Implication of antigenic variation for vaccine development: the Anaplasma marginale model. Kelly A. Brayton
|
|
- Emmeline Waters
- 5 years ago
- Views:
Transcription
1 Implication of antigenic variation for vaccine development: the Anaplasma marginale model Kelly A. Brayton
2 Order Rickettsiales Family Anaplasmataceae Rickettsiaceae
3 Anaplasma marginale Causes anaplasmosis, an important disease of cattle with no available vaccine Infects the red blood cell Anemia, weight loss, abortion, death Obligate intracellular organism
4 Persistent infection cyclic bacteremia Organisms/ml blood acute persistent Kieser et al., II 1990
5 MSP2 surface coat variants emerge during sequential bacteremic cycles MSP2 Organisms/ml blood emergence control P1 P2 P3 French et al., II 1998, 1999 acute persistent
6 MSP2 opag3 opag2 opag1 msp2 Immunodominant surface protein ~36 kd Central HVR Operon linked expression Multigene family Barbet et al., II 2000 opag1 opag2 opag3
7 All other copies of msp2 are functional pseudogenes opag3 opag2 opag1 msp2 Sequenced St Maries strain 1 ES 7 functional ψ Brayton et al., PNAS 2001, 2005
8 Analysis of ES variants Sampled weekly though acute infection Ticks transmit only 2 MSP2 variants of the South Idaho strain
9 Segmental Gene Conversion SGV2 GGARVEVEVGYERFVIKGGKKSNEDTASVFLLGKELAYDTARGQVDRLATALGKMTKGEAKKWGNAIESATG Ψ A3 GGARVEVEVGYERFVIKGGKKSNEDTASVFLLGKELAYDTARGQVDRLATALGKMTKSEAKKWGNAIESVTG A3-1 GGARVEVEVGYERFVIKGGKKSNEDTASVFLLGKELAYDTARGQVDRLTNALGKMTKSEAKKWGTTVEAAT- A3-2 GGARVEVEVGYERFVIKGGKKSNEDTASVFLLGKELAYDTARGQVDRLTNALGKMTKSEAKKWGTTVEAAT- A3-3 GGARVEVEVGYERFVIKGGKKSNEDTASVFLLGKELAYDTARGQVDRLTNALGKMTKSEAKKWGTTVEAAT- BLOCK 1 SGV2 TTNGEKVSQKVCGNGTGSSG TTQRKISEVFTSDTETAQLSTMENTSTTSGATISTSGMAGN Ψ A3 TTNGQTVSQKVCGKGEGSNGTKKCGTNDGTTATQHKISEVFTEGTDTATL------LSAAGDTINTTGMAGN A3-1 --NGQTVSQKVCGKGEGSNGTKKCGTNDGTTATQHKISEVFTEGTDTATL------LSAAGDTINTTGMAGN A3-2 --NGQTVSQKVCGNGTGSNCGVNSGTTG--STTQHKISEVFTEGTDTATL------LSAAGDTINTTGMAGN A3-3 --NGQTVSQKVCGNGTGSNCGVNSGTTG--STNGNKISAVFSAEGAEAISS---MDTTSNGTTINVSGMATN BLOCK 2 BLOCK 3 Short sequential changes are made Brayton et al., Mol Micro 2002
10 Segmental gene conversion generates complex variants Expression site pseudogenes Ψ1 X Ψ2 ΨP1 simple Ψ9H1 ΨE6/F7 complex
11 Increasing complexity over time 3 Mean number of Segmental changes Mean number of segmental changes Months after tick transmission Months after tick transmission 0: whole ψ 2: two segments from different ψ 1: single segment 3: three segments from different ψ
12 Anchoring model X X X X X X X X Futse et al., Mol Micro 2005
13 Anchoring model Generates many more variants than a sequence identity model 4 5 sequence combinations Limits the requirement for sequence identity to the conserved 5 and 3 domains Predicts that strains would diverge in msp2 pseudogene and thus variant repertoire
14 Paradox: Persistently infected animals cannot clear the existing pathogen--yet are immune to infection with a second genotype (strain superinfection)
15 The basis for the paradox lies in the mechanism of msp2 variation Infected animals generate immune responses against the MSP2 variants initially variants represented by whole ψ and single segmental changes With time, immunity against a broad repertoire of variants develops and is maintained During persistent infection, complex mosaics, not represented in any single ψ, are generated and allow continued evasion of immune clearance New infections (strain superinfection) are cleared as the memory response recognizes the expressed MSP2 variants Does not allow the multiple recombination events needed to generate a unique mosaic capable of evasion
16 The basis for the paradox lies in the mechanism of msp2 variation SIMPLE COMPLEX
17 7285 ; 6DE ; 6DE ; 6DE ; 4B ; 5B DE DE DE DE DE D B B B B B B B B 3261 msp1α genotype PCR ELISA Animal msp1α genotype PCR ELISA Animal Dual infection (6%) Palmer et al., J Clin Micro, 2004
18 EMΦ 5B 5B 6B 6DE St. M Assignment of sequence to each msp2ψlocus G G E6/F7 E6/F7 E6/F7 E6/F7 E6/F G ES ES ES ES ES ES Rodriguez et al., Gene H1
19 EMΦ 5B 5B 6B 6DE St. M Association between dual infection and msp2 repertoire G G E6/F7 E6/F7 E6/F7 E6/F7 E6/F G ES ES ES ES ES ES Rodriguez et al., Gene H1
20 Hypothesis: Superinfection will occur among strains with diverse msp2 pseudogenes
21 EMΦ StM strain Challenge experiment Ho: strains with completely different msp2 pseudogene repertoires will superinfect 46 EMΦ 8 St. M G year E6/F7 G11 1 ES ES St Maries strain EMΦ strain 4 9H1
22 Superinfection results Track superinfection status with specific PCR for msp1α genotype.
23 6DE StM strain Challenge 2 How many different pseudogenes are required for superinfection? 6DE G11 2 G11 2 St. M year E6/F7 E6/F7 G ES ES StM strain 6DE strain 42 9H1
24 Results = Superinfection 6DE St. M St. M 6DE Usage of 6DE specific ψ 9H1 ψ usage
25 Summary Strains with as few as 1 novel pseudogene can superinfect providing the novel pseudogene is used in the ES Establishes the importance of the msp2 allelic repertoire in initial infection Would predict the evolution of an allelic repertoire as diverse as possible
26 Hypothesis: There is selection for growth fitness independent of immune evasion St. Maries PI Naïve calf Direct inoculation Measurement of variant complexity Input (from persistent infection): 2.1 Day 7 post-infection: 0.29 Day 12 post-infection: 0.62 Palmer et al., I&I 2007
27 Msp2 ψ repertoire Under competing evolutionary forces Selection for growth fitness Selection for immune evasion
28 How diverse is msp2?
29 Implications for vaccine strategy Simple variants predominate in early infection Immunize against simple variants protection? Subdominant epitopes
30 Acknowledgements Guy H. Palmer Donald P. Knowles Glen Scoles Bev Hunter Ralph Horn Xiaoya Cheng James E. Futse Christina K. Leverich Jose-Luis Rodriguez Michael J. Dark Pei-Shin Ku
31 Funding NIH NIAID RO1 AI45580 & AI44005 Wellcome Trust GR075800M USDA CSREES
TRANSMISSION DYNAMICS OF GENETICALLY DISTINCT STRAINS OF. Anaplasma marginale FOLLOWING SUPERINFECTION MARIA FERNANDA BANDEIRA DE MELO GALLETTI
TRANSMISSION DYNAMICS OF GENETICALLY DISTINCT STRAINS OF Anaplasma marginale FOLLOWING SUPERINFECTION By MARIA FERNANDA BANDEIRA DE MELO GALLETTI A thesis submitted in partial fulfillment of the requirements
More informationSir Arnold Theiler and the discovery of anaplasmosis: A centennial perspective
Onderstepoort Journal of Veterinary Research, 76:75 79 (2009) Sir Arnold Theiler and the discovery of anaplasmosis: A centennial perspective Department of Veterinary Microbiology and Pathology and School
More informationReceived 24 June 2010/Returned for modification 27 July 2010/Accepted 30 September 2010
CLINICAL AND VACCINE IMMUNOLOGY, Dec. 2010, p. 1881 1890 Vol. 17, No. 12 1556-6811/10/$12.00 doi:10.1128/cvi.00257-10 Copyright 2010, American Society for Microbiology. All Rights Reserved. Anaplasma marginale
More informationTransmission of Anaplasma marginale by Boophilus microplus: Retention of Vector Competence in the Absence of Vector-Pathogen Interaction
JOURNAL OF CLINICAL MICROBIOLOGY, Aug. 2003, p. 3829 3834 Vol. 41, No. 8 0095-1137/03/$08.00 0 DOI: 10.1128/JCM.41.8.3829 3834.2003 Copyright 2003, American Society for Microbiology. All Rights Reserved.
More informationIdentification of vaccine candidate antigens for a Babesia bovis transmission blocking vaccine
Identification of vaccine candidate antigens for a Babesia bovis transmission blocking vaccine Carlos E. Suarez Animal Disease Research Unit ARS-USDA Department of Veterinary Microbiology and Pathology
More informationANTIGEN-SPECIFIC CD4 + T CELLS IN ANAPLASMA MARGINALE INFECTION OF CALVES SUSHAN HAN
ANTIGEN-SPECIFIC CD4 + T CELLS IN ANAPLASMA MARGINALE INFECTION OF CALVES By SUSHAN HAN A dissertation submitted in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY WASHINGTON
More informationRapid and Long-Term Disappearance of CD4 + T Lymphocyte Responses Specific for. Protein-2 (MSP2) in MSP2 Vaccinates
This information is current as of February 21, 2013. References Subscriptions Permissions Email Alerts Rapid and Long-Term Disappearance of CD4 + T Lymphocyte Responses Specific for Anaplasma Marginale
More informationCattle vaccination studies using novel anti-cattle tick antigens developed during Beef CRC research
final report Project code: Prepared by: B.AHE.0212 Alicia Tabor, Manuel Rodriguez Valle, Michael McGowan (UQ), David Mayer, Elizabeth Fowler, Catherin Minchin and Bing Zhang (QDAF) The University of Queensland;
More informationWendy C. Brown, 1 * Travis C. McGuire, 1 Waithaka Mwangi, 1 Kimberly A. Kegerreis, 1 Henriette Macmillan, 1 Harris A. Lewin, 2 and Guy H.
INFECTION AND IMMUNITY, Oct. 2002, p. 5521 5532 Vol. 70, No. 10 0019-9567/02/$04.00 0 DOI: 10.1128/IAI.70.10.5521 5532.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Major
More informationTitle: Revision of the National Surveillance Case Definition for Ehrlichiosis (Ehrlichiosis/Anaplasmosis)
07-ID-03 Committee: Infectious Diseases Title: Revision of the National Surveillance Case Definition for Ehrlichiosis (Ehrlichiosis/Anaplasmosis) Statement of the Problem: The purpose of the recommended
More informationUPDATE ON CANINE AND FELINE BLOOD DONOR SCREENING FOR BLOOD BORNE PATHOGENS Wardrop et al, JVIM 2016 Consensus statement
UPDATE ON CANINE AND FELINE BLOOD DONOR SCREENING FOR BLOOD BORNE PATHOGENS Wardrop et al, JVIM 2016 Consensus statement BACKGROUND: 3 types of pathogens: o Vector-borne (testing recommended) o Non-vector-borne
More informationDepartment of Agriculture, Fisheries and Forestry, Queensland. Improved protection of cattle against anaplasmosis in tick-infested areas of Australia
final report Project code: B.AHE.0060 Prepared by: Peter Rolls Date published: August 2013 Department of Agriculture, Fisheries and Forestry, Queensland ISBN: 9781925045376 PUBLISHED BY Meat & Livestock
More informationObjective 3. Develop new and improved diagnostic tools, vaccines, and novel management approaches
Objective 3. Develop new and improved diagnostic tools, vaccines, and novel management approaches Development of novel nanoparticle-base vaccines for infectious bronchitis PI, Mazhar I. Khan; CoPI, Peter
More informationStudying Repeated Immunization in an Animal Model. Kanta Subbarao Laboratory of Infectious Diseases, NIAID
Studying Repeated Immunization in an Animal Model Kanta Subbarao Laboratory of Infectious Diseases, NIAID Animal models in Influenza Research Commonly used Mice Ferrets Guinea pigs Non human primates Less
More informationSeroprevalence of bovine anaplasmosis caused by Anaplasma marginale in Malaysia.
Seroprevalence of bovine anaplasmosis caused by Anaplasma marginale in Malaysia. 1 Samantha Pong, 2 Nik Ahmad Irwan Izzauddin Nik Him 1 School of Biological Sciences, Universiti Sains Malaysia Penang 11800,
More informationPh.D. Thesis: Protective immune response in P.falciparum malaria 2011 CHAPTER I: Introduction. S.D. Lourembam 16
CHAPTER I: Introduction S.D. Lourembam 16 1. INTRODUCTION Malaria remains a major global health problem with 300 to 500 million clinical infections and more than a million deaths reported each year. In
More informationOn an individual level. Time since infection. NEJM, April HIV-1 evolution in response to immune selection pressures
HIV-1 evolution in response to immune selection pressures BISC 441 guest lecture Zabrina Brumme, Ph.D. Assistant Professor, Faculty of Health Sciences Simon Fraser University http://www3.niaid.nih.gov/topics/hivaids/understanding/biology/structure.htm
More informationNanoparticulate Vaccine Design: The VesiVax System
Nanoparticulate Vaccine Design: The VesiVax System Gary Fujii, Ph.D. President and CEO Molecular Express, Inc. May 16, 2006 Orlando, Florida Influenza Each year up to 20% of the world's population contracts
More informationMajor Histocompatibility Complex (MHC) and T Cell Receptors
Major Histocompatibility Complex (MHC) and T Cell Receptors Historical Background Genes in the MHC were first identified as being important genes in rejection of transplanted tissues Genes within the MHC
More informationINFECTION AND IMMUNITY, Nov. 1998, p Vol. 66, No. 11. Copyright 1998, American Society for Microbiology. All Rights Reserved.
INFECTION AND IMMUNITY, Nov. 1998, p. 5406 5413 Vol. 66, No. 11 0019-9567/98/$04.00 0 Copyright 1998, American Society for Microbiology. All Rights Reserved. CD4 T-Lymphocyte and Immunoglobulin G2 Responses
More informationPotential cross reactions between HIV 1 specific T cells and the microbiome. Andrew McMichael Suzanne Campion
Potential cross reactions between HIV 1 specific T cells and the microbiome Andrew McMichael Suzanne Campion Role of the Microbiome? T cell (and B cell) immune responses to HIV and Vaccines are influenced
More informationComparative Phylogenetic Analysis of E6 and E7 Proteins of Different 42 Strains of HPV Sangeeta Daf*, Lingaraja Jena, Satish Kumar
ORIGINAL ARTICLE Comparative Phylogenetic Analysis of E6 and E7 Proteins of Different 42 Strains of HPV Sangeeta Daf*, Lingaraja Jena, Satish Kumar Abstract Simultaneous phylogenetic analysis of E6 and
More informationChapter 6- An Introduction to Viruses*
Chapter 6- An Introduction to Viruses* *Lecture notes are to be used as a study guide only and do not represent the comprehensive information you will need to know for the exams. 6.1 Overview of Viruses
More informationThe success story of BVD virus
The success story of BVD virus BVD MD PI BVDV BVDV-1 BVDV-2 cp ncp Bovine Viral Diarrhea Mucosal Disease Persistently Infected Bovine Viral Diarrhea Virus Bovine Viral Diarrhea Virus Genotype 1 Bovine
More informationUltrastructural Studies on Plasmodium vivax
Characterization of Human Malaria Parasites Ultrastructural Studies on Plasmodium vivax For the first time a detailed ultrastructural study was carried out on P. vivax. Fine structural analysis of growth
More informationAmerican Association of Zoo Veterinarians Infectious Disease Committee Manual 2013 ANAPLASMOSIS
Two groups in Anaplasmataceae: Group 1- infects red blood cells; infects other blood cells Animal Group(s) Affected Group 1 Ruminants Wide range of mammals (including humans) Transmission Group 1+2 - Biological
More informationInvolvement of roe deer as source of Anaplasma phagocytophilum infection for Ixodes ricinus in a heterogeneous landscape
Involvement of roe deer as source of Anaplasma phagocytophilum infection for Ixodes ricinus in a heterogeneous landscape Extract of the PhD thesis of Amélie Chastagner A m é l i e C h a s tagner 1*, A
More informationPatterns of hemagglutinin evolution and the epidemiology of influenza
2 8 US Annual Mortality Rate All causes Infectious Disease Patterns of hemagglutinin evolution and the epidemiology of influenza DIMACS Working Group on Genetics and Evolution of Pathogens, 25 Nov 3 Deaths
More informationMin Levine, Ph. D. Influenza Division US Centers for Disease Control and Prevention. June 18, 2015 NIBSC
Workshop on Immunoassay Standardization for Universal Flu Vaccines Min Levine, Ph. D. Influenza Division US Centers for Disease Control and Prevention June 18, 2015 NIBSC 1 Multiple Immune Mechanisms Contribute
More informationEvolution of influenza
Evolution of influenza Today: 1. Global health impact of flu - why should we care? 2. - what are the components of the virus and how do they change? 3. Where does influenza come from? - are there animal
More informationReceived 21 January 2005/Returned for modification 8 March 2005/Accepted 6 May 2005
INFECTION AND IMMUNITY, Sept. 2005, p. 5388 5394 Vol. 73, No. 9 0019-9567/05/$08.00 0 doi:10.1128/iai.73.9.5388 5394.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Sequence
More informationaward M. tuberculosis T cell epitope analysis reveals paucity of antigenic variation and identifies rare variable TB antigens Mireia Coscolla
award M. tuberculosis T cell epitope analysis reveals paucity of antigenic variation and identifies rare variable TB antigens Mireia Coscolla Lausanne 16.06.2016 TB today TB is the 2nd bigest killer disease.6
More informationBroadly protective influenza vaccines for pandemic preparedness. Suresh Mittal Department of Comparative Pathobiology Purdue University
Broadly protective influenza vaccines for pandemic preparedness Suresh Mittal Department of Comparative Pathobiology Purdue University Influenza A Virus Orthomyxovirus Consist of s/s (-) sense RNA 8 segments
More informationLaboratory tools for monitoring and understanding IBDV infection and vaccination
Laboratory tools for monitoring and understanding IBDV infection and vaccination J.J. (Sjaak) de Wit, DVM, PhD, dipl ECPVS GD Deventer, The Netherlands Gumboro-virus (IBDV) Avibirna-virus: segments of
More informationFoot and mouth disease situation and control strategies in the People s Republic of China the current situation
Foot and mouth disease situation and control strategies in the People s Republic of China the current situation Lu Zengjun (Associate researcher) Shang Youjun (Associate researcher) National Foot-and-Mouth
More informationAnd Current Situation
African Swine Fever Research And Current Situation Luis L. Rodriguez Research Leader Foreign Animal Disease Research Unit Agricultural Research Service, Plum Island Animal Disease Center African Swine
More informationNoroviruses. Duncan Steele Bill & Melinda Gates Foundation. Acknowledgements: Ben Lopman and Umesh Parashar, CDC Megan Carey and Julia Bosch, BMGF
Noroviruses Duncan Steele Bill & Melinda Gates Foundation Acknowledgements: Ben Lopman and Umesh Parashar, CDC Megan Carey and Julia Bosch, BMGF 1 Global norovirus burden Globally, norovirus is associated
More informationThe Major Histocompatibility Complex of Genes
The Major Histocompatibility Complex of Genes Topic 4 The Major Histocompatibility Complex Outline of Lectures The immunological reasons for transplant rejection How the MHC was discovered using inbred
More informationCharacterizing intra-host influenza virus populations to predict emergence
Characterizing intra-host influenza virus populations to predict emergence June 12, 2012 Forum on Microbial Threats Washington, DC Elodie Ghedin Center for Vaccine Research Dept. Computational & Systems
More informationhttp://www.ibs.upm.edu.my Challenges in controlling viral diseases of poultry Abdul Rahman Omar Institute of Bioscience Faculty of Veterinary Medicine Universiti Putra Malaysia aro@upm.edu.my Outline of
More informationChronic HIV-1 Infection Frequently Fails to Protect against Superinfection
Chronic HIV-1 Infection Frequently Fails to Protect against Superinfection Anne Piantadosi 1,2[, Bhavna Chohan 1,2[, Vrasha Chohan 3, R. Scott McClelland 3,4,5, Julie Overbaugh 1,2* 1 Division of Human
More informationQ Fever What men and women on the land need to know
Q Fever What men and women on the land need to know Dr. Stephen Graves Director, Australian Rickettsial Reference Laboratory Director, Division of Microbiology, Pathology North (Hunter) NSW Health Pathology,
More informationMany important pathogens, such as Neisseria meningitidis
The effects of host contact network structure on pathogen diversity and strain structure Caroline O F. Buckee*, Katia Koelle, Matthew J. Mustard, and Sunetra Gupta* *Department of Zoology, University of
More informationInfluence of Weaning Vaccine Selection on Pre- Breeding Vaccine Options. Paul H. Walz, DVM, PhD Auburn University College of Veterinary Medicine
Influence of Weaning Vaccine Selection on Pre- Breeding Vaccine Options Paul H. Walz, DVM, PhD Auburn University College of Veterinary Medicine So how do we develop a vaccination program? Develop protocol
More informationNOTES: Exceptions to Mendelian Genetics!
NOTES: 11.3 Exceptions to Mendelian Genetics! Beyond Dominant and Recessive Alleles Some alleles are neither dominant nor recessive, and many traits are controlled by multiple alleles OR multiple genes.
More informationAnaplasmosis In Beef Cattle
B-5098 Anaplasmosis In Beef Cattle Anaplasmosis is an infectious disease of cattle that causes destruction of red blood cells. The disease is caused by a minute parasite, Anaplasma marginale, found in
More informationBreadth of the CD4+ T cell response to Anaplasma marginale VirB9-1, VirB9-2 and VirB10 and MHC class II DR and DQ restriction elements
Edinburgh Research Explorer Breadth of the CD4+ T cell response to Anaplasma marginale VirB9-1, VirB9-2 and VirB10 and MHC class II DR and DQ restriction elements Citation for published version: Morse,
More informationANTIGENIC VARIATION & IMMUNE EVASION
ANTIGENIC VARIATION & IMMUNE EVASION Fondation Mérieux Conference Center Les Pensières Veyrier-du-Lac - France March 30 - April 1, 2009 Steering Committee: Simona BARZU Alister CRAIG Catherine DUTEL Bernard
More informationBiotechnology-Based Vaccines. Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel:
Biotechnology-Based Vaccines Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1.
More informationGumboro Disease: where are we with IBDV epidemiology. J.J. (Sjaak) de Wit, DVM, PhD, dipl ECPVS GD Deventer, The Netherlands
Gumboro Disease: where are we with IBDV epidemiology J.J. (Sjaak) de Wit, DVM, PhD, dipl ECPVS GD Deventer, The Netherlands Gumboro-virus (IBDV) Avibirna-virus: 2 segments of dsrna Non enveloped virus
More informationMina John Institute for Immunology and Infectious Diseases Royal Perth Hospital & Murdoch University Perth, Australia
Mina John Institute for Immunology and Infectious Diseases Royal Perth Hospital & Murdoch University Perth, Australia AIDSvaccine conference, 14 th September 2011 IMGT HLA database July 2011 >5000 class
More informationPertussis: An Emerging Infection. Holly K. Ehrke. Ferris State University
Running head: PERTUSSIS AN EMERGING INFECTION 1 Pertussis: An Emerging Infection Holly K. Ehrke Ferris State University PERTUSSIS AN EMERGING INFECTION 2 Abstract Pertussis is a highly contagious disease
More informationThe early pathogenesis of FMD and the implications for control measures
The early pathogenesis of FMD and the implications for control measures Luis L. Rodriguez and Jonathan Arzt Foreign Animal Disease Research Unit, USDA-ARS Plum Island Animal Disease Center, New York, USA.
More informationE E Hepatitis E SARS 29, Lancet. E A B Enterically-Transmitted Non-A, Hepatitis E. Virus HEV nm. 1.35g/cm s ALT AST HEV HEV
7850 2004 Hepatitis E Tian-Cheng LI Naokazu TAKEDA Tatsuo MIYAMURA SARS 8 Lancet E E E Hepatitis E VirusHEV E E HEV HEV E 1955 29,000 E E A A B Enterically-Transmitted Non-A, Non-B Hepatitis 1983 Balayan
More informationEvidence That the Variable Regions of the Central Domain of VlsE Are Antigenic during Infection with Lyme Disease Spirochetes
INFECTION AND IMMUNITY, Aug. 2002, p. 4196 4203 Vol. 70, No. 8 0019-9567/02/$04.00 0 DOI: 10.1128/IAI.70.8.4196 4203.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Evidence
More informationAvian Influenza: Armageddon or Hype? Bryan E. Bledsoe, DO, FACEP The George Washington University Medical Center
Avian Influenza: Armageddon or Hype? Bryan E. Bledsoe, DO, FACEP The George Washington University Medical Center Definitions: Epidemic The occurrence of cases of an illness in a community or region which
More informationAnaplasma. Agent Searching a Disease
Anaplasma Agent Searching a Disease Dag Nyman Labquality 2017 Disclosures Partner, clinical and research director Biomedical Laboratory Bimelix Contact - Prof. Dag Nyman MD PhD Research
More informationGOVX-B11: A Clade B HIV Vaccine for the Developed World
GeoVax Labs, Inc. 19 Lake Park Drive Suite 3 Atlanta, GA 3 (678) 384-72 GOVX-B11: A Clade B HIV Vaccine for the Developed World Executive summary: GOVX-B11 is a Clade B HIV vaccine targeted for use in
More informationC E E Z A D. Rational Development of Influenza Vaccines: NDV-based influenza vaccines for poultry and livestock
C E E Z A D Center of Excellence for Emerging and Zoonotic Animal Diseases A Department of Homeland Security Center of Excellence Rational Development of Influenza Vaccines: NDV-based influenza vaccines
More informationInvestigation of the genetic differences between bovine herpesvirus type 1 variants and vaccine strains
Investigation of the genetic differences between bovine herpesvirus type 1 variants and vaccine strains Name: Claire Ostertag-Hill Mentor: Dr. Ling Jin Bovine herpesvirus Bovine herpesvirus-1 (BHV-1) Pathogen
More informationHuman Genome Complexity, Viruses & Genetic Variability
Human Genome Complexity, Viruses & Genetic Variability (Learning Objectives) Learn the types of DNA sequences present in the Human Genome other than genes coding for functional proteins. Review what you
More informationSURVEILLANCE TECHNICAL
CHAPTER 5 SURVEILLANCE TECHNICAL ASPECTS 55 Protect - detect - protect Polio eradication strategies can be summed up as protect and detect protect children against polio by vaccinating them, and detect
More informationAntimicrobial therapy of persistent Anaplasma marginale infections
Retrospective Theses and Dissertations Iowa State University Capstones, Theses and Dissertations 2005 Antimicrobial therapy of persistent Anaplasma marginale infections Johann Francois Coetzee Iowa State
More informationAutomated Quantification and Description of the Evolutionary Patterns of Influenza Viruses in U.S. Swine
Automated Quantification and Description of the Evolutionary Patterns of Influenza Viruses in U.S. Swine Spatial dissemination of a novel H3 influenza A Swine influenza A epidemic peaks Influenza A virus
More informationChemotherapeutic Efficacy of Oxytetracycline, Enrofloxacin and Imidocarb for the Elimination of Persistent Anaplasma marginale
Pakistan J. Zool., vol. 44(2), pp. 449-456, 2012. Chemotherapeutic Efficacy of Oxytetracycline, Enrofloxacin and Imidocarb for the Elimination of Persistent Anaplasma marginale Infection in Naturally Infected
More informationHEPATITIS C VIRUS: NEW DIAGNOSTIC TOOLS By (hepatitis)
HEPATITIS C VIRUS: NEW DIAGNOSTIC TOOLS By (hepatitis) If looking for the book by (hepatitis) HEPATITIS C VIRUS: NEW DIAGNOSTIC TOOLS in pdf form, then you've come to the right website. We present full
More informationWhat is influenza virus? 13,000 base RNA genome: 1/ the size of the human genome
What is influenza virus? 13,000 base RNA genome: 1/246153 the size of the human genome CDC Principles of Virology, 4e Neumann et al. Nature. 2009. Influenza virus is one of the most deadly viral pathogens
More informationEMERGING ISSUES IN THE HUMORAL IMMUNE RESPONSE TO HIV. (Summary of the recommendations from an Enterprise Working Group)
AIDS Vaccine 07, Seattle, August 20-23, 2007 EMERGING ISSUES IN THE HUMORAL IMMUNE RESPONSE TO HIV (Summary of the recommendations from an Enterprise Working Group) The Working Group Reston, Virginia,
More informationExistence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan
International Congress Series 1263 (2004) 749 753 Existence of reassortant A (H1N2) swine influenza viruses in Saitama Prefecture, Japan Shin ichi Shimada a, *, Takayasu Ohtsuka b, Masayuki Tanaka b, Munehito
More informationRapid perforin upregulation directly ex vivo by CD8 + T cells is a defining characteristic of HIV elite controllers
Rapid perforin upregulation directly ex vivo by CD8 + T cells is a defining characteristic of HIV elite controllers Adam R. Hersperger Department of Microbiology University of Pennsylvania Evidence for
More informationTransmissibility, virulence and fitness of resistant strains of M. tuberculosis. CHIANG Chen-Yuan MD, MPH, DrPhilos
Transmissibility, virulence and fitness of resistant strains of M. tuberculosis CHIANG Chen-Yuan MD, MPH, DrPhilos Transmissibility, Virulence and Fitness of resistant strains of M. tuberculosis For infectious
More informationAn innovative multi-dimensional NGS approach to understanding the tumor microenvironment and evolution
An innovative multi-dimensional NGS approach to understanding the tumor microenvironment and evolution James H. Godsey, Ph.D. Vice President, Research & Development Clinical Sequencing Division (CSD) Life
More informationPersistence mechanisms in tick-borne diseases
Onderstepoort Journal of Veterinary Research, 76:53 58 (2009) A.F. BARBET Department of Infectious Diseases & Pathology, College of Veterinary Medicine University of Florida, Gainesville, Florida, USA
More informationVaccine 26S (2008) C42 C52. Contents lists available at ScienceDirect. Vaccine. journal homepage:
Vaccine 26S (2008) C42 C52 Contents lists available at ScienceDirect Vaccine journal homepage: www.elsevier.com/locate/vaccine Virulence evolution in response to vaccination: The case of malaria M.J. Mackinnon
More information2000 and Beyond: Confronting the Microbe Menace 1999 Holiday Lectures on Science Chapter List
2000 and Beyond: Confronting the Microbe Menace 1999 Holiday Lectures on Science Chapter List Lecture One Microbe Hunters: Tracking Infectious Agents Donald E. Ganem, M.D. 1. Start of Lecture One 2. Introduction
More informationViruses. Objectives At the end of this sub section students should be able to:
Name: 3.5 Responses to Stimuli Objectives At the end of this sub section students should be able to: 3.5.4 Viruses 1. Explain the problem of defining what a virus is - living or non-living? 2. show you
More informationLecture 19 Evolution and human health
Lecture 19 Evolution and human health The evolution of flu viruses The evolution of flu viruses Google Flu Trends data US data Check out: http://www.google.org/flutrends/ The evolution of flu viruses the
More informationVirus Genetic Diversity
Virus Genetic Diversity Jin-Ching Lee, Ph.D. 李 jclee@kmu.edu.tw http://jclee.dlearn.kmu.edu.t jclee.dlearn.kmu.edu.tw TEL: 2369 Office: N1024 Faculty of Biotechnology Kaohsiung Medical University Outline
More informationThe Adaptive Immune Response. B-cells
The Adaptive Immune Response B-cells The innate immune system provides immediate protection. The adaptive response takes time to develop and is antigen specific. Activation of B and T lymphocytes Naive
More informationLocke Karriker, 2008 Iowa Pork Regional Conferences 1
Case Studies of Swine Viral Diseases February 18-19, 5-7 008 Ainsworth, Oelwein, Sioux Center, Carroll, Dows IA Dr. Locke Karriker, DVM, MS, DACVPM Veterinary Diagnostic and Production Animal Medicine
More information4/26/12. Recap of chapter 3! Antigen recognition by B cells! And by T
ecap of chapter What s the difference between the innate and adaptive immune system? n which way are the epitopes of B and cells different? What does that imply for their role in the immune response? arland
More informationHolarctic distribution of Lyme disease
Babesia and Ehrlichia epidemiology: key points Holarctic distribution of Lyme disease 1. Always test for babesia and ehrlichia if Lyme disease is suspected 2. Endemic areas perhaps too broad a term; vector-borne
More informationThe Economic Impact of BVD in a Herd. Slides available on website mid February
The Economic Impact of BVD in a Herd Slides available on website mid February www.shropshirefarmvets.com What is BVD? How does BVD cause disease? The Economic Impact What is the cost of BVD associated
More informationINTERfering and Co-Evolving Prevention and Therapy (INTERCEPT) Proposers Day
INTERfering and Co-Evolving Prevention and Therapy (INTERCEPT) Proposers Day Dr. Jim Gimlett, Program Manager DARPA Biological Technologies Office (BTO) April 28, 2016 Arlington, VA INTERCEPT Agenda INTERCEPT
More informationCD4 + T-cell-inducing HIV vaccines may have an impact on viral control
CD4 + T-cell-inducing HIV vaccines may have an impact on viral control Clues from cytokines produced by CD4 + T-cells from HIVinfected patients and vaccinated seronegative volunteers Eva Van Braeckel 1,
More informationExtensions of the Laws of
Extensions of the Laws of Inheritance Bởi: OpenStaxCollege Mendel studied traits with only one mode of inheritance in pea plants. The inheritance of the traits he studied all followed the relatively simple
More informationViral Genetics. BIT 220 Chapter 16
Viral Genetics BIT 220 Chapter 16 Details of the Virus Classified According to a. DNA or RNA b. Enveloped or Non-Enveloped c. Single-stranded or double-stranded Viruses contain only a few genes Reverse
More informationRajesh Kannangai Phone: ; Fax: ; *Corresponding author
Amino acid sequence divergence of Tat protein (exon1) of subtype B and C HIV-1 strains: Does it have implications for vaccine development? Abraham Joseph Kandathil 1, Rajesh Kannangai 1, *, Oriapadickal
More informationDengue: The next vaccine preventable disease? Prof John McBride James Cook University
Dengue: The next vaccine preventable disease? Prof John McBride James Cook University Dengue viruses A flavivirus ~11kb genome, ~50nm diameter, lipid envelope. Gene order 5 C-prM-E-NS1 Four serotypes (1-4)
More informationLecture 11. Immunology and disease: parasite antigenic diversity
Lecture 11 Immunology and disease: parasite antigenic diversity RNAi interference video and tutorial (you are responsible for this material, so check it out.) http://www.pbs.org/wgbh/nova/sciencenow/3210/02.html
More informationGlobal Challenges of Pandemic and Avian Influenza. 19 December 2006 Keiji Fukuda Global influenza Programme
Global Challenges of Pandemic and Avian Influenza 19 December 2006 Keiji Fukuda Global influenza Programme Summary of Current H5N1 Situation 1997 First known outbreak infecting humans 18 people hospitalized
More informationModeling the Antigenic Evolution of Influenza Viruses from Sequences
Modeling the Antigenic Evolution of Influenza Viruses from Sequences Taijiao Jiang Center of Systems Medicine, Chinese Academy of Medical Sciences Suzhou Institute of Systems Medicine October 8-10, 2015.
More information5. Over the last ten years, the proportion of HIV-infected persons who are women has: a. Increased b. Decreased c. Remained about the same 1
Epidemiology 227 April 24, 2009 MID-TERM EXAMINATION Select the best answer for the multiple choice questions. There are 60 questions and 9 pages on the examination. Each question will count one point.
More informationMalaria parasite vaccine development Strategies & Targets
Malaria parasite vaccine development Strategies & Targets Tulane University Ahmed Aly Most malaria disease deaths are among children and pregnant women A child or a pregnant woman dies of malaria nearly
More informationEarly History of Vaccination Vaccines
6/23/13 Early History of Vaccination Vaccines The tradition of vaccination may have originated in India in AD 1000 Pioneered India and China in the 17th Powdered scabs from people infected with smallpox
More informationActive and Passive Immunization for Avian Influenza Virus Infections
NIAID Active and Passive Immunization for Avian Influenza Virus Infections Kanta Subbarao, MD, MPH Laboratory of Infectious Diseases NIAID, NIH Immortalizing H5 HA-Specific Memory B Cells Collection of
More informationModels of HIV during antiretroviral treatment
Models of HIV during antiretroviral treatment Christina M.R. Kitchen 1, Satish Pillai 2, Daniel Kuritzkes 3, Jin Ling 3, Rebecca Hoh 2, Marc Suchard 1, Steven Deeks 2 1 UCLA, 2 UCSF, 3 Brigham & Womes
More informationQ FEVER Australian and global perspectives including the recent Netherlands outbreak
Q FEVER Australian and global perspectives including the recent Netherlands outbreak Coxiella burnetii, the causative bacterium for Q Fever is ubiquitous. Thought to be present in every land mass with
More information