationPedCath IMPACT User s Guide
PedCath IMPACT User s Guide Contents Overview... 3 IMPACT Overview... 3 PedCath IMPACT Registry Module... 3 More on Work Flow... 4 Case Complete Checkoff... 4 PedCath Cath Report/IMPACT Shared Data...
More informationChronic Pain Management Workflow Getting Started: Wrenching In Assessments into Favorites (do once!)
Chronic Pain Management Workflow Getting Started: Wrenching In Assessments into Favorites (do once!) 1. Click More Activities to star flowsheets into your chunky button screen. 3. Use the search function
More informationSEQUENCE FEATURE VARIANT TYPES
SEQUENCE FEATURE VARIANT TYPES DEFINITION OF SFVT: The Sequence Feature Variant Type (SFVT) component in IRD (http://www.fludb.org) is a relatively novel approach that delineates specific regions, called
More informationSleep Apnea Therapy Software Clinician Manual
Sleep Apnea Therapy Software Clinician Manual Page ii Sleep Apnea Therapy Software Clinician Manual Notices Revised Notice Trademark Copyright Sleep Apnea Therapy Software Clinician Manual 103391 Rev A
More informationDownload CoCASA Software Application
Comprehensive Clinic Assessment Software Application (CoCASA) 7.0 Instructions Guide for Immunization Service Contractors February 6, 2012 The Comprehensive Clinic Assessment Software Application (CoCASA)
More informationCare Pathways User Guide
Care Pathways User Guide For questions about McKesson Clinical Tools, email us at msh.providers@mckesson.com. Care Pathways User Guide Table of Contents Introduction to Care Pathways... 3 Launching Care
More informationDemo Mode. Once you have taken the time to navigate your RPM 2 app in "Demo mode" you should be ready to pair, connect, and try your inserts.
Demo Mode RPM 2 is supported with a "demonstration (Demo) mode" that easily allows you to navigate the app. Demo mode is intended for navigation purposes only. Data in Demo mode are simply random data
More informationEHS Integrator Controlled Substance Waste Pickup Request Help Guide
EHS Integrator Controlled Substance Waste Pickup Request Help Guide Use the EHS Integrator Controlled Substance Waste Pickup Form to request a Controlled Substance/Drug waste pickup. To request a controlled
More informationFully Automated IFA Processor LIS User Manual
Fully Automated IFA Processor LIS User Manual Unless expressly authorized, forwarding and duplication of this document is not permitted. All rights reserved. TABLE OF CONTENTS 1 OVERVIEW... 4 2 LIS SCREEN...
More informationEast Stroudsburg University Athletic Training Medical Forms Information and Directions
East Stroudsburg University Athletic Training Medical Forms Information and Directions 2013 2014 All student athletes must complete all medical information forms on the ATS Webportal by July 27 th, 2013.
More informationWorkshop on Analysis and prediction of contacts in proteins
Workshop on Analysis and prediction of contacts in proteins 1.09.09 Eran Eyal 1, Vladimir Potapov 2, Ronen Levy 3, Vladimir Sobolev 3 and Marvin Edelman 3 1 Sheba Medical Center, Ramat Gan, Israel; Departments
More informationAllergy Basics. This handout describes the process for adding and removing allergies from a patient s chart.
Allergy Basics This handout describes the process for adding and removing allergies from a patient s chart. Accessing Allergy Information Page 1 Recording No Known Medication Allergies Page 2 Recording
More informationPsy201 Module 3 Study and Assignment Guide. Using Excel to Calculate Descriptive and Inferential Statistics
Psy201 Module 3 Study and Assignment Guide Using Excel to Calculate Descriptive and Inferential Statistics What is Excel? Excel is a spreadsheet program that allows one to enter numerical values or data
More informationThe BLAST search on NCBI ( and GISAID
Supplemental materials and methods The BLAST search on NCBI (http:// www.ncbi.nlm.nih.gov) and GISAID (http://www.platform.gisaid.org) showed that hemagglutinin (HA) gene of North American H5N1, H5N2 and
More informationThe Influenza Virus Resource at the National Center for Biotechnology Information. Running Title: NCBI Influenza Virus Resource ACCEPTED
JVI Accepts, published online ahead of print on 17 October 2007 J. Virol. doi:10.1128/jvi.02005-07 Copyright 2007, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved.
More informationDementia Direct Enhanced Service
Vision 3 Dementia Direct Enhanced Service England Outcomes Manager Copyright INPS Ltd 2015 The Bread Factory, 1A Broughton Street, Battersea, London, SW8 3QJ T: +44 (0) 207 501700 F:+44 (0) 207 5017100
More informationClay Tablet Connector for hybris. User Guide. Version 1.5.0
Clay Tablet Connector for hybris User Guide Version 1.5.0 August 4, 2016 Copyright Copyright 2005-2016 Clay Tablet Technologies Inc. All rights reserved. All rights reserved. This document and its content
More informationCommonwealth of Pennsylvania PA Test Method No. 423 Department of Transportation October Pages LABORATORY TESTING SECTION. Method of Test for
Commonwealth of Pennsylvania PA Test Method No. 423 Department of Transportation 10 Pages 1. SCOPE LABORATORY TESTING SECTION Method of Test for RETRO-DIRECTIVE REFLECTIVITY OF REFLECTIVE MATERIALS 1.1
More informationiworx Sample Lab Experiment AN-5: Cockroach Leg Mechanoreceptors
Experiment AN-5: Cockroach Leg Mechanoreceptors Exercise 1: Chordotonal Organs Aim: To explore the basic characteristics of the chordotonal organs, their response to direction and intensity of leg movement,
More informationProScript User Guide. Pharmacy Access Medicines Manager
User Guide Pharmacy Access Medicines Manager Version 3.0.0 Release Date 01/03/2014 Last Reviewed 11/04/2014 Author Rx Systems Service Desk (T): 01923 474 600 Service Desk (E): servicedesk@rxsystems.co.uk
More informationShadeVision v Color Map
Kevin Aamodt Page 1 7/1/2004 ShadeVision v.3.01 Color Map The ShadeVision v.3.01 color map will allow the user to custom select the lookup regions of the Gingival, Middle, and Incisal areas of a tooth.
More informationMULTIPLE LINEAR REGRESSION 24.1 INTRODUCTION AND OBJECTIVES OBJECTIVES
24 MULTIPLE LINEAR REGRESSION 24.1 INTRODUCTION AND OBJECTIVES In the previous chapter, simple linear regression was used when you have one independent variable and one dependent variable. This chapter
More informationINRODUCTION TO TREEAGE PRO
INRODUCTION TO TREEAGE PRO Asrul Akmal Shafie BPharm, Pg Dip Health Econs, PhD aakmal@usm.my Associate Professor & Program Chairman Universiti Sains Malaysia Board Member HTAsiaLink Adjunct Associate Professor
More informationGuide to Use of SimulConsult s Phenome Software
Guide to Use of SimulConsult s Phenome Software Page 1 of 52 Table of contents Welcome!... 4 Introduction to a few SimulConsult conventions... 5 Colors and their meaning... 5 Contextual links... 5 Contextual
More informationThe Hospital Anxiety and Depression Scale Guidance and Information
The Hospital Anxiety and Depression Scale Guidance and Information About Testwise Testwise is the powerful online testing platform developed by GL Assessment to host its digital tests. Many of GL Assessment
More informationEHR Go Guide: Vitals, Pain, and Measurement
EHR Go Guide: Vitals, Pain, and Measurement Introduction Vital signs are an important aspect of patient care and diagnosis. They often provide the first indication of a change in the patient s health status
More informationOneTouch Reveal Web Application. User Manual for Patients Instructions for Use
OneTouch Reveal Web Application User Manual for Patients Instructions for Use Contents 2 Contents Chapter 1: Introduction...3 Product Overview...3 Intended Use...3 System Requirements... 3 Technical Support...3
More informationData mining with Ensembl Biomart. Stéphanie Le Gras
Data mining with Ensembl Biomart Stéphanie Le Gras (slegras@igbmc.fr) Guidelines Genome data Genome browsers Getting access to genomic data: Ensembl/BioMart 2 Genome Sequencing Example: Human genome 2000:
More informationhmhco.com National GO Math! K 6 USER GUIDE Personal Math Trainer Powered by Knewton
hmhco.com National GO Math! K 6 USER GUIDE Personal Math Trainer Powered by Knewton Version.0 August 015 Contents I. OVERVIEW AND MODES OF THE PMT...3 II. LOCATING THE PMT TO MAKE ASSIGNMENTS...5 III.
More informationEntering HIV Testing Data into EvaluationWeb
Entering HIV Testing Data into EvaluationWeb User Guide Luther Consulting, LLC July, 2014/v2.2 All rights reserved. Table of Contents Introduction... 3 Accessing the CTR Form... 4 Overview of the CTR Form...
More informationSpectrum. Quick Start Tutorial
Spectrum Quick Start Tutorial March 2005 Table of Contents Introduction... 2 What you will learn... 4 Basic Steps in Using Spectrum... 4 Step 1. Installing Spectrum... 4 Step 2. Changing the language in
More informationUniversity of Alaska Connected! FAQs
University of Alaska Connected! FAQs 1. What is Connected? Connected! allows employees and spouses/fips to connect a fitness device or app to Healthyroads.com. This will allow additional tracking options
More informationSleep Apnea Therapy Software User Manual
Sleep Apnea Therapy Software User Manual Page ii Notices Revised Notice Trademark Copyright 103392 Rev B Published February 8, 2013 and supersedes all previous versions. The information contained in this
More informationGST: Step by step Build Diary page
GST: At A Glance The home page has a brief overview of the GST app. Navigate through the app using either the buttons on the left side of the screen, or the forward/back arrows at the bottom right. There
More informationTeaching Phylogeny and Direction of Viral Transmission using a Real HIV Criminal Case
Tested Studies for Laboratory Teaching Proceedings of the Association for Biology Laboratory Education Volume 39, Article 24, 2018 Teaching Phylogeny and Direction of Viral Transmission using a Real HIV
More informationProtein Investigator. Protein Investigator - 3
Protein Investigator Objectives To learn more about the interactions that govern protein structure. To test hypotheses regarding protein structure and function. To design proteins with specific shapes.
More informationUser Guide. Protein Clpper. Statistical scoring of protease cleavage sites. 1. Introduction Protein Clpper Analysis Procedure...
User Guide Protein Clpper Statistical scoring of protease cleavage sites Content 1. Introduction... 2 2. Protein Clpper Analysis Procedure... 3 3. Input and Output Files... 9 4. Contact Information...
More informationCNV PCA Search Tutorial
CNV PCA Search Tutorial Release 8.1 Golden Helix, Inc. March 18, 2014 Contents 1. Data Preparation 2 A. Join Log Ratio Data with Phenotype Information.............................. 2 B. Activate only
More informationData Management, Data Management PLUS User Guide
Data Management, Data Management PLUS User Guide Table of Contents Introduction 3 SHOEBOX Data Management and Data Management PLUS (DM+) for Individual Users 4 Portal Login 4 Working With Your Data 5 Manually
More informationThe Student Experience: Taking an Assessment in CFS
The Student Experience: Taking an Assessment in CFS Students will be entering the responses to multiple choice questions Benchmark questions into CFS. There are small variations between Math and Science
More informationIMPORTANT!!! Please read the FAQ document BEFORE you step through this tutorial.
IMPORTANT!!! Please read the FAQ document BEFORE you step through this tutorial. If you choose to participate in the CrossFit Viral Nutrition Challenge, please purchase the Premium version of My Fitness
More informationUsing the New Nutrition Facts Label Formats in TechWizard Version 5
Using the New Nutrition Facts Label Formats in TechWizard Version 5 Introduction This document covers how to utilize the new US Nutrition Facts label formats that are part of Version 5. Refer to Installing
More informationRESULTS REPORTING MANUAL. Hospital Births Newborn Screening Program June 2016
RESULTS REPORTING MANUAL Hospital Births Newborn Screening Program June 2016 CONTENTS GETTING STARTED... 1 Summary... 1 Logging In... 1 Access For New Hires... 2 Reporting Parental Refusals... 3 Adding
More informationCaseBuilder - Quick Reference Guide
ADP UNEMPLOYMENT COMPENSATION MANAGEMENT CaseBuilder - Quick Reference Guide After signing into CaseBuilder, the first screen the user will see is called the Dashboard. The user can then navigate to any
More informationWarfarin Help Documentation
Warfarin Help Documentation Table Of Contents Warfarin Management... 1 iii Warfarin Management Warfarin Management The Warfarin Management module is a powerful tool for monitoring INR results and advising
More informationGene Ontology and Functional Enrichment. Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein
Gene Ontology and Functional Enrichment Genome 559: Introduction to Statistical and Computational Genomics Elhanan Borenstein The parsimony principle: A quick review Find the tree that requires the fewest
More informationUsing SPSS for Correlation
Using SPSS for Correlation This tutorial will show you how to use SPSS version 12.0 to perform bivariate correlations. You will use SPSS to calculate Pearson's r. This tutorial assumes that you have: Downloaded
More informationLiving with Newton's Laws
Task #1 - Newton s 1 st Law - This is a pain in the neck Let's suppose you are in your car, waiting at a stop light. Like any good driver, you have your seat belt buckled. (It's the law.) Suddenly, a car
More informationUse Case 9: Coordinated Changes of Epigenomic Marks Across Tissue Types. Epigenome Informatics Workshop Bioinformatics Research Laboratory
Use Case 9: Coordinated Changes of Epigenomic Marks Across Tissue Types Epigenome Informatics Workshop Bioinformatics Research Laboratory 1 Introduction Active or inactive states of transcription factor
More informationUser Guide. Association analysis. Input
User Guide TFEA.ChIP is a tool to estimate transcription factor enrichment in a set of differentially expressed genes using data from ChIP-Seq experiments performed in different tissues and conditions.
More informationTable of Contents Morning Set-up (GSI equipment, only)... 2 Opening AudBase... 3 Choosing a patient... 3 Performing Pure-Tone Air & Bone
AudBase Guidebook Table of Contents Morning Set-up (GSI equipment, only)... 2 Opening AudBase... 3 Choosing a patient... 3 Performing Pure-Tone Air & Bone Conduction... 6 Testing using a GSI-61 Audiometer:...
More informationMaking charts in Excel
Making charts in Excel Use Excel file MakingChartsInExcel_data We ll start with the worksheet called treatment This shows the number of admissions (not necessarily people) to Twin Cities treatment programs
More informationProblem Set 2 September 18, 2009
September 18, 2009 General Instructions: 1. You are expected to state all your assumptions and provide step-by-step solutions to the numerical problems. Unless indicated otherwise, the computational problems
More informationHOW TO USE THE BENCHMARK CALENDAR SYSTEM
HOW TO USE THE BENCHMARK CALENDAR SYSTEM 1. Go to Website http://doris.clk.co.st-johns.fl.us/benchmarkweb 2. You can use Firefox or Internet Explorer 11 to login to Benchmark. Compatibility mode is no
More informationStudent Guide. Concluding module. Visualizing proteins
Student Guide Concluding module Visualizing proteins Developed by bioinformaticsatschool.eu (part of NBIC) Text Hienke Sminia Illustrations Bioinformaticsatschool.eu Yasara.org All the included material
More informationMy Fitness Pal Health & Fitness Tracker A User s Guide
My Fitness Pal Health & Fitness Tracker A User s Guide By: Angela McCall Introduction My Fitness Pal is an online diet, health, and fitness tracker that allows you to track your nutrition and fitness goals
More informationSmartVA-Analyze 2.0 Help
SmartVA-Analyze 2.0 Help An instruction manual for using SmartVA-Analyze 2.0, which implements the Tariff 2.0 Method for computer certification of verbal autopsy (VA). Contents Contents Overview System
More informationHOST-PATHOGEN CO-EVOLUTION THROUGH HIV-1 WHOLE GENOME ANALYSIS
HOST-PATHOGEN CO-EVOLUTION THROUGH HIV-1 WHOLE GENOME ANALYSIS Somda&a Sinha Indian Institute of Science, Education & Research Mohali, INDIA International Visiting Research Fellow, Peter Wall Institute
More informationNumber of Differences from Species 1
Molecular Evidence for Evolution Name: Pre Lab Activity: Genes code for amino acids, amino acids code for proteins and proteins build body structures. Therefore, one way to observe the relatedness of species
More informationMODULE 4: SPLICING. Removal of introns from messenger RNA by splicing
Last update: 05/10/2017 MODULE 4: SPLICING Lesson Plan: Title MEG LAAKSO Removal of introns from messenger RNA by splicing Objectives Identify splice donor and acceptor sites that are best supported by
More informationmehealth for ADHD Parent Manual
mehealth for ADHD adhd.mehealthom.com mehealth for ADHD Parent Manual al Version 1.0 Revised 11/05/2008 mehealth for ADHD is a team-oriented approach where parents and teachers assist healthcare providers
More informationOne-Way Independent ANOVA
One-Way Independent ANOVA Analysis of Variance (ANOVA) is a common and robust statistical test that you can use to compare the mean scores collected from different conditions or groups in an experiment.
More informationRajesh Kannangai Phone: ; Fax: ; *Corresponding author
Amino acid sequence divergence of Tat protein (exon1) of subtype B and C HIV-1 strains: Does it have implications for vaccine development? Abraham Joseph Kandathil 1, Rajesh Kannangai 1, *, Oriapadickal
More informationUniversity of Illinois at Urbana-Champaign NIH Resource for Macromolecular Modeling and Bioinformatics Beckman Institute.
University of Illinois at Urbana-Champaign NIH Resource for Macromolecular Modeling and Bioinformatics Beckman Institute Aquaporins VMD Developers: John Stone Dan Wright John Eargle Fatemeh Khalili Elizabeth
More informationIBRIDGE 1.0 USER MANUAL
IBRIDGE 1.0 USER MANUAL Jaromir Krizek CONTENTS 1 INTRODUCTION... 3 2 INSTALLATION... 4 2.1 SYSTEM REQUIREMENTS... 5 2.2 STARTING IBRIDGE 1.0... 5 3 MAIN MENU... 6 3.1 MENU FILE... 6 3.2 MENU SETTINGS...
More informationLiteLink mini USB. Diatransfer 2
THE ART OF MEDICAL DIAGNOSTICS LiteLink mini USB Wireless Data Download Device Diatransfer 2 Diabetes Data Management Software User manual Table of Contents 1 Introduction... 3 2 Overview of operating
More informationBeltone Solus Pro 1.9 Fitting Guide
Beltone Solus Pro 1.9 Fitting Guide Table of Contents Table of Contents... 2 Getting started... 3 Start Screen... 3 Assigning Devices... 4 Connection Process... 5 MSG Calibration... 5 Gain Adjustment...
More informationInfluenza Virus HA Subtype Numbering Conversion Tool and the Identification of Candidate Cross-Reactive Immune Epitopes
Influenza Virus HA Subtype Numbering Conversion Tool and the Identification of Candidate Cross-Reactive Immune Epitopes Brian J. Reardon, Ph.D. J. Craig Venter Institute breardon@jcvi.org Introduction:
More informationImpact of Group Rejections on Self Esteem
Impact of Group Rejections on Self Esteem In 2005, researchers from the School of Physical Education at the University of Otago carried out a study to assess the impact of rejection on physical self esteem.
More informationWORKS
How it WORKS www.proctoru.com 855-772 - 8678 contact@proctoru.com Test-Taker Experience Test-takers log on to go.proctoru.com and create an account (Figure 1). When the test-taker logs in for the first
More informationUtilizing the SAP ISR Report to Monitor ISRs
Purpose The ISR report in SAP allows you to review individual ISRs by various parameters; such as: ISR number, ISR type, Initiator, Approver I or II, and/or Effective date. The tool will also allow you
More informationLibreHealth EHR Student Exercises
LibreHealth EHR Student Exercises 1. Exercises with Test Patients created by students a. Create a new Encounter using the Bronchitis form (template) i. While your patient s chart is open, go to either
More information