2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy
|
|
- Darlene Garrison
- 5 years ago
- Views:
Transcription
1 2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications DPP-4 Inhibition and Diabetic Nephropathy Daisuke Koya Department of Diabetology & Endocrinology Kanazawa Medical University
2 Kidney fibrosis in diabetes How can we combat kidney fibrosis in diabetes?
3 DPP-4 levels are elevated in diabetic kidney DPP-4 on endothelial cells Kanasaki et al Diabetes 2014
4 Endothelial-to-Mesenchymal transition (EndMT) EndMT is appeared to be an important orign of myofibroblast or activated fibroblast. Kanasaki K, et al. Frontiers in Endocrinology 2013;4:7 Srivastava SP, et al. Biomed Res Int. 2013
5 Dipeptidyl Peptidase-4 (DPP-4) DPP-4 is a cell surface aminopeptidase which was originally characterized as a T-cell differentiation antigen (CD26). It is distributed throughout the body and cleaves numerous substrates other than incretin hormones. High expression of DPP-4 is associated with fibrogenic potential of fibroblasts. In diabetic mice, DPP-4 overexpression in endothelial cell is associated with EndMT and kidney fibrosis. Fleischer B.. Immunol Today 1994 Drucker, D. J. Exp. Opin. Investig. Drugs 2003 Rinkevich, Science, 2015 Keizo kanasaki. Diabetes, 2014
6 Inhibition of DPP-4 by linagliptin in diabetic kidney is associated with the amelioration of kidney fibrosis. Control DM DM+linagliptin Urine albumin
7 Linagliptin-suppressed kidney fibrosis in diabetic CD-1 mice was associated with EndMT inhibition Control DM DM+linagliptin Kanasaki et al Diabetes 2014
8 Fibrogenic cross-talk in diabetic kidney Summary of Kanasaki Diabetes 2014 Increased DPP-4 activity Diabetes High TGF-b activity microrna29 suppression DPP-4 inhibition
9 Linagliptin inhibited TGF-b2-induced smad3 phosphorylation in HMVEC How?
10 What is the relevance of DPP-4 on TGF-b/smad signal transduction?
11 Integrin β1 Integrins are cell surface receptors that play key roles in cell migration and adhesion. β1-integrin is the most critical one that can pair with different α- subunits, it is reported that it has a fibrotic potential, and high β1-integrin level is associated with seriously kidney fibrosis. Chen, et al. JCI 2014 Hynes, R. O. Cell 2002 Hind et al. Frontiers in Bioscience 2009
12 *The loss of DPP-4 surface expression has shown to be associated with decreased phosphorylation of integrin β1 at the S785 residue, which has a key role in cellular adhesion to ECM. *CD26 potentiates mesothelioma tumor cell invasion through its interaction with αvβ1 integrin. Tsutomu Sato, et al. Proc Amer Assoc Cancer Res, 2005 Toshihiro Okamoto, et al, PLoS One Hypothesis: DPP-4-integrin β1 interaction is a therapeutic target for kidney fibrosis in diabetes via the normalization of endothelial cell homeostasis and inhibition of EndMT.
13 Aim: To identify the interaction of integrin β1 and DPP-4 in diabetic kidney and EndMT Specific Aim 1: Intervention with DPP-4 inhibitor, linagliptin on STZ-induced diabetes-associated with suppression of integrin β1 and EndMT. Specific Aim 2: To analyze the interaction between DPP-4 and integrin β1. Specific Aim 3: To identify the mechanism of DPP- 4 /integrin β1 interaction on endothelial homeostasis
14 DPP-4/integrin β1/ DAPI P-integrin β1/dpp4 /DAPI P-integrin β1/cd31 /DAPI Specific Aim 1: The association of DPP-4 and integrin β1 expression in kidney of STZ- induced diabetic CD1 mice Control DM DM+linagliptin Control DM DM+linagliptin Control DM DM+linagliptin
15 Short summary 1 The protein expression levels of integrin β1, phosphorylated-integrin β1, and DPP- 4 were all increased in endothelial cells in STZ-induced diabetic kidneys; all of these inductions were suppressed by linagliptin treatment.
16 Specific Aim 2: To analyze the interaction between DPP-4 and integrin β1 TGF-β2 Control sirna TGF-β2 Control sirna Integrin β1 sirna DPP-4 sirna DPP-4 110kDa CD31 130kDa Integrin β1 P-integrin β1 GAPDH VWF αsma SM22α GAPDH αsma 88kDa DPP-4 88kDa Integrin β1 37kDa P-integrin β1 250kDa GAPDH 42kDa 23kDa 37kDa 42kDa 110kDa 88kDa 88kDa 37kDa Integrin β1 or DPP-4 deletion in endothelial cell is associated with inhibition of EndMT in cultured endothelial cells
17 Duolink (DPP-4-integrin β1)/dapi Duolink (TGF-βR1-TGF-βR2)/DAPI Interaction between DPP-4 and integrin β1 regulates TGF-β receptors heterodimer formation Control Control Control sirna +TGF-β2 TGF-β2 Integrin β1 sirna Integrin β1 sirna +TGF-β2 TGF-β2 +linagliptin DPP-4 sirna DPP-4 sirna +TGF-β2 Rik Derynck, nature TGF-β activation is dependent on the TGF-βR1/2 heterodimer formation We also perform the immunoprecipitation for DPP-4 and integrin β1 interaction and get the same result.
18 Integrin β1 activation antibody induced EndMT and DPP-4 expression ;also induce the interaction of DPP-4 and integrin β1 and TGFβ receptors heterodimer formation Control IgG Integrin β1 activation antibody CD31 αsma 130kDa 42kDa SM22α 23kDa β-actin 42kDa DPP-4 P-integrin β1 Integrin β1 110kDa 88kDa 88kDa β-actin 42kDa
19 Short summary 2 1. Deletion of integrin β1 was associated with suppression of DPP-4. By contrast, the activation of integrin β1 by a specific antibody induced EndMT associated with DPP-4 induction. 2. The interaction of DPP-4 and integrin β1 is associated with the induction of EndMT and TGFβ signaling by enhancing the TGF-βRs heterodimer formation.
20 Specific Aim 3: To identify the mechanism of DPP-4 /integrin β1 interaction on endothelial homeostasis Diverse VEGF receptors and their role on EndMT Integrin b1 EndMT VEGF-R1/ Flt-1 VEGF-R2/ KDR/Flk-1 sflt-1 PlGF VEGF-A VEGF-R3/ Flt-4 VEGF-B VEGF-C Neuropilin-1 Neuropilin-2 VEGF-D
21 VEGF-R2/CD31/ DAPI VEGF-R1/CD31/ DAPI DPP-4 regulate VEGFRs expression in vivo and in vitro In vivo In vitro Control DNA A. Control DPP-4 DNA VEGF DPP-4 110kDa VEGF-R1 180kDa Control DM DM+linagliptin VEGF-R2 180kDa D. P-ERK 75kDa β-actin 42kDa DM Control DM DM+linagliptin
22 Short summary 3 The DPP-4 is key factor to inhibit VEGFinduced survival signaling in endothelial cells.
23 DPP-4-integrin β1 interaction and EndMT ECM TGFβ2 activate α β1 α β1 DPP4 DPP4 T G F β R 1 T G F β R 2 VEGFR2 VEGFR1 VEGFR1 VEGFR2 TGF-βRs heterodimer formation EndMT and fibrosis
24 Conclusion The interaction between DPP-4 and integrin β1 is a therapeutic target for diabetic microvessel complications including diabetic nephropathy.
## : Co-correspondence. Address correspondence to:
Page 1 of 40 Linagliptin-mediated DPP-4 inhibition ameliorates kidney fibrosis in streptozotocin-induced diabetic mice by inhibiting endothelial-to-mesenchymal transition in a therapeutic regimen Keizo
More informationAbnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S100A9
Abnormally differentiating keratinocytes in the epidermis of systemic sclerosis patients show enhanced secretion of CCN2 and S1A9 Joanna Nikitorowicz-Buniak UCL Division of Medicine Systemic sclerosis
More informationIntroduction: 年 Fas signal-mediated apoptosis. PI3K/Akt
Fas-ligand (CD95-L; Fas-L) Fas (CD95) Fas (apoptosis) 年 了 不 度 Fas Fas-L 力 不 Fas/Fas-L T IL-10Fas/Fas-L 不 年 Fas signal-mediated apoptosis 度降 不 不 力 U-118, HeLa, A549, Huh-7 MCF-7, HepG2. PI3K/Akt FasPI3K/Akt
More informationRath, N., and Olson, M. (2016) Regulation of pancreatic cancer aggressiveness by stromal stiffening. Nature Medicine, 22(5), pp. 462-463. There may be differences between this version and the published
More informationRole of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies. Traditional Hypothesis Stress
3/1/212 Role of Inflammatory and Progenitor Cells in Pulmonary Vascular Remodeling: Potential Role for Targeted Therapies K.R. Stenmark University of Colorado Denver, CO 845 Prominent Fibroproliferative
More informationDipeptidyl peptidase 4 inhibitor linagliptin can decrease the dosage of erythropoiesisstimulating
Aono and Sato Renal Replacement Therapy (2016) 2:44 DOI 10.1186/s41100-016-0058-7 RESEARCH Open Access Dipeptidyl peptidase 4 inhibitor linagliptin can decrease the dosage of erythropoiesisstimulating
More informationThe 11 th Japan-Korea Diabetic Nephropathy Seminar
FINAL REPORT For Japan-Korea Joint Seminar AREA 1. Humanities and Social Sciences 2. Science/Engineering(Excluding Biology and Medicine) 3. Biology/Medicine 4. Interdisciplinary Study 1. Title of Seminar:
More informationSphingosine-1-phosphate signaling and cardiac fibrosis. Department of Physiology, Kanazawa University School of Medicine, Kanazawa, Japan
96 Special Issue: Cellular and Molecular Bases for Fibrotic Diseases Review Article Sphingosine-1-phosphate signaling and cardiac fibrosis Noriko Takuwa 1, 2, ), Yasuo Okamoto 1), Kazuaki Yoshioka 1) and
More informationSmall Molecule Inhibitor of the Wnt Pathway (SM04755) as a Potential Topical Scleroderma Treatment
Small Molecule Inhibitor of the Wnt Pathway (SM755) as a Potential Topical Scleroderma Treatment Vishal Deshmukh, PhD, Allison Hood, Yusuf Yazici, MD Disclosures Vishal Deshmukh, Ph.D. o Financial disclosure:
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure S1: Fibroblast-induced elongation of cancer cells requires direct contact with living fibroblasts. A. Representative images of HT29-GFP cultured in the presence
More informationCOMPLICATIONS Diabetes Volume 63, June Diabetes 2014;63: DOI: /db
2120 Diabetes Volume 63, June 2014 Keizo Kanasaki, 1 Sen Shi, 1 Megumi Kanasaki, 1 Jianhua He, 1 Takako Nagai, 1 Yuka Nakamura, 2 Yasuhito Ishigaki, 2 Munehiro Kitada, 1 Swayam Prakash Srivastava, 1 and
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationPhospholipase C γ Prof. Graham Carpenter
Graham Carpenter, h.d. rofessor of Biochemistry Cornelia Crooke Department of Biochemistry Vanderbilt University School of Medicine, Nashville, TN 1 Receptor Tyrosine Kinases GF Extracellular M Intracellular
More informationMEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS
MEK/ERK INHIBITORS: A PROOF-OF-CONCEPT STUDY IN LUNG FIBROSIS Andrew Leask Departments of Dentistry and Physiology and Pharmacology University of Western Ontario Dental Sciences Building London ON Canada
More informationEndothelial PGC 1 - α 1 mediates vascular dysfunction in diabetes
Endothelial PGC-1α mediates vascular dysfunction in diabetes Reporter: Yaqi Zhou Date: 04/14/2014 Outline I. Introduction II. Research route & Results III. Summary Diabetes the Epidemic of the 21st Century
More informationHsp90 regulation of fibroblast activation in pulmonary fibrosis
Downloaded from http:// on January 22, 2018. Hsp90 regulation of fibroblast activation in pulmonary fibrosis Vishwaraj Sontake, 1,4 Yunguan Wang, 2 Rajesh K. Kasam, 1,4 Debora Sinner, 3 Geereddy B. Reddy,
More informationThe 12 th Japan-Korea Diabetic Nephropathy Seminar
FINAL REPORT For Japan-Korea Joint Seminar AREA 1. Humanities and Social Sciences 2. Science/Engineering(Excluding Biology and Medicine) 3. Biology/Medicine 4. Interdisciplinary Study 1. Title of Seminar:
More informationGallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity
Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae
More informationROS as targets for therapeutic intervention of diabetic nephropathy
36 th Autumn Congress of Korean Diabetes Association September 16-17, 2010, BEXCO, Busan, Korea ROS as targets for therapeutic intervention of diabetic nephropathy Hunjoo Ha Department of Bioinspired Science
More informationHOMEWORK RUBRICS MECHANOTRANSDUCTION UNIT: HOMEWORK #1 (20 pts towards your grade)
HOMEWORK RUBRICS MECHANOTRANSDUCTION UNIT: HOMEWORK #1 (20 pts towards your grade) 1. Mesenchymal stem cells (MSC) cultured on extracellular matrices with different stiffness exhibit diverse lineage commitment
More informationPostn MCM Smad2 fl/fl Postn MCM Smad3 fl/fl Postn MCM Smad2/3 fl/fl. Postn MCM. Tgfbr1/2 fl/fl TAC
A Smad2 fl/fl Smad3 fl/fl Smad2/3 fl/fl Tgfbr1/2 fl/fl 1. mm B Tcf21 MCM Tcf21 MCM Smad3 fl/fl Tcf21 MCM Smad2/3 fl/fl Tcf21 MCM Tgfbr1/2 fl/fl αmhc MCM C 1. mm 1. mm D Smad2 fl/fl Smad3 fl/fl Smad2/3
More informationCYTOKINE RECEPTORS AND SIGNAL TRANSDUCTION
CYTOKINE RECEPTORS AND SIGNAL TRANSDUCTION What is Cytokine? Secreted popypeptide (protein) involved in cell-to-cell signaling. Acts in paracrine or autocrine fashion through specific cellular receptors.
More informationCell Cell Communication
IBS 8102 Cell, Molecular, and Developmental Biology Cell Cell Communication January 29, 2008 Communicate What? Why do cells communicate? To govern or modify each other for the benefit of the organism differentiate
More informationcells ISSN
Cells 2015, 4, 631-652; doi:10.3390/cells4040631 Review OPEN ACCESS cells ISSN 2073-4409 www.mdpi.com/journal/cells Epithelial-to-Mesenchymal Transition in Diabetic Nephropathy: Fact or Fiction? Ivonne
More informationUnderstanding Root Cause: Pathogenesis of Hepatic Fibrosis
10/1/12 Understanding Root Cause: Pathogenesis of Hepatic Fibrosis Hepatitis C Virus Mild inflammation Inflammation Fibrosis Cirrhosis 1 10/1/12 Non-alcoholic Fatty Liver Disease Steatosis Steatohepatitis
More informationSupplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation
Supplementary Figure 1 ITGB1 and ITGA11 increase with evidence for heterodimers following HSC activation. (a) Time course of rat HSC activation indicated by the detection of -SMA and COL1 (log scale).
More informationTissue renewal and Repair. Nisamanee Charoenchon, PhD Department of Pathobiology, Faculty of Science
Tissue renewal and Repair Nisamanee Charoenchon, PhD Email: nisamanee.cha@mahidol.ac.th Department of Pathobiology, Faculty of Science Topic Objectives 1. Describe processes of tissue repair, regeneration
More informationVWF other roles than hemostasis. Summary 1: VWF & hemostasis synthesis 11/4/16. Structure/function relationship & functions kDa.
VWF other roles than hemostasis Len$ng PJ, Casari C et al JTH 2012 Summary 1: VWF & hemostasis synthesis Structure/function relationship & functions (HMWM) 20.000kDa multimerization propeptide FVIII GPIb
More informationTissue repair. (3&4 of 4)
Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationSupplementary Materials. for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis
Supplementary Materials for Garmy-Susini, et al, Integrin 4 1 signaling is required for lymphangiogenesis and tumor metastasis 1 Supplementary Figure Legends Supplementary Figure 1: Integrin expression
More informationObstructive nephropathy: Insights from genetically engineered animals
Kidney International, Vol. 68 (2005), pp. 925 937 Obstructive nephropathy: Insights from genetically engineered animals JEAN-LOUP BASCANDS and JOOST P. SCHANSTRA Inserm U388, Institut Louis Bugnard, Touluse
More informationReview of relationship between vascular endothelial growth factor family & receptors and tumor angiogenesis
16 1 2004 2 hinese Bulletin of Life Sciences Vol. 16, No. 1 Feb., 2004 1004-0374 (2004) 01-0019-05 1 201203 2 200025 (vascular endothelial growth factor, ) (vascular permeability factor, VPF), -A -B -
More informationFunctional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma
Functional Effects of TGF-beta1 on Mesenchymal Stem Cell Mobilization in Cockroach Allergen Induced Asthma Pei-Song Gao, MD, PhD Division of Allergy & Clinical Immunology Johns Hopkins University School
More informationSupplementary Figure 1. Deletion of Smad3 prevents B16F10 melanoma invasion and metastasis in a mouse s.c. tumor model.
A B16F1 s.c. Lung LN Distant lymph nodes Colon B B16F1 s.c. Supplementary Figure 1. Deletion of Smad3 prevents B16F1 melanoma invasion and metastasis in a mouse s.c. tumor model. Highly invasive growth
More informationThis article is protected by copyright. All rights reserved.
Coates edited INVITED COMMENTARY Fibroblast Growth Factors and Pulmonary Fibrosis: It s more complex than it sounds Running Title: Pleiotropic actions of FGFs in lung fibrosis Authors: Kevin K. Kim*, Thomas
More informationFoxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition.
Manuscript EMBO-2012-82682 Foxm1 Transcription Factor is Required for Lung Fibrosis and Epithelial to Mesenchymal Transition. David Balli, Vladimir Ustiyan, Yufang Zhang, I-Ching Wang, Alex J. Masino,
More informationCell Cell Communication
IBS 8102 Cell, Molecular, and Developmental Biology Cell Cell Communication January 29, 2008 Communicate What? Why do cells communicate? To govern or modify each other for the benefit of the organism differentiate
More informationMesenchymal progenitor cells in intramuscular connective tissue development
Mesenchymal progenitor cells in intramuscular connective tissue development Min Du, Ph.D. Professor and Endowed Chair Department of Animal Sciences Washington State University Pullman, WA Beef Quality:
More informationSupplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim.
Supplemental Data TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Molly A. Taylor 1, Khalid Sossey-Alaoui 2, Cheryl L. Thompson 3, David Danielpour 4, and William
More informationHistone modifications in kidney disease
Histone modifications in kidney disease Masaomi Nangaku Division of Nephrology and Endocrinology The University of Tokyo Graduate School of Medicine Japan Mimura, Tanaka, & Nangaku. Semin Nephrol 2013
More informationMASTER EN ONCOLOGÍA MOLECULAR 2011 TGF-BETA
MASTER EN ONCOLOGÍA MOLECULAR 2011 TGF-BETA Joan Seoane ICREA Research Professor Vall d Hebron Institute of Oncology Vall d Hebron University Hospital Barcelona jseoane@vhio.net Glioma Stupp et al. New
More informationNiki Prakoura. Calreticulin upregulation in renal fibrosis
Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,
More informationClinical therapeutic strategies for early stage of diabetic kidney disease
Submit a Manuscript: http://www.wjgnet.com/esps/ Help Desk: http://www.wjgnet.com/esps/helpdesk.aspx DOI: 10.4239/wjd.v5.i3.342 World J Diabetes 2014 June 15; 5(3): 342-356 ISSN 1948-9358 (online) 2014
More informationSupplementary Figure 1
CD31 FN Supplementary Figure 1 a Multivariate Cox regression analysis of predicting factors for disease-free and overall survival in 435 HNSCC patients b FN staining in whole sections of HNSCC c FN expression
More informationCHAPTER VII CONCLUDING REMARKS AND FUTURE DIRECTION. Androgen deprivation therapy is the most used treatment of de novo or recurrent
CHAPTER VII CONCLUDING REMARKS AND FUTURE DIRECTION Stathmin in Prostate Cancer Development and Progression Androgen deprivation therapy is the most used treatment of de novo or recurrent metastatic PCa.
More informationGrowth Factor Circuitry in Vascular Morphogenesis. Lung Development
Growth Factor Circuitry in Vascular Morphogenesis Margaret Schwarz, MD Associate Professor Lung Development PECAM-1 Vascular Mediators VEGF ECM Adhesion molecules Anti-angiogenic Factors Fate Specification
More informationTITLE: Neuropilin-2: Novel Biomarker and Therapeutic Target for Aggressive Prostate Cancer
AD Award Number: W81XWH-12-1-0308 TITLE: Neuropilin-2: Novel Biomarker and Therapeutic Target for Aggressive Prostate Cancer PRINCIPAL INVESTIGATOR: Arthur M. Mercurio, Ph.D. CONTRACTING ORGANIZATION:
More informationUncovering the mechanisms of wound healing and fibrosis
Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:
More informationBlockade of endothelial-mesenchymal-transition by a Smad3 inhibitor delays the early development of streptozotocin-induced diabetic nephropathy
Diabetes Publish Ahead of Print, published online August 3, 2010 Blockade of endothelial-mesenchymal-transition by a Smad3 inhibitor delays the early development of streptozotocin-induced diabetic nephropathy
More informationScleroderma. Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis
Scleroderma Chronic multisystemic disease characterized by vasculopathy, variable degree of inflammation, and fibrosis Incidence 3.7-22.8 cases/million Female:male 5:1 Pulmonary fibrosis common, severe
More informationPaul J. Davis, MD. Albany Medical College and Pharmaceutical Research Institute, Albany College of Pharmacy and Health Sciences, Albany, NY USA
ANTI-APOPTOTIC AND PRO- ANGIOGENIC PROPERTIES OF ENDOGENOUS THYROID HORMONE AND ITS ACTION ON P-GLYCOPROTEIN MAY BLUNT RESPONSE TO CONVENTIONAL CHEMOTHERAPY Paul J. Davis, MD Albany Medical College and
More informationControl of Cell Proliferation by Peptide Growth Factors. Autocrine Growth Factor Production Causes Malignant Transformation?
Control of Cell Proliferation by Peptide Growth Factors Autocrine Growth Factor Production Causes Malignant Transformation? Transforming Activities From Condition Media from a Tumor Cell Line Condition
More informationDiabetes: What is the scope of the problem?
Diabetes: What is the scope of the problem? Elizabeth R. Seaquist MD Division of Endocrinology and Diabetes Department of Medicine Director, General Clinical Research Center Pennock Family Chair in Diabetes
More informationEndothelial Mesenchymal Transition: Comparative Analysis of Different Induction Methods
Pinto et al. Biological Procedures Online (2016) 18:10 DOI 10.1186/s12575-016-0040-3 SHORT REPORT Open Access Endothelial Mesenchymal Transition: Comparative Analysis of Different Induction Methods Mariana
More informationTRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer
Supplementary Information TRAF6 ubiquitinates TGFβ type I receptor to promote its cleavage and nuclear translocation in cancer Yabing Mu, Reshma Sundar, Noopur Thakur, Maria Ekman, Shyam Kumar Gudey, Mariya
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): The manuscript by Wu et al describes critical role of RNA binding protein CUGBP1 in the development of TGF-beta-mediated liver fibrosis. The activation
More informationSupplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC
Supplementary Figure 1. Characterization of NMuMG-ErbB2 and NIC breast cancer cells expressing shrnas targeting LPP. NMuMG-ErbB2 cells (a) and NIC cells (b) were engineered to stably express either a LucA-shRNA
More informationIL-17 in health and disease. March 2014 PSO13-C051n
IL-17 in health and disease March 2014 PSO13-C051n Originally Researchers Suggested That IL-12 and IL-4 drove Th Cell Differentiation Naïve CD4 + T cell Question: Which of these cell types is responsible
More informationDPP-4 inhibitor use and risk of diabetic retinopathy: a new safety issue of a safe drug Nam Hoon Kim
DPP-4 inhibitor use and risk of diabetic retinopathy: a new safety issue of a safe drug Nam Hoon Kim Endocrinology of Metabolism, Korea University College of Medicine Conflict of interest disclosure None
More informationInflammation in heart failure: biomarker, bystander or mediator
Inflammation in heart failure: biomarker, bystander or mediator Novel matricellular proteins to target Javier Díez, MD, PhD. Centre of Applied Medical Research and University Clinic School of Medicine,
More informationSupplemental Information
Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin
More informationCancer and Oncogenes Bioscience in the 21 st Century. Linda Lowe-Krentz
Cancer and Oncogenes Bioscience in the 21 st Century Linda Lowe-Krentz December 1, 2010 Just a Few Numbers Becoming Cancer Genetic Defects Drugs Our friends and family 25 More mutations as 20 you get older
More informationRecombinant Integrins
Recombinant Integrins Ligand INTEGRIN α subunit S S β subunit Recombinant Integrins Integrins are heterodimeric integral membrane proteins that play key roles in regulating cell-cell and cell-extracellular
More informationMesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis
Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis Yukinori Koyama,, David A. Brenner, Tatiana Kisseleva J Clin Invest. 2017;127(4):1254-1270. https://doi.org/10.1172/jci88845.
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/364/ra18/dc1 Supplementary Materials for The tyrosine phosphatase (Pez) inhibits metastasis by altering protein trafficking Leila Belle, Naveid Ali, Ana Lonic,
More informationPrinciples of Genetics and Molecular Biology
Cell signaling Dr. Diala Abu-Hassan, DDS, PhD School of Medicine Dr.abuhassand@gmail.com Principles of Genetics and Molecular Biology www.cs.montana.edu Modes of cell signaling Direct interaction of a
More informationFigure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients.
Supplementary Materials Supplementary Figures Figure S1. Reduction in glomerular mir-146a levels correlate with progression to higher albuminuria in diabetic patients. Figure S2. Expression level of podocyte
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/385/ra70/dc1 Supplementary Materials for The interaction of heparan sulfate proteoglycans with endothelial transglutaminase-2 limits VEGF 165 -induced angiogenesis
More informationΑνάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο
Ανάπτυξη Βιοτράπεζας για την Ανίχνευση Πρώιμων Βιοδεικτών σε Ασθενείς με Χρόνια Νεφρική Νόσο ΔΗΜΗΤΡΙΟΣ Σ. ΓΟΥΜΕΝΟΣ Νεφρολογικό και Μεταμοσχευτικό Κέντρο Πανεπιστημιακό Νοσοκομείο Πατρών Causes of chronic
More informationSupplemental Information. Differential Effects of EGFL6 on Tumor. versus Wound Angiogenesis
Cell Reports, Volume 21 Supplemental Information Differential Effects of EGFL6 on Tumor versus Wound Angiogenesis Kyunghee Noh, Lingegowda S. Mangala, Hee-Dong Han, Ningyan Zhang, Sunila Pradeep, Sherry
More informationEpithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention
REVIEW J Am Soc Nephrol 15: 1 12, 2004 Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention YOUHUA LIU Division of Cellular
More informationResearch article. Department of Pharmacology and Toxicology, Medical College of Georgia, Georgia Health Sciences University, Augusta, Georgia, USA.
Research article Calpain mediates pulmonary vascular remodeling in rodent models of pulmonary hypertension, and its inhibition attenuates pathologic features of disease Wanli Ma, 1 Weihong Han, 1 Peter
More informationScope. History. History. Incretins. Incretin-based Therapy and DPP-4 Inhibitors
Plasma Glucose (mg/dl) Plasma Insulin (pmol/l) Incretin-based Therapy and Inhibitors Scope Mechanism of action ผศ.ดร.นพ.ว ระเดช พ ศประเสร ฐ สาขาว ชาโภชนว ทยาคล น ก ภาคว ชาอาย รศาสตร คณะแพทยศาสตร มหาว ทยาล
More informationThomas Jefferson University Annual Progress Report: 2008 Formula Grant
Thomas Jefferson University Annual Progress Report: 2008 Formula Grant Reporting Period July 1, 2012 December 31, 2012 Formula Grant Overview The Thomas Jefferson University received $3,455,597 in formula
More informationSupplementary Figure 1.
Supplementary Figure 1. Increased expression of cell cycle pathway genes in insulin + Glut2 low cells of STZ-induced diabetic islets. A) random blood glucose measuers of STZ and vehicle treated MIP-GFP
More informationIntegrin structure and signaling
Integrin structure and signaling Ramray Bhat ramray@iisc.ac.in 08022932764 History -1 Richard Hynes begins his stint in Michael Stoker s laboratory to look for cell surface changes in PyMT virus transformed
More informationMechanisms of hepatic fibrogenesis in chronic liver disease
Mechanisms of hepatic fibrogenesis in chronic liver disease JPEMS 2014, Physiopathology Module Corentin Bessy (Nantes) _ Gabrielle Cepella (Amsterdam) _ Charly Gaisne (Angers) _ Gwladys Guilloineau (Angers)
More informationCCN2 Keratinocyte Interactions In Vitro and In Vivo
Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Medicine 968 CCN2 Keratinocyte Interactions In Vitro and In Vivo ELIZABETH KIWANUKA ACTA UNIVERSITATIS UPSALIENSIS UPPSALA 2014
More information1.The metastatic cascade. 2.Pathologic features of metastasis. 3.Therapeutic ramifications
Metastasis 1.The metastatic cascade 2.Pathologic features of metastasis 3.Therapeutic ramifications Sir James Paget (1814-1899) British Surgeon/ Pathologist Paget s disease of bone Paget s disease of the
More informationOriginal Article Astragaloside effect on TGF-β1, SMAD2/3, and α-sma expression in the kidney tissues of diabetic KKAy mice
Int J Clin Exp Pathol 2015;8(6):6828-6834 www.ijcep.com /ISSN:1936-2625/IJCEP0008918 Original Article Astragaloside effect on TGF-β1, SMAD2/3, and α-sma expression in the kidney tissues of diabetic KKAy
More informationFigure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min
Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): This is a well written and well executed study describing a novel mechanism of pro-angiogenic signalling which may, potentially, help to explain
More informationRole of Inflammation in Pulmonary Hypertension
Role of Inflammation in Pulmonary Hypertension K. R. Stenmark University of Colorado Denver, USA Prominent Fibroproliferative Changes are Observed in the Lung Vasculature of Infants With Pulmonary Arterial
More informationIntracellular MHC class II molecules promote TLR-triggered innate. immune responses by maintaining Btk activation
Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining Btk activation Xingguang Liu, Zhenzhen Zhan, Dong Li, Li Xu, Feng Ma, Peng Zhang, Hangping Yao and Xuetao
More informationManuel López Cabrera. Modelos experimentales para la investigación en DP
Manuel López Cabrera Modelos experimentales para la investigación en DP Manuel López Cabrera Transición Mesotelio Mesénquima (MMT) como Marcador de Enfermedad y como Diana Terapéutica en Fibrosis Peritoneal
More informationESC Congress August 2011 Paris France. VEGFs and the angiogenic paradox in diabetic patients
ESC Congress 2011 27. 31. August 2011 Paris France VEGFs and the angiogenic paradox in diabetic patients Session: New features and effects of angiogenic growth factors in vascular diseases. Johannes Waltenberger,
More informationAMPK Activation by Metformin Suppresses Abnormal Extracellular Matrix Remodeling in Adipose Tissue and Ameliorates Insulin Resistance in Obesity
Diabetes Volume 65, August 2016 2295 Ting Luo, 1,2 Allison Nocon, 1 Jessica Fry, 1 Alex Sherban, 1 Xianliang Rui, 1 Bingbing Jiang, 1 X. Julia Xu, 1 Jingyan Han, 1 Yun Yan, 3 Qin Yang, 4 Qifu Li, 2 and
More informationDiscussion & Conclusion
Discussion & Conclusion 7. Discussion DPP-4 inhibitors augment the effects of incretin hormones by prolonging their half-life and represent a new therapeutic approach for the treatment of type 2 diabetes
More informationWe are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists. International authors and editors
We are IntechOpen, the world s leading publisher of Open Access books Built by scientists, for scientists 4,000 116,000 120M Open access books available International authors and editors Downloads Our
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb3399 a b c d FSP DAPI 5mm mm 5mm 5mm e Correspond to melanoma in-situ Figure a DCT FSP- f MITF mm mm MlanaA melanoma in-situ DCT 5mm FSP- mm mm mm mm mm g melanoma in-situ MITF MlanaA mm mm
More informationFang et al. NMuMG. PyVmT unstained Anti-CCR2-PE MDA-MB MCF MCF10A
A NMuMG PyVmT 16.5+.5 47.+7.2 Fang et al. unstained Anti-CCR2-PE 4T1 Control 37.6+6.3 56.1+.65 MCF1A 16.1+3. MCF-7 3.1+5.4 MDA-M-231 42.1+5.5 unstained Secondary antibody only Anti-CCR2 SUPPLEMENTAL FIGURE
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3021 Supplementary figure 1 Characterisation of TIMPless fibroblasts. a) Relative gene expression of TIMPs1-4 by real time quantitative PCR (RT-qPCR) in WT or ΔTimp fibroblasts (mean ±
More informationGrowth factors in experimental liver fibrogenesis
Falk Symposium 162: Leberzirrhose: Von der Pathophysiologie zur Klinik 13. Oktober 2007 Ralf Weiskirchen Institute of linical hemistry and Pathobiochemistry, UKA Growth factors in experimental liver fibrogenesis
More informationThe Characterization of Endothelial-Mesenchymal-Transition in Response to. TGF-beta and its Potential Role in Angiogenesis
The Characterization of Endothelial-Mesenchymal-Transition in Response to TGF-beta and its Potential Role in Angiogenesis by Sonja Charlotte Zours A Thesis presented to The University of Guelph In partial
More informationBasic Immunology. Immunological tolerance. Cellular and molecular mechanisms of the immunological tolerance. Lecture 23 rd
Basic Immunology Lecture 23 rd Immunological tolerance Cellular and molecular mechanisms of the immunological tolerance Tolerated skin grafts on MHC (H2) identical mice TOLERANCE & AUTOIMMUNITY Upon encountering
More informationa. b. c. d. e. f. g. h. i. j. k. l. m. n. o. p.
a. b. c. d. e. f. g. h. i. j. k. l. 2.5 2 1.5 1.5 IL-1β 12 8 6 4 2 IL-1β 9 8 7 6 4 3 3 2.9 IL-1β m. n. o. p. 1.8 1.6 1.4 1.2 1.8.6.4.2 6h LPS 2 15 1 5 6h LPS 2 6h LPS 6 4 3 6h LPS Supplementary Figure
More informationSwedish mutant APP-based BACE1 binding site peptide reduces APP β-cleavage and cerebral Aβ levels in Alzheimer s mice
Supplementary Information Swedish mutant APP-based binding site peptide reduces APP β-cleavage and cerebral Aβ levels in Alzheimer s mice Song Li 1,2, *, Huayan Hou 1, *, Takashi Mori 3, Darrell Sawmiller
More informationGENE THERAPY IN CARDIOVASCULAR DISEASES ASAN MEDICAL CENTER KI HOON HAN MD
GENE THERAPY IN CARDIOVASCULAR DISEASES ASAN MEDICAL CENTER KI HOON HAN MD GENE THERAPY 1. CORRECT GENES 2. CURE WITH GENES WHAT IS GENE? DNA ( deoxyribonucleic acid ) - DOUBLE HELICAL STRUCTURE GENE ;
More informationOxygen-independent regulation of HIF-1α levels
Oxygen-independent regulation of HIF-1α levels Growth factors THIOREDOXIN (TRX) OXIDATIVE STRESS PKC PI3K Akt mtor PTEN HIF1α p70s6k Target gene mrnas SP1 HIF-1α mrna Intratumor hypoxia Genetic alterations
More information