Molecular biology, isotopic labeling, and refolding of membrane proteins in phospholipid bilayers.
|
|
- Nancy Lee
- 6 years ago
- Views:
Transcription
1 Molecular biology, isotopic labeling, and refolding of membrane proteins in phospholipid bilayers. 1
2 Preparation of membrane proteins for NMR experiments. Established bacterial overexpression systems. Over forty different constructs of various membrane proteins. Improved purification and refolding protocols. Efficient detergent removal and sample quality control by lipid analysis. Implemented various lipid bilayer systems. Proteoliposomes. Nanodiscs and macrodiscs. Bicelles. Implemented various isotopic labeling schemes. Several types of sparse labeling. Complementary selective labeling. Perdeuteration. Preparation of membrane proteins for NMR experiments plays an important role in our BTRC program together with the development in NMR probes, pulse programs, and structure calculations. 2
3 General protocol for sample preparation of membrane proteins. Vpu TM CXCR1 CXCR1 Vpu TM Lipid analysis by Evaporative Light Scattering Detection (ELSD) Before reconstitution After reconstitution The protocol can be applied to a wide range of membrane proteins from a small single transmembrane protein to a large seven transmembrane helical protein. retention (ml) 3
4 Expression, purification, and refolding of human GPCRs. Function & related diseases Fusion protein Expression vector & host cells Reconstitution lipids Yield (mg/l culture) CXCR1 Chemokine receptor Inflammatory responses GST pgex-2t BL21 DMPC DMPC/POPC 8 AVPR2 Arginine vasopression receptor Nephrogenic diabetes insipidus KSI pet-31b(+) C43(DE3) DMPC DMPC/POPC 2 b2ar Adrenergic receptor Asthma, obesity, type 2 diabetes KSI pet-31b(+) BL21(DE3)plysS DPPC/CHS 3 CB2* Cannabinoid receptor Immune system, Neurodegenerative disorders GST pgex-2t BL21 codon plus DMPC ~1 *Collaboration with Sean Xie s group at the University of Pittsburgh. The refolding and reconstitution protocol originally developed for CXCR1 was successfully applied to other GPCRs with minor modifications, and the multi-milligram quantities of the functional receptors were obtained. 4
5 Refolded GPCRs have biological activities. G-protein activation assay NMR binding experiments CXCR1 unbound EC 50 = 1 nm CXCR1 bound 1 H shift (ppm) b2ar Fluorescent antagonist binding Competitive CB2 in ligand DMPC binding displacement H 3 CP55940 assay CB H CP55,940 %specific binding 50 0 K i = 4.74 nm log[sr144528] M Xie and coworkers 5
6 Two-dimensional 13 C/ 13 C correlation MAS solid-state NMR spectra of three constructs of Vpu from HIV-1. Vpu Full Vpu Cyto Vpu TM QPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVELGVELGHHAPWDVDDL EYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVELGVELGHHAPWDVDDL QPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK 81 Vpu Full Vpu Cyto Vpu TM ~ 2 mg of uniformly 13 C/ 15 N-labeled protein, lipid/protein = 5 10 (w/w) 6
7 Membrane environment affects the structure of p7 from hepatitis C virus. P7 ALENLVVLNAASVAGAHGILSFLVFFSAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA 63 DHPC detergent micelles DMPC lipid bilayers C N C In general, membrane proteins are more stable in lipid bilayers than in detergent micelles, suggesting that the p7 structure in lipid bilayers is more relevant to the native structure in cell membranes. N 7
8 * * * * Terminal truncation affects the structure of the bacterial mercury transporter MerF. MerF MerFt * * KDPKTLLRVSIIGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASSTPKFNGVKKS IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS 81 A52 A19 MerF MerFt A N C N C It is important to study the full-length membrane proteins in lipid bilayers in order to obtain accurate structurefunction relationships of membrane proteins. 8
9 Mobile N-terminal region of CXCR1 is immobilized upon interaction with its ligand interleukin-8. Unbound 1TM-CXCR1 IL-8 bound 1TM-CXCR1 unlabeled IL-8 15 N-1TM-CXCR1 15 N-1TM-CXCR1 15 N shift (ppm) 15 N shift (ppm) We have determined the structure of the unmodified full-length chemokine receptor CXCR1 in lipid bilayers. And now we continue working on the structure of the complex of the receptor, ligand and G-proteins in order to understand the activation mechanism of CXCR1. 9
10 Cell-free expression of membrane proteins. Quick production of membrane proteins. Selective amino acid labeling. Unnatural amino acid incorporation. Cell-free Cell-based TM-CXCR MSP GST TM-CXCR1 1TM-CXCR1 lipids MSP Nanodisc 1. Supernatant in the presence of nanodiscs 2. Precipitate in the absence of nanodiscs 3. 1TM-CXCR1 and GST in the presence of detergents MembraneMax expression kit: 10
11 Unnatural amino acid incorporation into membrane proteins. HQA 1 : (2-Amino-3-(8-hydroxyquinolin-3-yl)propanoic acid. Forms stable complexes with metal ions and lanthanides. Apply to distance measurement by Paramagnetic Relaxation Enhancement. pevol-aars 2 prok term trna prok prom PstI (4801) Xho I (5336) ApaLI (5112) glns T aars CmR pevol 6124 bp p15a arac Nde I (3874) glns' rrnb SalI (3453) aars arabad BglII (2526) 1. Lee HS, Spraggon G, Schultz PG, Wang F J Am Chem Soc (2009). 2. Yong TS, Ahmand I, Yin JA, Schultz PG J Mol Biol (2010). 11
12 Segmental labeling of membrane proteins using Sortase A. Sortase A: Staphylococcus aureus transpeptidase. Reduce NMR spectral complexity. Generate post-translationally modified proteins. CXCR1 Gai Sortase A Nanodiscs Various CXCR1 constructs Segmental labeling is used to specifically label a protein segment with NMR active nuclei, and as a result it reduces NMR spectral complexity, providing more flexibility in sample preparations and facilitate structural studies of multi-domain membrane proteins. 12
Oriented Sample Solid-State NMR Spectroscopy Stanley J. Opella University of California, San Diego
Winter School 2016 Oriented Sample Solid-State NMR Spectroscopy Stanley J. Opella University of California, San Diego Introduction. Contents of an Escherichia coli cell is enclosed by its plasma membrane,
More informationProtein-Membrane Interaction Studies using NMR Spectroscopy
2017 Soft Matter Summer School on Membranes Protein-Membrane Interaction Studies using NMR Spectroscopy Jung Ho Lee Department of Chemistry Seoul National University, Korea Motivation Compartmentalization
More informationChemical Biology of Tea Catechins
Workshop Argentina-Japan Bioscience and Biotechnology for the Promotion of Agriculture and Food Production August 4 th 2009 Chemical Biology of Tea Catechins Tsutomu NAKAYAMA Laboratory of Molecular Food
More informationCHAPTER 4. Tryptophan fluorescence quenching by brominated lipids
CHAPTER 4 Tryptophan fluorescence quenching by brominated lipids 102 4.1 INTRODUCTION The structure and dynamics of biological macromolecules have been widely studied with fluorescence quenching. The accessibility
More informationAdvances in membrane-protein crystallization: From detergent-free crystallization to in situ approaches. Dr. Jana Broecker
Advances in membrane-protein crystallization: From detergent-free crystallization to in situ approaches Dr. Jana Broecker jana.broecker@utoronto.ca 6 th International Symposium on HOS of Protein Therapeutics
More informationSupplementary Information. Supplementary Figures
Supplementary Information Supplementary Figures Supplementary Figure 1: Mutational analysis of the ADP-based coupled ATPase-AK activity. (a) Proposed model for the coupled ATPase/AK reaction upon addition
More informationNature Methods: doi: /nmeth Supplementary Figure 1. Salipro lipid particles.
Supplementary Figure 1 Salipro lipid particles. (a) Gel filtration analysis of Saposin A after incubation with the indicated detergent solubilised lipid solutions. The generation of Saposin A-lipid complexes
More informationMemMagic Bicelle Screen kit
MemMagic Bicelle Screen kit INSTRUCTION MANUAL Catalog MX 201001 MemMagic Bicelle Screen kit (100 l) MX 201002 MemMagic Bicelle Screen kit (250 l) Revision A For In Vitro Use Only www.memxbio.com MemMagic
More informationScreening Conditions for NMR of Integral Membrane Proteins Updated 1/2015
Screening Conditions for NMR of Integral Membrane Proteins Updated 1/2015 Charles R. Sanders, Vanderbilt University chuck.sanders@vanderbilt.edu phone: 615-833-2586 Background Reading Solution NMR of membrane
More informationWeek 5 Section. Junaid Malek, M.D.
Week 5 Section Junaid Malek, M.D. HIV: Anatomy Membrane (partiallystolen from host cell) 2 Glycoproteins (proteins modified by added sugar) 2 copies of RNA Capsid HIV Genome Encodes: Structural Proteins
More informationChapter 12: Membranes. Voet & Voet: Pages
Chapter 12: Membranes Voet & Voet: Pages 390-415 Slide 1 Membranes Essential components of all living cells (define boundry of cells) exclude toxic ions and compounds; accumulation of nutrients energy
More informationLife Sciences 1A Midterm Exam 2. November 13, 2006
Name: TF: Section Time Life Sciences 1A Midterm Exam 2 November 13, 2006 Please write legibly in the space provided below each question. You may not use calculators on this exam. We prefer that you use
More informationALLOSTERIC REGULATION OF GPCR ACTIVITY BY PHOSPHOLIPIDS
Supplementary Information ALLOSTERIC REGULATION OF GPCR ACTIVITY BY PHOSPHOLIPIDS Rosie Dawaliby 1, Cataldo Trubbia 1, Cédric Delporte 3,4, Matthieu Masureel 2, Pierre Van Antwerpen 3,4, Brian K. Kobilka
More informationCapture and reconstitution of G protein-coupled receptors on a biosensor surface
ANALYTICAL BIOCHEMISTRY Analytical Biochemistry 316 (2003) 243 250 www.elsevier.com/locate/yabio Capture and reconstitution of G protein-coupled receptors on a biosensor surface Peter Stenlund, a Gregory
More informationStructural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB
Structural Characterization of Prion-like Conformational Changes of the Neuronal Isoform of Aplysia CPEB Bindu L. Raveendra, 1,5 Ansgar B. Siemer, 2,6 Sathyanarayanan V. Puthanveettil, 1,3,7 Wayne A. Hendrickson,
More informationStructure of Outer Membrane Protein OmpG (and how we got there) Lukas Tamm University of Virginia
Structure of Outer Membrane Protein OmpG (and how we got there) Lukas Tamm University of Virginia MEMBRANE PROTEINS ARE ABUNDANT AND IMPORTANT BUT KNOWLEDGE DATABASE IS LAGGING FAR BEHIND THAT OF SOLUBLE
More informationOverview of the Expressway Cell-Free Expression Systems. Expressway Mini Cell-Free Expression System
Overview of the Expressway Cell-Free Expression Systems The Expressway Cell-Free Expression Systems use an efficient coupled transcription and translation reaction to produce up to milligram quantities
More informationSOLID-STATE NMR SPECTROSCOPY TO STUDY PROTEIN-LIPID INTERACTIONS Daniel Huster
Institute of Medical Physics and Biophysics Leipzig University Author Manuscript Published in final edited form as: Biochim. Biophys. Acta (Molecular and Cell Biology of Lipids), 2014 Aug; 1841(8):1146-1160.
More informationSupporting Information
Supporting Information A single design strategy for dual sensitive ph probe with a suitable range to map ph in living cells Kang-Kang Yu, Ji-Ting Hou, Kun Li, * Qian Yao, Jin Yang, Ming-Yu Wu, Yong-Mei
More informationCell Biology Lecture 9 Notes Basic Principles of cell signaling and GPCR system
Cell Biology Lecture 9 Notes Basic Principles of cell signaling and GPCR system Basic Elements of cell signaling: Signal or signaling molecule (ligand, first messenger) o Small molecules (epinephrine,
More informationStable isotope labeled Media products
www.isotope.com RESEARCH PRODUCTS Stable isotope labeled Media products Bacterial Cell Growth Insect Cell Growth Mammalian Cell Growth Yeast Cell Growth Minimal Media for Bacterial Cell Growth Spectra
More informationBioluminescence Resonance Energy Transfer (BRET)-based studies of receptor dynamics in living cells with Berthold s Mithras
Bioluminescence Resonance Energy Transfer (BRET)-based studies of receptor dynamics in living cells with Berthold s Mithras Tarik Issad, Ralf Jockers and Stefano Marullo 1 Because they play a pivotal role
More informationStructure-Transport Relationship in Organized Soft Matter Systems by Diffusion NMR. Sergey Vasenkov
Structure-Transport Relationship in Organized Soft Matter Systems by Diffusion NMR Sergey Vasenkov Outline Combining advantages of high field and high gradients in diffusion NMR Relationship between diffusivities
More informationThe Amyloid Precursor Protein Has a Flexible Transmembrane Domain and Binds Cholesterol
The Amyloid Precursor Protein Has a Flexible Transmembrane Domain and Binds Cholesterol Science 336, 1171 (2013) Coach Prof. : Dr. Chung-I Chang Sit-in Prof.: Dr. Wei Yuan Yang Presenter: Han-Ying Wu Date:
More informationSupplementary Information: Liquid-liquid phase coexistence in lipid membranes observed by natural abundance 1 H 13 C solid-state NMR
Electronic Supplementary Material (ESI) for Physical Chemistry Chemical Physics. This journal is the wner Societies 28 Supplementary Information: Liquid-liquid phase coexistence in lipid membranes observed
More informationNanodiscs and Macro-Nanodiscs for Structural Studies by NMR
Nanodiscs and Macro-Nanodiscs for Structural Studies by NMR Ayyalusamy (Rams) Ramamoorthy Chemistry and Biophysics, University of Michigan Thanks to NIH funding Our Research at the Cell Membrane David
More informationStable Isotope Labeled Media Products
Cambridge Isotope Laboratories, Inc. www.isotope.com RESEARCH PRODUCTS Stable Isotope Labeled Media Products Bacterial Cell Growth Insect Cell Growth Mammalian Cell Growth Yeast Cell Growth Cambridge Isotope
More informationGCD3033:Cell Biology. Plasma Membrane Dynamics
Plasma Membrane Dynamics Membrane Structure I) Lipid Bilayer A) Membrane Lipids B) Membrane Flexibility & Composition C) Phospholipids II) Membrane Proteins A) association with membranes B) membrane solubilization
More informationLowering Barriers to Membrane Protein Expression and Crystallization. James Bowie UCLA
Lowering Barriers to Membrane Protein Expression and Crystallization James Bowie UCLA Outline I. Improving expression of membrane proteins in E. coli Liz Massey-see poster II. New methods for crystallizing
More informationReceived: February 7, 2015 Revised: March 12, 2015 Published: March 16, 2015
pubs.acs.org/biochemistry Investigation of the Curvature Induction and Membrane Localization of the Influenza Virus M2 Protein Using Static and Off-Magic-Angle Spinning Solid-State Nuclear Magnetic Resonance
More informationI. Fluid Mosaic Model A. Biological membranes are lipid bilayers with associated proteins
Lecture 6: Membranes and Cell Transport Biological Membranes I. Fluid Mosaic Model A. Biological membranes are lipid bilayers with associated proteins 1. Characteristics a. Phospholipids form bilayers
More informationMembrane Protein. Expression Purification Reconstitution Sample Preparation
Membrane Protein Expression Purification Reconstitution Sample Preparation Tim Cross, Florida State University - if interested in help with any of the above contact us and arrange to spend a few days in
More informationRegulating Transmembrane Signaling Through Plexin- Neuropilin Oligomerization
Regulating Transmembrane Signaling Through Plexin- Neuropilin Oligomerization Bryan W. Berger Department of Chemical Engineering Program in Bioengineering Components of Cell Membranes Approximately 30-40%
More informationOXIDATIVE STRESS STUDIES ON LIPID MODEL MEMBRANES
OXIDATIVE STRESS STUDIES ON LIPID MODEL MEMBRANES MARCELA ELISABETA BARBINTA-PATRASCU *, LAURA TUGULEA * * Faculty of Physics, University of Bucharest, Romania Received December 21, 2004 The liposomes
More informationChapter 12. Part II. Biological Membrane
Chapter 12 Part II. Biological Membrane Single-tailed lipids tend to form micelles Critical micelle concentration (cmc): minimum concentration that forms micelles e.g.) cmc for SDS 1mM; cmc for phospholipids
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. (a) Uncropped version of Fig. 2a. RM indicates that the translation was done in the absence of rough mcirosomes. (b) LepB construct containing the GGPG-L6RL6-
More informationBiochemistry 2000 Sample Question Transcription, Translation and Lipids. (1) Give brief definitions or unique descriptions of the following terms:
(1) Give brief definitions or unique descriptions of the following terms: (a) exon (b) holoenzyme (c) anticodon (d) trans fatty acid (e) poly A tail (f) open complex (g) Fluid Mosaic Model (h) embedded
More informationBabyBio IMAC columns DATA SHEET DS
BabyBio IMAC columns DATA SHEET DS 45 655 010 BabyBio columns for Immobilized Metal Ion Affinity Chromatography (IMAC) are ready-to-use for quick and easy purification of polyhistidine-tagged (His-tagged)
More informationab SREBP-2 Translocation Assay Kit (Cell-Based)
ab133114 SREBP-2 Translocation Assay Kit (Cell-Based) Instructions for Use For analysis of translocation of SREBP-2 into nuclei. This product is for research use only and is not intended for diagnostic
More informationG-Protein Coupled Receptors: Structure and Function
PCTH 400 G-Protein Coupled Receptors: Structure and Function Dr. Rishi Somvanshi 2405 Wesbrook Mall rishiks@mail.ubc.ca 604-827-3672 Learning Objectives 1. GPCR? Structure and Synthesis 2. Function? Receptor
More informationChapter 8. Interaction between the phosphatidylinositol 3- kinase SH3 domain and a photocleavable cyclic peptide
Interaction between the phosphatidylinositol 3- kinase SH3 domain and a photocleavable cyclic peptide 129 Abstract The interaction of the PI3K SH3 domain with a cyclic photocleavable peptide and the linear
More informationPurification of Glucagon3 Interleukin-2 Fusion Protein Derived from E. coli
Purification of Glucagon3 Interleukin-2 Fusion Protein Derived from E. coli Hye Soon Won Dept. of Chem. Eng. Chungnam National University INTRODUCTION Human interleukin-2(hil-2) - known as T Cell Growth
More informationSupplementary Figure 1. Overview of steps in the construction of photosynthetic protocellular systems
Supplementary Figure 1 Overview of steps in the construction of photosynthetic protocellular systems (a) The small unilamellar vesicles were made with phospholipids. (b) Three types of small proteoliposomes
More informationElectronic Supplementary Material
Electronic Supplementary Material PAMAM Dendrimers Bearing Electron-Donating Chromophores: Fluorescence and Electrochemical Properties Bing-BingWang a, Xin Zhang a, Ling Yang a, Xin-Ru Jia* a, Yan Ji a,
More information(multiple answers) This strain of HIV uses a different chemokine coreceptor for entry into cells.
LS1a Fall 06 Problem Set #4 100 points total all questions including the (*extra*) one should be turned in TF 1. (20 points) To further investigate HIV infection you decide to study the process of the
More informationOvercoming bottlenecks in the membrane protein structural biology pipeline
Overcoming bottlenecks in the membrane protein structural biology pipeline David Hardy 1,2, Roslyn M Bill 1, Anass Jawhari 2 & Alice J Rothnie 1 1 Life & Health Sciences, Aston University, Birmingham,
More informationThe Effect of Zn2+ Binding on the Chemistry of Tm3+ and Eu3+ Chelates
Portland State University PDXScholar University Honors Theses University Honors College 3-1-2018 The Effect of Zn2+ Binding on the Chemistry of Tm3+ and Eu3+ Chelates Diana King Portland State University
More information[14] NMR Experiments on Aligned Samples of Membrane Proteins
350 challenging systems for NMR [14] Wishart, D. S., and Case, D. A. (2001). Use of chemical shifts in macromolecular structure determination. Methods Enzymol. 338, 3 34. Yang, D. W., and Kay, L. E. (1999).
More informationPrevalent mechanism of membrane bridging by synaptotagmin-1
Prevalent mechanism of membrane bridging by synaptotagmin-1 Alpay B. Seven a, Kyle D. Brewer a, Liang Shi b, Qiu-Xing Jiang b, and Josep Rizo a,1 a Departments of Biophysics, Biochemistry, and Pharmacology
More informationProteins? Protein function. Protein folding. Protein folding diseases. Protein interactions. Macromolecular assemblies. The end product of Genes
Proteins? Protein function Protein folding Protein folding diseases Protein interactions Macromolecular assemblies The end product of Genes Protein Unfolding DOD Acid Catalysis DOD HDOD + N H N D C N C
More informationChapter 3. Structure of Enzymes. Enzyme Engineering
Chapter 3. Structure of Enzymes Enzyme Engineering 3.1 Introduction With purified protein, Determining M r of the protein Determining composition of amino acids and the primary structure Determining the
More informationRama Abbady. Odai Bani-Monia. Diala Abu-Hassan
5 Rama Abbady Odai Bani-Monia Diala Abu-Hassan Lipid Rafts Lipid rafts are aggregates (accumulations) of sphingolipids. They re semisolid clusters (10-200 nm) of cholesterol and sphingolipids (sphingomyelin
More informationThe human immunodeficiency virus (HIV) is enveloped by
pubs.acs.org/biochemistry Solid-State Nuclear Magnetic Resonance (NMR) Spectroscopy of Human Immunodeficiency Virus gp41 Protein That Includes the Fusion Peptide: NMR Detection of Recombinant Fgp41 in
More informationLecture 2 I. Membrane Proteins II. Intracellular Compartments
Lecture 2 I. Membrane Proteins II. Intracellular Compartments Ref: MBoC (5th Edition), Alberts Johnson Lewis Raff Roberts Walter Chapter 10 Membrane Structure Chapter 12 Intracellular Compartments and
More informationQuantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles
Quantifying Lipid Contents in Enveloped Virus Particles with Plasmonic Nanoparticles Amin Feizpour Reinhard Lab Department of Chemistry and the Photonics Center, Boston University, Boston, MA May 2014
More informationAdvanced Cell Biology. Lecture 28
Advanced Cell Biology. Lecture 28 Alexey Shipunov Minot State University April 8, 2013 Shipunov (MSU) Advanced Cell Biology. Lecture 28 April 8, 2013 1 / 41 Outline Questions and answers Shipunov (MSU)
More informationWater Interactions with Membrane Proteins & Other Biomolecules from 1. H-X Heteronuclear Correlation NMR. Mei Hong Department of Chemistry, MIT
Water Interactions with Membrane Proteins & Other Biomolecules from 1 H-X Heteronuclear Correlation NMR Mei Hong Department of Chemistry, MIT 4 th Winter School on Biomolecular Solid-State NMR, Stowe,
More informationNIH Public Access Author Manuscript Org Lett. Author manuscript; available in PMC 2011 September 3.
NIH Public Access Author Manuscript Published in final edited form as: Org Lett. 2010 September 3; 12(17): 3776 3779. doi:10.1021/ol101408f. Preparation of Translationally Competent trna by Direct Chemical
More informationChapter 2 Structural Insights into Activation and Allosteric Modulation of G Protein-Coupled Receptors
Chapter 2 Structural Insights into Activation and Allosteric Modulation of G Protein-Coupled Receptors Andrew C. Kruse Abstract G protein-coupled receptors (GPCRs) are cell-surface receptors that regulate
More informationAdvanced Cell Biology. Lecture 28
Alexey Shipunov Minot State University March 30, 2012 Outline Questions and answers Outline Questions and answers Questions and answers Previous final question: the answer How to make a transgenic organism
More informationBL-8040: BEST-IN-CLASS CXCR4 ANTAGONIST FOR TREATMENT OF ONCOLOGICAL MALIGNANCIES. Overview and Mechanism of Action Dr.
BL-8040: BEST-IN-CLASS CXCR4 ANTAGONIST FOR TREATMENT OF ONCOLOGICAL MALIGNANCIES Overview and Mechanism of Action Dr. Leah Klapper, CSO 88 BL-8040: Novel CXCR4 Antagonist For Hematological Cancers Indications:
More informationChapter 3b Cells Membrane transport - Student Notes
Chapter 3b Cells Membrane transport - Student Notes 1 Transport are permeable Some molecules the membrane; others do 2 Types of Membrane Transport processes No cellular required Substance its processes
More informationDiffusion and Solid State NMR Studies of Structures in Model Biological Membranes. Hyo Soon Cho. B. S. in Chemistry, Korea University, 2002
Diffusion and Solid State NMR Studies of Structures in Model Biological Membranes by Hyo Soon Cho B. S. in Chemistry, Korea University, 2002 M. S. in Chemistry, Seoul National University, 2004 Submitted
More informationFluid Mozaic Model of Membranes
Replacement for the 1935 Davson Danielli model Provided explanation for Gortner-Grendel lack of lipid and permitted the unit membrane model. Trans membrane protein by labelling Fry & Edidin showed that
More informationChapter 7: Membranes
Chapter 7: Membranes Roles of Biological Membranes The Lipid Bilayer and the Fluid Mosaic Model Transport and Transfer Across Cell Membranes Specialized contacts (junctions) between cells What are the
More informationElectronic Supporting Information
Electronic Supporting Information Detection of Hg 2+ by Cyanobacteria in Aqueous media. Moorthy Suresh, Sanjiv K. Mishra, Sandhya Mishra* and Amitava Das* Contents 1. Absorption spectrum of C-Phycocyanin
More informationCell Membranes. Dr. Diala Abu-Hassan School of Medicine Cell and Molecular Biology
Cell Membranes Dr. Diala Abu-Hassan School of Medicine Dr.abuhassand@gmail.com Cell and Molecular Biology Organelles 2Dr. Diala Abu-Hassan Membrane proteins Major components of cells Nucleic acids DNA
More informationWork-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples:
Dr. Sanjeeva Srivastava IIT Bombay Work-flow: protein sample preparation Precipitation methods Removal of interfering substances Specific examples: Sample preparation for serum proteome analysis Sample
More informationIn vitro Expression of Human Cannabinoid 1 Receptor for Ligand-assisted Binding Site Characterization
In vitro Expression of Human Cannabinoid 1 Receptor for Ligand-assisted Binding Site Characterization Master s Thesis Presented by Srikrishnan Mallipeddi To Bouvé College of Health Sciences In Partial
More informationSupporting Information
Supporting Information Chen et al. 10.1073/pnas.1106420108 SI Materials and Methods High-Level Expression of Human apoe3. A monomeric, biologically active, full-length human apoe3 is generated using an
More informationConsiderations for the preparation of biological samples for solid-state NMR
Considerations for the preparation of biological samples for solid-state NMR Dr Philip Williamson September 2011 Solid-state NMR studies of biomolecules Biological samples studies by solid-state NMR Structure
More informationSignal-Transduction Cascades - 2. The Phosphoinositide Cascade
Signal-Transduction Cascades - 2 The Phosphoinositide Cascade Calcium ion as a second messenger Tyrosine kinase and receptor dimerization scribd.com Faisal Khatib JU The Phosphoinositide Cascade Used by
More informationIncorporation of porin channels into miniaturized bilayers
Incorporation of porin channels into miniaturized bilayers Tivadar Mach, Mohammed Kreir, Niels Fertig, Mathias Winterhalter Marseille 11 April 2008 Folded classical bilayer Main issues: time resolution
More informationGSI Canine IL-5 ELISA Kit-2 Plates DataSheet
Interleukin5 (IL5) is a secreted glycoprotein that belongs to the α-helical group of cytokines (1, 2, 3). Unlike other family members, it is present as a covalently linked antiparallel dimer (4, 5). IL-5
More informationStable Isotope Labeled Media Products
www.iso ope.com Cambridge Iso ope Labora ories, Inc. www.iso ope.com RESEARCH PRODUC S Stable Isotope Labeled Media Products Cambridge Iso ope Labora ories, Inc. Minimal Media for Bacterial Cell Growth
More informationG Protein-Coupled Receptors as Drug Targets
G Protein-Coupled Receptors as Drug Targets Analysis of Activation and Constitutive Activity Edited by Roland Seifert and Thomas Wieland WILEY- VCH WILEY-VCH Verlag GmbH & Co. KGaA Table of Contents Preface
More informationThe Cell Membrane (Ch. 7)
The Cell Membrane (Ch. 7) Phospholipids Phosphate head hydrophilic Fatty acid tails hydrophobic Arranged as a bilayer Phosphate attracted to water Fatty acid repelled by water Aaaah, one of those structure
More informationChapter 3, Part A (Pages 37-45): Leukocyte Migration into Tissues
Allergy and Immunology Review Corner: Chapter 3, Part A (pages 37-45) of Cellular and Molecular Immunology (Seventh Edition), by Abul K. Abbas, Andrew H. Lichtman and Shiv Pillai. Chapter 3, Part A (Pages
More informationMultidimensional Tracking of GPCR Signaling with Proximity- Labeling. Technical Journal Club Anna Henzi,
Multidimensional Tracking of GPCR Signaling with Proximity- Labeling Technical Journal Club Anna Henzi, 11.07.2017 Proximity-dependent labeling methods Enzymes create radicals Proximity-dependent biotin
More informationP NMR in lipid membranes. CSA recoupling.
31 P NMR in lipid membranes. CSA recoupling. Ludovic BERTHELT, Dror E. WARSCHAWSKI & Philippe F. DEVAUX 1 1 Laboratoire de physico-chimie moléculaire des membranes biologiques UPR 9052 Alpine conference
More information3) How many different amino acids are proteogenic in eukaryotic cells? A) 12 B) 20 C) 25 D) 30 E) None of the above
Suggesting questions for Biochemistry 1 and 2 and clinical biochemistry 1) Henderson Hasselbalch Equation shows: A) The relationship between ph and the concentration of an acid and its conjugate base B)
More informationLecture 33 Membrane Proteins
Lecture 33 Membrane Proteins Reading for today: Chapter 4, section D Required reading for next Wednesday: Chapter 14, sections A and 14.19 to the end Kuriyan, J., and Eisenberg, D. (2007) The origin of
More informationHormones and Signal Transduction. Dr. Kevin Ahern
Dr. Kevin Ahern Signaling Outline Signaling Outline Background Signaling Outline Background Membranes Signaling Outline Background Membranes Hormones & Receptors Signaling Outline Background Membranes
More informationFundamentals of Pharmacology
Fundamentals of Pharmacology Topic Page Receptors 2 Ion channels / GABA 4 GPCR s 6 TK receptors 8 Basics of PK 11 ADR s / Clinical study design 13 Introduction to the ANS 16 Cholinergic Pharmacology 20
More informationCellular Biochemistry
Cellular Biochemistry Fall Semester 2013 Sept. 23 Benoit Kornmann Institute of Biochemistry Introduction to biological membranes General functions and properties Membrane lipids Physical properties Distribution/asymmetry
More informationARV Mode of Action. Mode of Action. Mode of Action NRTI. Immunopaedia.org.za
ARV Mode of Action Mode of Action Mode of Action - NRTI Mode of Action - NNRTI Mode of Action - Protease Inhibitors Mode of Action - Integrase inhibitor Mode of Action - Entry Inhibitors Mode of Action
More informationEffect of temperature on liposome structures studied using EPR spectroscopy
Spectroscopy 19 (2005) 37 42 37 IOS Press Effect of temperature on liposome structures studied using EPR spectroscopy W.W. Sułkowski a,,d.pentak a, W. Korus a and A. Sułkowska b a Department of Environmental
More informationPREDICTING THE EXPRESSION AND SOLUBILITY OF MEMBRANE PROTEINS
PREDICTING THE EXPRESSION AND SOLUBILITY OF MEMBRANE PROTEINS Mark E. Dumont, Michael A. White, Kathy Clark, Elizabeth J. Grayhack, and Eric. M. Phizicky Unknowns in Membrane Protein Expression, and Solubilization
More informationSelective methyl labeling of eukaryotic membrane proteins using cell-free expression
Supplementary Information for the manuscript: Selective methyl labeling of eukaryotic membrane proteins using cell-free expression By Rasmus Linser, Vladimir Gelev, Franz Hagn, Haribabu Arthanari, Sven
More informationFusion (%) = 100 (B-A)/(C-A)
6 Fusion (%) = 1 (B-A)/(C-A) fluorescence, a.u. x 1 C 1 B A 6 1 A Supplementary Figure 1. Fusion of lipid vesicles studied with cobalt-calcein liquid content transfer assay. An example of fusion % calibration
More informationCONTRACTING ORGANIZATION: Beth Israel Deaconess Medical Center Boston, MA 02115
AD Award Number: W81XWH-06-1-0756 TITLE: Determination of the Dynamics, Structure, and Orientation of the Transmembrane Segment of ErbB2 in Model Membranes Using Solid-State NMR Spectroscopy PRINCIPAL
More informationThe Cell Membrane & Movement of Materials In & Out of Cells PACKET #11
1 February 26, The Cell Membrane & Movement of Materials In & Out of Cells PACKET #11 Introduction I 2 Biological membranes are phospholipid bilayers with associated proteins. Current data support a fluid
More informationPantothenic Acid. Shang-Jing Pan, Ph.D. Abbott Nutrition Columbus, Ohio, USA
Pantothenic Acid Shang-Jing Pan, Ph.D. Abbott Nutrition Columbus, Ohio, USA Pantothenic acid- history Discovered by Roger J Williams in 1919. Isolated in 1933 by R. J. Williams. Named by Williams, meaning
More informationPhotochemical Applications to the Study of Complexity Phospholipid Bilayer Environments
Virginia Commonwealth University VCU Scholars Compass Theses and Dissertations Graduate School 2006 Photochemical Applications to the Study of Complexity Phospholipid Bilayer Environments Christopher John
More informationMultiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL
Multiple-Choice Questions Answer ALL 20 multiple-choice questions on the Scantron Card in PENCIL For Questions 1-10 choose ONE INCORRECT answer. 1. Which ONE of the following statements concerning the
More informationLecture 15. Membrane Proteins I
Lecture 15 Membrane Proteins I Introduction What are membrane proteins and where do they exist? Proteins consist of three main classes which are classified as globular, fibrous and membrane proteins. A
More informationDefense Technical Information Center Compilation Part Notice
UNCLASSIFIED Defense Technical Information Center Compilation Part Notice ADP014413 TITLE: Colorimetric Biosensor Vesicles for Biotechnological Applications DISTRIBUTION: Approved for public release, distribution
More informationPart I => CARBS and LIPIDS. 1.5 Biological Membranes 1.5a Artificial Membranes 1.5b Lipid Bilayers
Part I => CARBS and LIPIDS 1.5 Biological Membranes 1.5a Artificial Membranes 1.5b Lipid Bilayers Section 1.5a: Artificial Membranes Synopsis 1.5a - In water, apolar molecules such as fats and oils (eg
More informationSupplementary Information
Gureaso et al., Supplementary Information Supplementary Information Membrane-dependent Signal Integration by the Ras ctivator Son of Sevenless Jodi Gureaso, William J. Galush, Sean Boyevisch, Holger Sondermann,
More information