The Immune Epitope Database Analysis Resource: MHC class I peptide binding predictions. Edita Karosiene, Ph.D.

Size: px
Start display at page:

Download "The Immune Epitope Database Analysis Resource: MHC class I peptide binding predictions. Edita Karosiene, Ph.D."

Transcription

1 The Immune Epitope Database Analysis Resource: MHC class I peptide binding predictions Edita Karosiene, Ph.D. edita@liai.org IEDB Workshop October 29, 2015

2 Outline Introduction MHC-I peptide binding prediction tool Web user interface Guidelines on choosing Prediction methods Prediction thresholds HLA alleles Exercises 1

3 Introduction 2

4 MHC class I molecules Expressed by almost all nucleated cells and present antigen to CD8 + T cells The binding groove is closed at both ends, can accommodate peptides of 8-15 AA Only α chain impacts binding. α chain β2-microglobulin HLA-A*02:01, PDB entry 1DUZ 3

5 MHC binding predictions MHC molecules are highly polymorphic thousands of different variants exist Experimental characterisation of peptide MHC interactions is highly costintensive Prediction methods facilitate selection of potential epitopes from a pool of peptides Peptide binding data Machine learning algorithms PEPTIDE IC50 (nm) AAAAAGTTV AAAAAVAAE 211 AAAAAVAAE 5 AAAAPYAGW AAACAGTTV 6 AAADAGTTV 6 AAADLFRGT 8791 AAADLFRGV 1773 AAADLFRGW Artificial Neural Networks (ANN) 4

6 Binding data for MHC class I 126 MHC molecules: 83 human: HLA-A, HLA-B and HLA-C 18 macaque: Mamu-A, Mamu-B 8 chimpanzee: Patr-A, Patr-B 6 mouse: H-2 Db, Dd, Kb, Kd, Kk, Ld 7 cattle: BoLA-HD6 3 pig: SLA1, SLA2, SLA3, SLA6 1 rat: RT1A Predictors were re-trained in the middle of year

7 MHC-I peptide binding prediction tool Web user interface 6

8 MHC-I binding predictions on IEDB home page 7

9 MHC-I binding predictions 8

10 Instructions 9

11 Examples 10

12 References 11

13 Download Peptide binding data 12

14 Contact 13

15 Submission Submit sequence: Space separated sequences One continuous sequence FASTA format 14

16 Submission Choose file with sequence(s) 15

17 Submission Choose sequence format "auto detect format": FASTA if ">" is found Continuous sequence otherwise 16

18 Submission Choose prediction method IEDB Recommended: Consensus if predictions available for a chosen MHC molecule NetMHCpan, otherwise Consensus combines ANN, SMM, CombLib 17

19 Submission Choose species Specify MHC allele(s) and peptide length Format: HLA-A*02:01,9 HLA-B*15:01,9 HLA-A*02:06,10 18

20 Submission Choose output sorting method 19

21 Submission Optional filtering of results 20

22 Submission Choose output format Submit 21

23 Prediction results A percentile rank score for a peptide is a percentage of randomly sampled peptides scoring better than the peptide. 22

24 Prediction results Individual scores for different methods 23

25 Prediction results SMM method was chosen 24

26 How to choose prediction method 25

27 Groups of prediction methods Allele-specific methods Training data: peptide sequences binding affinities to one specific MHC molecule Predictions: molecules from the training set. Stabilized Matrix Method (SMM) SMM PMBEC CombLib NetMHC/ANN Consensus Pan-specific methods Training data: peptide sequences MHC sequences binding affinities Predictions: any known MHC molecule. NetMHCpan PickPocket NetMHCcons 26

28 Consensus Motivation: combined predictions from different predictors may result into higher predictive performance than any of the individual predictors Consensus Combines NetMHC, SMM and CombLib Requires that all methods give predictions on the same scale percentile ranks are used PMID: CombLib = 0.2 SMM = 0.4 ANN = 0.7 MEDIAN Consensus =

29 Recommendations IEDB Recommended Addresses the problem of choosing from many available prediction methods Uses the best method for a given MHC molecule Consensus if predictions for NetMHC, SMM or CombLib are available NetMHCpan, otherwise Benchmark of the methods: Consensus > NetMHC > SMM > NetMHCpan > CombLib Recommendation may change with the new benchmark studies 28

30 How to choose prediction threshold 29

31 Two main choices for binders 1. Binding affinity (IC50) threshold of 500 nm identifies peptide binders recognized by T cells IC50 < 50 nm high affinity IC50 < 500 nm intermediate affinity IC50 < 5000 nm low affinity Sette et al. 1994, J. Immunology (PMID: ) Ensures that all peptides have reasonable affinity (at lest intermediate affinity). 1. Pick top 1% of peptides for each (MHC, length) combination to cover most of immune responses Moutaftsi et al. 2006, Nat. Biotech (PMID: ) Kotturi et al. 2007, J. Virology (PMID: ) Ensures equal number of peptides per allele. 2. Percentile rank score threshold of

32 Different peptide-binding repertoires The size of the peptide repertoire binding at a given affinity varies between alleles. HLA-A*02:01 HLA-A*01:01 Allele-specific affinity cutoffs Paul et al. 2013, J. Immunol. (PMID: ) 31

33 Allele-specific thresholds 32

34 Recommendations Both approaches (affinity and ranking) are reasonable, and have been applied in numerous studies Cut-offs can be combined (peptides in top 1% and IC50 < 500 nm) Current studies suggest that allele specific thresholds can be derived. 33

35 How to choose representative alleles 34

36 MHC polymorphism Known HLA protein molecules: HLA-A 2,041 HLA-B 2,668 HLA-C 1,677 Total: 6386 We have peptide binding data for 80 => 1.3 % 35

37 How to deal with MHC polymorphism Frequency of alleles is changing across different populations worldwide MHC alleles can be classified into relatively few supertypes based on their peptide binding similarities Sette and Sidney, 1998, Curr. Opin. Immunol. (PMID: ) Sette and Sidney, 1999, Immunogenetics (PMID: ) Goulder & Watkins, 2008, Nature Reviews Immunology 36

38 Recommendations Reference set of 27 alleles has been assembled covers > 97% of population HLA-A Frequency HLA-B Frequency A*01: B*07: A*02: B*08: A*02: B*15: A*02: B*35: A*03: B*40: A*11: B*44: A*23: B*44: A*24: B*51: A*26: B*53: A*30: B*57: A*30:02 5 B*58: A*31: A*32: A*33: A*68: A*68:

39 Recommendations 38

40 Exercise 1 finding Malaria minimal epitope 39

41 Exercise 1 finding Malaria minimal epitope Background Apical membrane antigen-1 (AMA1) is a protein expressed in the membrane of Plasmodium falciparum in sporozoite, liver and blood stages. AMA1 has been tested in clinical trials to give both CD4 + and CD8 + responses and is considered as a good candidate for a multi-antigen malaria vaccine. Methods Five volunteers were immunized with a vaccine containing full length of AMA1. A peptide pool of 15-mers overlapping by 11 amino acids in the AMA1 sequence was constructed. ELISpot responses of the peptides from the peptide pool were tested among the volunteers. HLA typing was done for each volunteer. Problem statement Use IEDB prediction tools to determine the best epitope within a 15-mer: LLSAFEFTYMINFGR. Volunteer s HLA set: HLA-A*02:01, HLA-A*26:01, HLA-B*18:01, HLA-B*44:02. Reference Sedegah M. et al. 2010, Malaria Journal (PMID: ) 40

42 Exercise 2 choosing epitopes for a global Dengue virus vaccine 41

43 Exercise 2 choosing epitopes for a global Dengue virus vaccine Imagine that you want to design a vaccine for Dengue virus that would work across the world. Use Dengue virus 1 isolate from Sri Lanka as a reference sequence (GenBank: JN ). You would have to use HLA allele reference set (27 alleles) to make predictions. However, due to the limited time choose only 1 allele from the reference list: HLA-A*01:01. Answer the questions: 1) How many peptides would you choose if you follow top 1% rule? 2) How many peptides would you choose if you only want to have peptides with a percentile rank score < 1.0? 3) How many of the top 10 peptides are known as Dengue epitopes in the IEDB data base? 42

44 Thank you for your attention! Questions?

A HLA-DRB supertype chart with potential overlapping peptide binding function

A HLA-DRB supertype chart with potential overlapping peptide binding function A HLA-DRB supertype chart with potential overlapping peptide binding function Arumugam Mohanapriya 1,2, Satish Nandagond 1, Paul Shapshak 3, Uma Kangueane 1, Pandjassarame Kangueane 1, 2 * 1 Biomedical

More information

CS229 Final Project Report. Predicting Epitopes for MHC Molecules

CS229 Final Project Report. Predicting Epitopes for MHC Molecules CS229 Final Project Report Predicting Epitopes for MHC Molecules Xueheng Zhao, Shanshan Tuo Biomedical informatics program Stanford University Abstract Major Histocompatibility Complex (MHC) plays a key

More information

MetaMHC: a meta approach to predict peptides binding to MHC molecules

MetaMHC: a meta approach to predict peptides binding to MHC molecules W474 W479 Nucleic Acids Research, 2010, Vol. 38, Web Server issue Published online 18 May 2010 doi:10.1093/nar/gkq407 MetaMHC: a meta approach to predict peptides binding to MHC molecules Xihao Hu 1, Wenjian

More information

NIH Public Access Author Manuscript Immunogenetics. Author manuscript; available in PMC 2014 September 01.

NIH Public Access Author Manuscript Immunogenetics. Author manuscript; available in PMC 2014 September 01. NIH Public Access Author Manuscript Published in final edited form as: Immunogenetics. 2013 September ; 65(9): 655 665. doi:10.1007/s00251-013-0714-9. MHCcluster, a method for functional clustering of

More information

IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology

IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology Bioinformatics 1 -- Lecture 22 IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology Most slides courtesy of Julia Ponomarenko, San Diego Supercomputer Center or Oliver Kohlbacher, WSI/ZBIT, Eberhard-Karls-

More information

Immune Epitope Database NEWSLETTER Volume 6, Issue 2 July 2009

Immune Epitope Database NEWSLETTER Volume 6, Issue 2  July 2009 Immune Epitope Database NEWSLETTER Volume 6, Issue 2 http://www.iedb.org July 2009 In response to concerns of a swine flu epidemic, the IEDB Curation curation team updated the database s collection of

More information

A community resource benchmarking predictions of peptide binding to MHC-I molecules

A community resource benchmarking predictions of peptide binding to MHC-I molecules Downloaded from orbit.dtu.dk on: Dec 17, 2017 A community resource benchmarking predictions of peptide binding to MHC-I molecules Peters, B; Bui, HH; Pletscher-Frankild, Sune; Nielsen, Morten; Lundegaard,

More information

Degenerate T-cell Recognition of Peptides on MHC Molecules Creates Large Holes in the T-cell Repertoire

Degenerate T-cell Recognition of Peptides on MHC Molecules Creates Large Holes in the T-cell Repertoire Degenerate T-cell Recognition of Peptides on MHC Molecules Creates Large Holes in the T-cell Repertoire Jorg J. A. Calis*, Rob J. de Boer, Can Keşmir Theoretical Biology & Bioinformatics, Utrecht University,

More information

Identification and characterization of merozoite surface protein 1 epitope

Identification and characterization of merozoite surface protein 1 epitope Identification and characterization of merozoite surface protein epitope Satarudra Prakash Singh,2, Bhartendu Nath Mishra 2* Amity Institute of Biotechnology, Amity University, Uttar Pradesh, Gomti Nagar,

More information

Machine Learning For Personalized Cancer Vaccines. Alex Rubinsteyn February 9th, 2018 Data Science Salon Miami

Machine Learning For Personalized Cancer Vaccines. Alex Rubinsteyn February 9th, 2018 Data Science Salon Miami Machine Learning For Personalized Cancer Vaccines Alex Rubinsteyn February 9th, 2018 Data Science Salon Miami OpenVax @ Mount Sinai Focus: personalized cancer vaccines Machine learning for immunology Cancer

More information

Definition of MHC supertypes through clustering of MHC peptide binding repertoires

Definition of MHC supertypes through clustering of MHC peptide binding repertoires Definition of MHC supertypes through clustering of MHC peptide binding repertoires Pedro A. Reche and Ellis L. Reinherz Laboratory of Immunobiology and Department of Medical Oncology, Dana-Farber Cancer

More information

Epitope discovery. Using predicted MHC binding CENTER FOR BIOLOGICAL SEQUENCE ANALYSIS

Epitope discovery. Using predicted MHC binding CENTER FOR BIOLOGICAL SEQUENCE ANALYSIS Epitope discovery Using predicted MHC binding SARS corona virus The 2003 outbreak The disease Lung Pathology Inflammatory exudation in alveoli and interstitial spaces Monocytic and lymphocytic infiltration

More information

Epitope discovery and Rational vaccine design Morten Nielsen

Epitope discovery and Rational vaccine design Morten Nielsen Epitope discovery and Rational vaccine design Morten Nielsen mniel@cbs.dtu.dk Bioinformatics in a nutshell List of peptides that have a given biological feature Mathematical model (neural network, hidden

More information

Short peptide epitope design from hantaviruses causing HFRS

Short peptide epitope design from hantaviruses causing HFRS www.bioinformation.net Volume 13(7) Hypothesis Short peptide epitope design from hantaviruses causing HFRS Sathish Sankar*, Mageshbabu Ramamurthy, Balaji Nandagopal, Gopalan Sridharan Sri Sakthi Amma Institute

More information

Convolutional and LSTM Neural Networks

Convolutional and LSTM Neural Networks Convolutional and LSTM Neural Networks Vanessa Jurtz January 11, 2017 Contents Neural networks and GPUs Lasagne Peptide binding to MHC class II molecules Convolutional Neural Networks (CNN) Recurrent and

More information

MHC Tetramers and Monomers for Immuno-Oncology and Autoimmunity Drug Discovery

MHC Tetramers and Monomers for Immuno-Oncology and Autoimmunity Drug Discovery MHC Tetramers and Monomers for Immuno-Oncology and Autoimmunity Drug Discovery Your Partner in Drug Discovery and Research MHC Tetramer Background T-Cell Receptors recognize and bind to complexes composed

More information

Selection of epitope-based vaccine targets of HCV genotype 1 of Asian origin: a systematic in silico approach

Selection of epitope-based vaccine targets of HCV genotype 1 of Asian origin: a systematic in silico approach www.bioinformation.net Hypothesis Volume 8(20) Selection of epitope-based vaccine targets of HCV genotype 1 of Asian origin: a systematic in silico approach Abida Shehzadi 1 *, Shahid Ur Rehman 1, 2 &

More information

In silico methods for rational design of vaccine and immunotherapeutics

In silico methods for rational design of vaccine and immunotherapeutics In silico methods for rational design of vaccine and immunotherapeutics Morten Nielsen, CBS, Department of Systems Biology, DTU and Instituto de Investigaciones Biotecnológicas, Universidad de San Martín,

More information

PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands

PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands W138 W142 doi:10.1093/nar/gki357 PEPVAC: a web server for multi-epitope vaccine development based on the prediction of supertypic MHC ligands Pedro A. Reche 1,2, * and Ellis L. Reinherz 1,2 1 Laboratory

More information

Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning

Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning Yi-Hsiang Hsu, MD, SCD Sep 16, 2017 yihsianghsu@hsl.harvard.edu Director & Associate

More information

Use of BONSAI decision trees for the identification of potential MHC Class I peptide epitope motifs.

Use of BONSAI decision trees for the identification of potential MHC Class I peptide epitope motifs. Use of BONSAI decision trees for the identification of potential MHC Class I peptide epitope motifs. C.J. SAVOIE, N. KAMIKAWAJI, T. SASAZUKI Dept. of Genetics, Medical Institute of Bioregulation, Kyushu

More information

Definition of MHC Supertypes Through Clustering of MHC Peptide-Binding Repertoires

Definition of MHC Supertypes Through Clustering of MHC Peptide-Binding Repertoires 11 Definition of MHC Supertypes Through Clustering of MHC Peptide-Binding Repertoires Pedro A. Reche and Ellis L. Reinherz Summary Identification of peptides that can bind to major histocompatibility complex

More information

Vaccine Design: A Statisticans Overview

Vaccine Design: A Statisticans Overview GoBack : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: 2004 - slide #1 The Chinese are credited with making the observation that deliberately infecting

More information

Fondation Merieux J Craig Venter Institute Bioinformatics Workshop. December 5 8, 2017

Fondation Merieux J Craig Venter Institute Bioinformatics Workshop. December 5 8, 2017 Fondation Merieux J Craig Venter Institute Bioinformatics Workshop December 5 8, 2017 Module 5: Comparative Genomics Analysis Outline Definition of comparative genomics Applications in studying human pathogens

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Notes 1: accuracy of prediction algorithms for peptide binding affinities to HLA and Mamu alleles For each HLA and Mamu allele we have analyzed the accuracy of four predictive algorithms

More information

DIRECT IDENTIFICATION OF NEO-EPITOPES IN TUMOR TISSUE

DIRECT IDENTIFICATION OF NEO-EPITOPES IN TUMOR TISSUE DIRECT IDENTIFICATION OF NEO-EPITOPES IN TUMOR TISSUE Eustache Paramithiotis PhD Vice President, Biomarker Discovery & Diagnostics 17 March 2016 PEPTIDE PRESENTATION BY MHC MHC I Antigen presentation by

More information

Convolutional and LSTM Neural Networks

Convolutional and LSTM Neural Networks Convolutional and LSTM Neural Networks Vanessa Jurtz January 12, 2016 Contents Neural networks and GPUs Lasagne Peptide binding to MHC class II molecules Convolutional Neural Networks (CNN) Recurrent and

More information

ProPred1: prediction of promiscuous MHC Class-I binding sites. Harpreet Singh and G.P.S. Raghava

ProPred1: prediction of promiscuous MHC Class-I binding sites. Harpreet Singh and G.P.S. Raghava BIOINFORMATICS Vol. 19 no. 8 2003, pages 1009 1014 DOI: 10.1093/bioinformatics/btg108 ProPred1: prediction of promiscuous MHC Class-I binding sites Harpreet Singh and G.P.S. Raghava Institute of Microbial

More information

Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning

Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning Immuno-Oncology Therapies and Precision Medicine: Personal Tumor-Specific Neoantigen Prediction by Machine Learning Yi-Hsiang Hsu, MD, SCD Sep 16, 2017 yihsianghsu@hsl.harvard.edu HSL GeneticEpi Center,

More information

New technologies for studying human immunity. Lisa Wagar Postdoctoral fellow, Mark Davis lab Stanford University School of Medicine

New technologies for studying human immunity. Lisa Wagar Postdoctoral fellow, Mark Davis lab Stanford University School of Medicine New technologies for studying human immunity Lisa Wagar Postdoctoral fellow, Mark Davis lab Stanford University School of Medicine New strategies: Human immunology is ideal for a systems approach We have

More information

Basic Immunology. Lecture 5 th and 6 th Recognition by MHC. Antigen presentation and MHC restriction

Basic Immunology. Lecture 5 th and 6 th Recognition by MHC. Antigen presentation and MHC restriction Basic Immunology Lecture 5 th and 6 th Recognition by MHC. Antigen presentation and MHC restriction Molecular structure of MHC, subclasses, genetics, functions. Antigen presentation and MHC restriction.

More information

Significance of the MHC

Significance of the MHC CHAPTER 7 Major Histocompatibility Complex (MHC) What is is MHC? HLA H-2 Minor histocompatibility antigens Peter Gorer & George Sneell (1940) Significance of the MHC role in immune response role in organ

More information

SEQUENCE FEATURE VARIANT TYPES

SEQUENCE FEATURE VARIANT TYPES SEQUENCE FEATURE VARIANT TYPES DEFINITION OF SFVT: The Sequence Feature Variant Type (SFVT) component in IRD (http://www.fludb.org) is a relatively novel approach that delineates specific regions, called

More information

Profiling HLA motifs by large scale peptide sequencing Agilent Innovators Tour David K. Crockett ARUP Laboratories February 10, 2009

Profiling HLA motifs by large scale peptide sequencing Agilent Innovators Tour David K. Crockett ARUP Laboratories February 10, 2009 Profiling HLA motifs by large scale peptide sequencing 2009 Agilent Innovators Tour David K. Crockett ARUP Laboratories February 10, 2009 HLA Background The human leukocyte antigen system (HLA) is the

More information

The Major Histocompatibility Complex

The Major Histocompatibility Complex The Major Histocompatibility Complex Today we will discuss the MHC The study of MHC is necessary to understand how an immune response is generated. And these are the extra notes with respect to slides

More information

Supplementary Figure 1. Using DNA barcode-labeled MHC multimers to generate TCR fingerprints

Supplementary Figure 1. Using DNA barcode-labeled MHC multimers to generate TCR fingerprints Supplementary Figure 1 Using DNA barcode-labeled MHC multimers to generate TCR fingerprints (a) Schematic overview of the workflow behind a TCR fingerprint. Each peptide position of the original peptide

More information

Section D. Identification of serotype-specific amino acid positions in DENV NS1. Objective

Section D. Identification of serotype-specific amino acid positions in DENV NS1. Objective Section D. Identification of serotype-specific amino acid positions in DENV NS1 Objective Upon completion of this exercise, you will be able to use the Virus Pathogen Resource (ViPR; http://www.viprbrc.org/)

More information

The Major Histocompatibility Complex (MHC)

The Major Histocompatibility Complex (MHC) The Major Histocompatibility Complex (MHC) An introduction to adaptive immune system before we discuss MHC B cells The main cells of adaptive immune system are: -B cells -T cells B cells: Recognize antigens

More information

Alessandra Franco MD PhD UCSD School of Medicine Department of Pediatrics Division of Allergy Immunology and Rheumatology

Alessandra Franco MD PhD UCSD School of Medicine Department of Pediatrics Division of Allergy Immunology and Rheumatology Immunodominant peptides derived from the heavy constant region of IgG1 stimulate natural regulatory T cells: identification of pan- HLA binders for clinical translation Alessandra Franco MD PhD UCSD School

More information

2017 EFI/DGI Meeting Teaching Session I

2017 EFI/DGI Meeting Teaching Session I 2017 EFI/DGI Meeting Teaching Session I Mannheim, Wednesday, 31.05.2017 10:30 12:00 Role of non-classical HLA in Stem Cell Transplantation 10:30 10:40 Non Classical HLA-Molecules J. Mytilineos, Ulm 10:40

More information

Bjoern Peters La Jolla Institute for Allergy and Immunology Buenos Aires, Oct 31, 2012

Bjoern Peters La Jolla Institute for Allergy and Immunology Buenos Aires, Oct 31, 2012 www.iedb.org Bjoern Peters bpeters@liai.org La Jolla Institute for Allergy and Immunology Buenos Aires, Oct 31, 2012 Overview 1. Introduction to the IEDB 2. Application: 2009 Swine-origin influenza virus

More information

Pro5 MHC Pentamers. Dr. Jeremy Fry. Copyright ProImmune Limited All Rights Reserved

Pro5 MHC Pentamers. Dr. Jeremy Fry. Copyright ProImmune Limited All Rights Reserved Pro5 MHC Pentamers Dr. Jeremy Fry Pro5 MHC Pentamers The most consistent technology for detecting antigenspecific T cells The most-cited commercially available MHC Multimer Used by most-leading academic

More information

MHC class I MHC class II Structure of MHC antigens:

MHC class I MHC class II Structure of MHC antigens: MHC class I MHC class II Structure of MHC antigens: MHC class I antigens consist of a transmembrane heavy chain (α chain) that is non-covalently associated with β2- microglobulin. Membrane proximal domain

More information

Potential cross reactions between HIV 1 specific T cells and the microbiome. Andrew McMichael Suzanne Campion

Potential cross reactions between HIV 1 specific T cells and the microbiome. Andrew McMichael Suzanne Campion Potential cross reactions between HIV 1 specific T cells and the microbiome Andrew McMichael Suzanne Campion Role of the Microbiome? T cell (and B cell) immune responses to HIV and Vaccines are influenced

More information

Predicting Protein-Peptide Binding Affinity by Learning Peptide-Peptide Distance Functions

Predicting Protein-Peptide Binding Affinity by Learning Peptide-Peptide Distance Functions Predicting Protein-Peptide Binding Affinity by Learning Peptide-Peptide Distance Functions Chen Yanover and Tomer Hertz,2 School of Computer Science and Engineering 2 The Center for Neural Computation,

More information

Gibbs sampling - Sequence alignment and sequence clustering

Gibbs sampling - Sequence alignment and sequence clustering Gibbs sampling - Sequence alignment and sequence clustering Massimo Andreatta Center for Biological Sequence Analysis Technical University of Denmark massimo@cbs.dtu.dk Technical University of Denmark

More information

Antigen Presentation to T lymphocytes

Antigen Presentation to T lymphocytes Antigen Presentation to T lymphocytes Immunology 441 Lectures 6 & 7 Chapter 6 October 10 & 12, 2016 Jessica Hamerman jhamerman@benaroyaresearch.org Office hours by arrangement Antigen processing: How are

More information

HLA and more. Ilias I.N. Doxiadis. Geneva 03/04/2012.

HLA and more. Ilias I.N. Doxiadis. Geneva 03/04/2012. www.ebmt.org HLA and more Ilias I.N. Doxiadis Geneva 03/04/2012 HLA and more HLA and more / Doxiadis 2 Topic of the day Compatibility testing is a type of testing used to ensure compatibility of the system/application/website

More information

Contents. Just Classifier? Rules. Rules: example. Classification Rule Generation for Bioinformatics. Rule Extraction from a trained network

Contents. Just Classifier? Rules. Rules: example. Classification Rule Generation for Bioinformatics. Rule Extraction from a trained network Contents Classification Rule Generation for Bioinformatics Hyeoncheol Kim Rule Extraction from Neural Networks Algorithm Ex] Promoter Domain Hybrid Model of Knowledge and Learning Knowledge refinement

More information

Eur. J. Immunol : Antigen processing 2295

Eur. J. Immunol : Antigen processing 2295 Eur. J. Immunol. 2005. 35: 2295 2303 Antigen processing 2295 Antigen processing An integrative approach to CTL epitope prediction: A combined algorithm integrating MHC class I binding, TAP transport efficiency,

More information

Neoantigen Identification using ATLAS Across Multiple Tumor Types Highlights Limitations of Prediction Algorithms

Neoantigen Identification using ATLAS Across Multiple Tumor Types Highlights Limitations of Prediction Algorithms Neoantigen Identification using ATLAS Across Multiple Tumor Types Highlights Limitations of Prediction Algorithms Wendy Broom, Ph.D. Keystone: Translational Systems Immunology, Snowbird February 1st 2018

More information

Major Histocompatibility Complex (MHC) and T Cell Receptors

Major Histocompatibility Complex (MHC) and T Cell Receptors Major Histocompatibility Complex (MHC) and T Cell Receptors Historical Background Genes in the MHC were first identified as being important genes in rejection of transplanted tissues Genes within the MHC

More information

HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol

HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol HLA and antigen presentation Department of Immunology Charles University, 2nd Medical School University Hospital Motol MHC in adaptive immunity Characteristics Specificity Innate For structures shared

More information

HOW TO HIT THEM ALL IN ONE BLOW

HOW TO HIT THEM ALL IN ONE BLOW HOW TO HIT THEM ALL IN ONE BLOW HCV THE DISEASE More than 4 million Americans (1.3% of the U.S. population) and 170 million individuals in the world (3% worldwide) are infected with hepatitis C virus The

More information

NetMHCpan, a Method for Quantitative Predictions of Peptide Binding to Any HLA-A and -B Locus Protein of Known Sequence

NetMHCpan, a Method for Quantitative Predictions of Peptide Binding to Any HLA-A and -B Locus Protein of Known Sequence NetMHCpan, a Method for Quantitative Predictions of Peptide Binding to Any HLA-A and -B Locus Protein of Known Sequence Morten Nielsen 1 *, Claus Lundegaard 1, Thomas Blicher 1, Kasper Lamberth 2, Mikkel

More information

Historical definition of Antigen. An antigen is a foreign substance that elicits the production of antibodies that specifically binds to the antigen.

Historical definition of Antigen. An antigen is a foreign substance that elicits the production of antibodies that specifically binds to the antigen. Historical definition of Antigen An antigen is a foreign substance that elicits the production of antibodies that specifically binds to the antigen. Historical definition of Antigen An antigen is a foreign

More information

The Major Histocompatibility Complex of Genes

The Major Histocompatibility Complex of Genes The Major Histocompatibility Complex of Genes Topic 4 The Major Histocompatibility Complex Outline of Lectures The immunological reasons for transplant rejection How the MHC was discovered using inbred

More information

Vaccine Design: A Statisticans Overview

Vaccine Design: A Statisticans Overview GoBack : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: 2004 - slide #1 The Chinese are credited with making the observation that deliberately infecting

More information

The major histocompatibility complex (MHC) is a group of genes that governs tumor and tissue transplantation between individuals of a species.

The major histocompatibility complex (MHC) is a group of genes that governs tumor and tissue transplantation between individuals of a species. Immunology Dr. John J. Haddad Chapter 7 Major Histocompatibility Complex The major histocompatibility complex (MHC) is a group of genes that governs tumor and tissue transplantation between individuals

More information

Antigen Recognition by T cells

Antigen Recognition by T cells Antigen Recognition by T cells TCR only recognize foreign Ags displayed on cell surface These Ags can derive from pathogens, which replicate within cells or from pathogens or their products that cells

More information

BIOINFORMATICS. June Immunological Bioinformatics

BIOINFORMATICS. June Immunological Bioinformatics IMMUNOLOGICAL BIOINFORMATICS MEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRT YLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVH VKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEKKQ DVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAA LLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILE

More information

Identification and Characterization of Presented Tumor Neo-epitopes from Metastatic Colon Cancer

Identification and Characterization of Presented Tumor Neo-epitopes from Metastatic Colon Cancer Identification and Characterization of Presented Tumor Neo-epitopes from Metastatic Colon Cancer Eustache Paramithiotis, PhD Vice President, Discovery NeoAg Summit 15 November 2018 CAPRION BIOSCIENCES

More information

Probability-Based Protein Identification for Post-Translational Modifications and Amino Acid Variants Using Peptide Mass Fingerprint Data

Probability-Based Protein Identification for Post-Translational Modifications and Amino Acid Variants Using Peptide Mass Fingerprint Data Probability-Based Protein Identification for Post-Translational Modifications and Amino Acid Variants Using Peptide Mass Fingerprint Data Tong WW, McComb ME, Perlman DH, Huang H, O Connor PB, Costello

More information

Significance of the MHC

Significance of the MHC CHAPTER 8 Major Histocompatibility Complex (MHC) What is is MHC? HLA H-2 Minor histocompatibility antigens Peter Gorer & George Sneell (1940) Significance of the MHC role in immune response role in organ

More information

Workshop presentation: Development and application of Bioinformatics methods

Workshop presentation: Development and application of Bioinformatics methods Workshop presentation: Development and application of Bioinformatics methods Immune system Innate fast Addaptive remembers Cellular Cytotoxic T lymphocytes (CTL) Helper T lymphocytes (HTL) Humoral B lymphocytes

More information

SMPD 287 Spring 2015 Bioinformatics in Medical Product Development. Final Examination

SMPD 287 Spring 2015 Bioinformatics in Medical Product Development. Final Examination Final Examination You have a choice between A, B, or C. Please email your solutions, as a pdf attachment, by May 13, 2015. In the subject of the email, please use the following format: firstname_lastname_x

More information

The MHC and Transplantation Brendan Clark. Transplant Immunology, St James s University Hospital, Leeds, UK

The MHC and Transplantation Brendan Clark. Transplant Immunology, St James s University Hospital, Leeds, UK The MHC and Transplantation Brendan Clark Transplant Immunology, St James s University Hospital, Leeds, UK Blood Groups Immunofluorescent staining has revealed blood group substance in the cell membranes

More information

Developing Understanding of CMI. Dr Tom Wilkinson Associate Professor of Respiratory Medicine Faculty of Medicine University of Southampton UK

Developing Understanding of CMI. Dr Tom Wilkinson Associate Professor of Respiratory Medicine Faculty of Medicine University of Southampton UK Pre-existing influenza-specific CD4+ T cells correlate with homologous and heterotypic response and disease protection against influenza challenge in humans Do At Risk Groups Rely more on CMI to Viruses?

More information

Antigen capture and presentation to T lymphocytes

Antigen capture and presentation to T lymphocytes Antigen capture and presentation to T lymphocytes What T lymphocytes see Innate Immunity Immediately available or Very broad specificity rapidly recruited Adaptive Immunity Rare and naïve cells require

More information

The neoepitope landscape of breast cancer: implications for immunotherapy

The neoepitope landscape of breast cancer: implications for immunotherapy Narang et al. BMC Cancer (2019) 19:200 https://doi.org/10.1186/s12885-019-5402-1 RESEARCH ARTICLE The neoepitope landscape of breast cancer: implications for immunotherapy Pooja Narang 1, Meixuan Chen

More information

Immunology - Lecture 2 Adaptive Immune System 1

Immunology - Lecture 2 Adaptive Immune System 1 Immunology - Lecture 2 Adaptive Immune System 1 Book chapters: Molecules of the Adaptive Immunity 6 Adaptive Cells and Organs 7 Generation of Immune Diversity Lymphocyte Antigen Receptors - 8 CD markers

More information

Host Genomics of HIV-1

Host Genomics of HIV-1 4 th International Workshop on HIV & Aging Host Genomics of HIV-1 Paul McLaren École Polytechnique Fédérale de Lausanne - EPFL Lausanne, Switzerland paul.mclaren@epfl.ch Complex trait genetics Phenotypic

More information

Innate and Cellular Immunology Control of Infection by Cell-mediated Immunity

Innate and Cellular Immunology Control of Infection by Cell-mediated Immunity Innate & adaptive Immunity Innate and Cellular Immunology Control of Infection by Cell-mediated Immunity Helen Horton PhD Seattle Biomedical Research Institute Depts of Global Health & Medicine, UW Cellular

More information

Determinants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco

Determinants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco Determinants of Immunogenicity and Tolerance Abul K. Abbas, MD Department of Pathology University of California San Francisco EIP Symposium Feb 2016 Why do some people respond to therapeutic proteins?

More information

HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol

HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol HLA and antigen presentation Department of Immunology Charles University, 2nd Medical School University Hospital Motol MHC in adaptive immunity Characteristics Specificity Innate For structures shared

More information

a. From the grey navigation bar, mouse over Analyze & Visualize and click Annotate Nucleotide Sequences.

a. From the grey navigation bar, mouse over Analyze & Visualize and click Annotate Nucleotide Sequences. Section D. Custom sequence annotation After this exercise you should be able to use the annotation pipelines provided by the Influenza Research Database (IRD) and Virus Pathogen Resource (ViPR) to annotate

More information

B F. Location of MHC class I pockets termed B and F that bind P2 and P9 amino acid side chains of the peptide

B F. Location of MHC class I pockets termed B and F that bind P2 and P9 amino acid side chains of the peptide Different MHC alleles confer different functional properties on the adaptive immune system by specifying molecules that have different peptide binding abilities Location of MHC class I pockets termed B

More information

Key Concept B F. How do peptides get loaded onto the proper kind of MHC molecule?

Key Concept B F. How do peptides get loaded onto the proper kind of MHC molecule? Location of MHC class I pockets termed B and F that bind P and P9 amino acid side chains of the peptide Different MHC alleles confer different functional properties on the adaptive immune system by specifying

More information

Immunotherapy for HCC

Immunotherapy for HCC Immunotherapy for HCC Jack R. Wands, MD Jeffrey and Kimberly Greenberg - Artemis and Martha Joukowsky, Professor in Gastroenterology and Professor of Medical Sciences, Director, Division of Gastroenterology

More information

1 Introduction Epitope prediction Prediction methods used for MHC class I... 4

1 Introduction Epitope prediction Prediction methods used for MHC class I... 4 Contents 1 Introduction... 1 2 Epitope prediction... 1 2.1 Prediction methods used for MHC class I... 4 3 Algorithms used for machine learning... 5 4 References... 10 1 Introduction This document supplements

More information

T Cell Differentiation

T Cell Differentiation T Cell Differentiation Ned Braunstein, MD MHC control of Immune Responsiveness: Concept Whether or not an individual makes an immune response to a particular antigen depends on what MHC alleles an individual

More information

Phase of immune response

Phase of immune response Antigen and antigen recognition by lymphocytes Antigen presentation to T lymphocytes Sanipa Suradhat Department of Veterinary Microbiology Faculty of Veterinary Science Phase of immune response 1 Phase

More information

Measuring naturally acquired immune responses to candidate malaria vaccine antigens in Ghanaian adults

Measuring naturally acquired immune responses to candidate malaria vaccine antigens in Ghanaian adults RESEARCH Open Access Measuring naturally acquired immune responses to candidate malaria vaccine antigens in Ghanaian adults Daniel Dodoo 1, Michael R Hollingdale 2, Dorothy Anum 1, Kwadwo A Koram 1, Ben

More information

Co-evolution of host and pathogen: HIV as a model. Can Keşmir Theoretical Biology/Bioinformatics Utrecht University, NL

Co-evolution of host and pathogen: HIV as a model. Can Keşmir Theoretical Biology/Bioinformatics Utrecht University, NL Co-evolution of host and pathogen: HIV as a model Can Keşmir Theoretical Biology/Bioinformatics Utrecht University, NL c.kesmir@bio.uu.nl Outline Does HIV adapt to monomorphic human molecules? Polymorphic

More information

General information. Cell mediated immunity. 455 LSA, Tuesday 11 to noon. Anytime after class.

General information. Cell mediated immunity. 455 LSA, Tuesday 11 to noon. Anytime after class. General information Cell mediated immunity 455 LSA, Tuesday 11 to noon Anytime after class T-cell precursors Thymus Naive T-cells (CD8 or CD4) email: lcoscoy@berkeley.edu edu Use MCB150 as subject line

More information

Computational prediction of immunodominant antigenic regions & potential protective epitopes for dengue vaccination

Computational prediction of immunodominant antigenic regions & potential protective epitopes for dengue vaccination Indian J Med Res 144, October 2016, pp 587-591 DOI: 10.4103/0971-5916.200894 Quick Response Code: Computational prediction of immunodominant antigenic regions & potential protective epitopes for dengue

More information

E.J. Glass. AFRC Institute of Animal Physiology and Genetics Research, Edinburgh Research Station, Roslin, Midlothian, EH25 9PS, U.K.

E.J. Glass. AFRC Institute of Animal Physiology and Genetics Research, Edinburgh Research Station, Roslin, Midlothian, EH25 9PS, U.K. THE ROLE OF MHC CLASS II IN IMMUNE RESPONSES IN CATTLE E.J. Glass AFRC Institute of Animal Physiology and Genetics Research, Edinburgh Research Station, Roslin, Midlothian, EH25 9PS, U.K. 388 SUMMARY Polymorphism

More information

Attribution: University of Michigan Medical School, Department of Microbiology and Immunology

Attribution: University of Michigan Medical School, Department of Microbiology and Immunology Attribution: University of Michigan Medical School, Department of Microbiology and Immunology License: Unless otherwise noted, this material is made available under the terms of the Creative Commons Attribution

More information

Significance of the MHC

Significance of the MHC CHAPTER 8 Major Histocompatibility Complex (MHC) What is MHC? HLA H-2 Minor histocompatibility antigens Peter Gorer & George Sneell (1940) - MHC molecules were initially discovered during studies aimed

More information

Conserved epitopes on HIV-1, FIV and SIV p24 proteins are recognized by HIV-1 infected subjects

Conserved epitopes on HIV-1, FIV and SIV p24 proteins are recognized by HIV-1 infected subjects Human Vaccines & Immunotherapeutics ISSN: 2164-5515 (Print) 2164-554X (Online) Journal homepage: http://www.tandfonline.com/loi/khvi20 Conserved epitopes on HIV-1, FIV and SIV p24 proteins are recognized

More information

Supplementary Figure 1. ALVAC-protein vaccines and macaque immunization. (A) Maximum likelihood

Supplementary Figure 1. ALVAC-protein vaccines and macaque immunization. (A) Maximum likelihood Supplementary Figure 1. ALVAC-protein vaccines and macaque immunization. (A) Maximum likelihood tree illustrating CRF01_AE gp120 protein sequence relationships between 107 Envs sampled in the RV144 trial

More information

Antigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS

Antigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS 1 Antigen Presentation and T Lymphocyte Activation Abul K. Abbas UCSF FOCiS 2 Lecture outline Dendritic cells and antigen presentation The role of the MHC T cell activation Costimulation, the B7:CD28 family

More information

Nature Immunology: doi: /ni Supplementary Figure 1

Nature Immunology: doi: /ni Supplementary Figure 1 Supplementary Figure 1 A β-strand positions consistently places the residues at CDR3β P6 and P7 within human and mouse TCR-peptide-MHC interfaces. (a) E8 TCR containing V β 13*06 carrying with an 11mer

More information

25/10/2017. Clinical Relevance of the HLA System in Blood Transfusion. Outline of talk. Major Histocompatibility Complex

25/10/2017. Clinical Relevance of the HLA System in Blood Transfusion. Outline of talk. Major Histocompatibility Complex Clinical Relevance of the HLA System in Blood Transfusion Dr Colin J Brown PhD FRCPath. October 2017 Outline of talk HLA genes, structure and function HLA and immune complications of transfusion TA-GVHD

More information

LIPOPREDICT: Bacterial lipoprotein prediction server

LIPOPREDICT: Bacterial lipoprotein prediction server www.bioinformation.net Server Volume 8(8) LIPOPREDICT: Bacterial lipoprotein prediction server S Ramya Kumari, Kiran Kadam, Ritesh Badwaik & Valadi K Jayaraman* Centre for Development of Advanced Computing

More information

Rotavirus Genotyping and Enhanced Annotation in the Virus Pathogen Resource (ViPR) Yun Zhang J. Craig Venter Institute ASV 2016 June 19, 2016

Rotavirus Genotyping and Enhanced Annotation in the Virus Pathogen Resource (ViPR) Yun Zhang J. Craig Venter Institute ASV 2016 June 19, 2016 Rotavirus Genotyping and Enhanced Annotation in the Virus Pathogen Resource (ViPR) Yun Zhang J. Craig Venter Institute ASV 2016 June 19, 2016 Loading Virus Pathogen Database and Analysis About Resource

More information

Antigen presenting cells

Antigen presenting cells Antigen recognition by T and B cells - T and B cells exhibit fundamental differences in antigen recognition - B cells recognize antigen free in solution (native antigen). - T cells recognize antigen after

More information

Potential Elucidation of a Novel CTL Epitope in HIV-1 Protease by the Protease Inhibitor Resistance Mutation L90M

Potential Elucidation of a Novel CTL Epitope in HIV-1 Protease by the Protease Inhibitor Resistance Mutation L90M Potential Elucidation of a Novel CTL Epitope in HIV-1 Protease by the Protease Inhibitor Resistance Mutation L90M Werner Smidt* Bioinformatics and Computational Biology Unit, Department of Biochemistry,

More information

T Cell Development II: Positive and Negative Selection

T Cell Development II: Positive and Negative Selection T Cell Development II: Positive and Negative Selection 8 88 The two phases of thymic development: - production of T cell receptors for antigen, by rearrangement of the TCR genes CD4 - selection of T cells

More information

How T cells recognize antigen: The T Cell Receptor (TCR) Identifying the TCR: Why was it so hard to do? Monoclonal antibody approach

How T cells recognize antigen: The T Cell Receptor (TCR) Identifying the TCR: Why was it so hard to do? Monoclonal antibody approach How T cells recognize antigen: The T Cell Receptor (TCR) Identifying the TCR: Why was it so hard to do By the early 1980s, much about T cell function was known, but the receptor genes had not been identified

More information