Vaccine Design: A Statisticans Overview
|
|
|
- Irma Chapman
- 5 years ago
- Views:
Transcription
1 GoBack
2 : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #1
3 The Chinese are credited with making the observation that deliberately infecting people with mild forms of smallpox could prevent infection with more deadly forms and provide life long protection. Introduction of first generation of vaccines for use in humans 1798 Smallpox 1926 Pertussis 1885 Rabies 1927 Tuberculosis (BCG) 1897 Plague 1923 Diphtheria 1927 Tetanus 1935 Yellow Fever Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #2
4 Live attenuated vaccines Inactivated or killed vaccines Recombinant sub-unit envelope vaccines Recombinant vectored vaccines DNA vaccines and replicons Involve HIV genetic sequences which, once injected, induce expression of HIV antigens by human cells. In the case of replicons, these sequences are wrapped in the outer coat of an unrelated virus. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #3
5 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #4
6 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #5
7 Sequence Analysis Viral/Microbial Evolution. Being Lower forms of life ( or even unicellular organism) they can mutate much easily. But we cannot. Gene Expression Analysis Which Genes/Molecules/Protiens are expressed at certain time point in the viral life cycle. Classification and Prediction Which of these proteins will bind to the MHC Molecule present in a particular human being. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #6
8 Destruction of infected cells and tumor cells by cytotoxic T-lymphocytes or CTLs. CTLs are effector cells derived from T8-lymphocytes during cell-mediated immunity. The TCRs and CD8 on the surface of naive T8-lymphocytes are designed to recognize peptide epitopes bound to MHC-I on antigen-presenting cells (APCs). Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #7
9 Major Histo Compatibility, also known as human leukocyte antigens or HLA Present on various human cells e.g. dendritic cells. Typically epitopes of length 9. MHC I animation MHC I movie 1 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #8
10 Mechanism different from MHC I. More complicated as the binding length may be more than 9. MHC II animation MHC II movie 2 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #9
11 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #10
12 >A85A_MYCTU 48 GLPVEYLQV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85A_MYCTU 242 KLIANNTRV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85B_MYCTU 239 KLVANNTRL MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGR DIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYS DWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKL VANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG THSWEYWGAQLNAMKGDLQSSLGAG >ACTB_HUMAN 180 ALPHAILRL MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #11
13 MHC class I genes (HLA-A, HLA-B and HLA-C) MHC class II genes (HLA-DP, HLA-DQ and HLA-DR) Database ALPHAILRL Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #12
14 We want to classify the peptides into Binders and non Binders. Binders of specific HLA-super types. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #13
15 A supermotif is a motif which confers the ability to bind to several different HLA A supertype, the corresponding assembly of HLA As of October 2001, nine major HLA class I supertypes have been defined HLA-A1, A2, A3, A24 HLA-B7, B27, B44, B58, B62 e.g the 5 alleles belonging to HLA-A3 supertype: A*0301 A*1101 A*3101 A*3301 A*6801. Sette et al, Immunogenetics (1999) 50: Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #14
16 Mostly +ve examples. No good database of -ve examples. Include structural information of peptides in the classifier. In case of we do not know the position of binding. Supertypes are still being defined. Work in Progress... Slides produced with HA-prosper latex package Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #15
Vaccine Design: A Statisticans Overview
GoBack : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: 2004 - slide #1 The Chinese are credited with making the observation that deliberately infecting
The Major Histocompatibility Complex (MHC)
The Major Histocompatibility Complex (MHC) An introduction to adaptive immune system before we discuss MHC B cells The main cells of adaptive immune system are: -B cells -T cells B cells: Recognize antigens
VACCINATION. DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M.
VACCINATION DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M. IMMUNIZATION Immunization is defined as the procedure by which the body is prepared to fight against a specific disease. It is used to induce the
1. Overview of Adaptive Immunity
Chapter 17A: Adaptive Immunity Part I 1. Overview of Adaptive Immunity 2. T and B Cell Production 3. Antigens & Antigen Presentation 4. Helper T cells 1. Overview of Adaptive Immunity The Nature of Adaptive
By:Reham Alahmadi NOV The production of antibodies and vaccination technology
By:Reham Alahmadi NOV 2018 The production of antibodies and vaccination technology Antibody Production The blood contains two types of white blood cell or leukocyte Phagocytes ingest bacteria by endocytosis
Lecture 6. Burr BIO 4353/6345 HIV/AIDS. Tetramer staining of T cells (CTL s) Andrew McMichael seminar: Background
Lecture 6 Burr BIO 4353/6345 HIV/AIDS Andrew McMichael seminar: Background Tetramer staining of T cells (CTL s) 1. Vβ 19: There are 52 T cell receptor (TCR) Vβ gene segments in germ line DNA (See following
Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii. Ringworm fungus HIV Influenza
Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii Ringworm fungus HIV Influenza Candida Staph aureus Mycobacterium tuberculosis Listeria Salmonella Streptococcus Levels
Gene Vaccine Dr. Sina Soleimani
Gene Vaccine Dr. Sina Soleimani Human Viral Vaccines Quality Control Laboratory (HVVQC) Titles 1. A short Introduction of Vaccine History 2. First Lineage of Vaccines 3. Second Lineage of Vaccines 3. New
Trends in vaccinology
Trends in vaccinology Mathieu Peeters, MD Joint Conference of European Human Pharmacological Societies and Joint Conference of European Human Pharmacological Societies and 20th Anniversary of AGAH March
Profiling HLA motifs by large scale peptide sequencing Agilent Innovators Tour David K. Crockett ARUP Laboratories February 10, 2009
Profiling HLA motifs by large scale peptide sequencing 2009 Agilent Innovators Tour David K. Crockett ARUP Laboratories February 10, 2009 HLA Background The human leukocyte antigen system (HLA) is the
White Blood Cells (WBCs)
YOUR ACTIVE IMMUNE DEFENSES 1 ADAPTIVE IMMUNE RESPONSE 2! Innate Immunity - invariant (generalized) - early, limited specificity - the first line of defense 1. Barriers - skin, tears 2. Phagocytes - neutrophils,
Attribution: University of Michigan Medical School, Department of Microbiology and Immunology
Attribution: University of Michigan Medical School, Department of Microbiology and Immunology License: Unless otherwise noted, this material is made available under the terms of the Creative Commons Attribution
C. Incorrect! MHC class I molecules are not involved in the process of bridging in ADCC.
Immunology - Problem Drill 13: T- Cell Mediated Immunity Question No. 1 of 10 1. During Antibody-dependent cell mediated cytotoxicity (ADCC), the antibody acts like a bridge between the specific antigen
RAISON D ETRE OF THE IMMUNE SYSTEM:
RAISON D ETRE OF THE IMMUNE SYSTEM: To Distinguish Self from Non-Self Thereby Protecting Us From Our Hostile Environment. Innate Immunity Acquired Immunity Innate immunity: (Antigen nonspecific) defense
Lines of Defense. Immunology, Immune Response, and Immunological Testing. Immunology Terminology
Immunology, Immune Response, and Immunological Testing Lines of Defense If the First and Second lines of defense fail, then the Third line of defense is activated. B and T lymphocytes undergo a selective
BBS 2711 Virology. Virus Vaccines
BBS 2711 Virology Virus Vaccines Dr Paul Young, Department of Microbiology & Parasitology. p.young@mailbox.uq.edu.au Virus Vaccines First vaccine developed by Jenner in late 1700's against smallpox virus
Adaptive Immune Response Day 2. The Adaptive Immune Response
Adaptive Immune Response Day 2 Chapter 16 The Adaptive Immune Response 1 The B cell receptor vs. the T cell receptor. The B cell receptor vs. the T cell receptor. 2 Which T cells have CD4 and which have
Determinants of Immunogenicity and Tolerance. Abul K. Abbas, MD Department of Pathology University of California San Francisco
Determinants of Immunogenicity and Tolerance Abul K. Abbas, MD Department of Pathology University of California San Francisco EIP Symposium Feb 2016 Why do some people respond to therapeutic proteins?
Adaptive Immunity: Specific Defenses of the Host
17 Adaptive Immunity: Specific Defenses of the Host SLOs Differentiate between innate and adaptive immunity, and humoral and cellular immunity. Define antigen, epitope, and hapten. Explain the function
IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology
Bioinformatics 1 -- Lecture 22 IMMUNOINFORMATICS: Bioinformatics Challenges in Immunology Most slides courtesy of Julia Ponomarenko, San Diego Supercomputer Center or Oliver Kohlbacher, WSI/ZBIT, Eberhard-Karls-
A HLA-DRB supertype chart with potential overlapping peptide binding function
A HLA-DRB supertype chart with potential overlapping peptide binding function Arumugam Mohanapriya 1,2, Satish Nandagond 1, Paul Shapshak 3, Uma Kangueane 1, Pandjassarame Kangueane 1, 2 * 1 Biomedical
Emerging Viruses. Part IIb Follow Up from Part I Vaccines and Inhibitors
Emerging Viruses Part IIb Follow Up from Part I Vaccines and Inhibitors Cellular Responses to Viral Invasion: Restriction Factors Cells fight viral infection using a series of restriction factors Restriction
Antigen Presentation and T Lymphocyte Activation. Abul K. Abbas UCSF. FOCiS
1 Antigen Presentation and T Lymphocyte Activation Abul K. Abbas UCSF FOCiS 2 Lecture outline Dendritic cells and antigen presentation The role of the MHC T cell activation Costimulation, the B7:CD28 family
RAISON D ETRE OF THE IMMUNE SYSTEM:
RAISON D ETRE OF THE IMMUNE SYSTEM: To Distinguish Self from Non-Self Thereby Protecting Us From Our Hostile Environment. Innate Immunity Adaptive Immunity Innate immunity: (Antigen - nonspecific) defense
Antigen Presentation to T lymphocytes
Antigen Presentation to T lymphocytes Immunology 441 Lectures 6 & 7 Chapter 6 October 10 & 12, 2016 Jessica Hamerman jhamerman@benaroyaresearch.org Office hours by arrangement Antibodies and T cell receptors
Immunology Lecture 4. Clinical Relevance of the Immune System
Immunology Lecture 4 The Well Patient: How innate and adaptive immune responses maintain health - 13, pg 169-181, 191-195. Immune Deficiency - 15 Autoimmunity - 16 Transplantation - 17, pg 260-270 Tumor
Use of BONSAI decision trees for the identification of potential MHC Class I peptide epitope motifs.
Use of BONSAI decision trees for the identification of potential MHC Class I peptide epitope motifs. C.J. SAVOIE, N. KAMIKAWAJI, T. SASAZUKI Dept. of Genetics, Medical Institute of Bioregulation, Kyushu
Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel:
Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1 Realize the significance
Vaccines and other immunological antimicrobial therapy 1
Vaccines and other immunological antimicrobial therapy 1 Vaccines Vaccine: a biological preparation that provides active acquired immunity to a particular disease. Vaccine typically contains an agent that
Lecture 11. Immunology and disease: parasite antigenic diversity
Lecture 11 Immunology and disease: parasite antigenic diversity RNAi interference video and tutorial (you are responsible for this material, so check it out.) http://www.pbs.org/wgbh/nova/sciencenow/3210/02.html
In other words. how to prevent David from killing Goliath. Tammy Rickabaugh, Ph.D. January 14, 2014
In other words. how to prevent David from killing Goliath Tammy Rickabaugh, Ph.D. January 14, 2014 2011 Nobel Prize in Medicine IMMUNOLOGISTS!!!!!!! Bruce A. Beutler Jules A. Hoffman Ralph M. Steinman
Antigen processing and presentation. Monika Raulf
Antigen processing and presentation Monika Raulf Lecture 25.04.2018 What is Antigen presentation? AP is the display of peptide antigens (created via antigen processing) on the cell surface together with
Chapter 35 Active Reading Guide The Immune System
Name: AP Biology Mr. Croft Chapter 35 Active Reading Guide The Immune System Section 1 Phagocytosis plays an important role in the immune systems of both invertebrates and vertebrates. Review the process
Chapter 22: The Lymphatic System and Immunity
Bio40C schedule Lecture Immune system Lab Quiz 2 this week; bring a scantron! Study guide on my website (see lab assignments) Extra credit Critical thinking questions at end of chapters 5 pts/chapter Due
Physiology Unit 3. ADAPTIVE IMMUNITY The Specific Immune Response
Physiology Unit 3 ADAPTIVE IMMUNITY The Specific Immune Response In Physiology Today The Adaptive Arm of the Immune System Specific Immune Response Internal defense against a specific pathogen Acquired
Principles of Adaptive Immunity
Principles of Adaptive Immunity Chapter 3 Parham Hans de Haard 17 th of May 2010 Agenda Recognition molecules of adaptive immune system Features adaptive immune system Immunoglobulins and T-cell receptors
Immunology. T-Lymphocytes. 16. Oktober 2014, Ruhr-Universität Bochum Karin Peters,
Immunology T-Lymphocytes 16. Oktober 2014, Ruhr-Universität Bochum Karin Peters, karin.peters@rub.de The role of T-effector cells in the immune response against microbes cellular immunity humoral immunity
Introduction to Immunology Part 2 September 30, Dan Stetson
Introduction to Immunology Part 2 September 30, 2016 Dan Stetson stetson@uw.edu 441 Lecture #2 Slide 1 of 26 CLASS ANNOUNCEMENT PLEASE NO TREE NUTS IN CLASS!!! (Peanuts, walnuts, almonds, cashews, etc)
Immunodeficiency. (2 of 2)
Immunodeficiency (2 of 2) Acquired (secondary) immunodeficiencies More common Many causes such as therapy, cancer, sarcoidosis, malnutrition, infection & renal disease The most common of which is therapy-related
The World Health Organization (WHO) estimate that vaccination averts 2-3 million deaths per year (in all age groups), and up to 1.
Vaccination The World Health Organization (WHO) estimate that vaccination averts 2-3 million deaths per year (in all age groups), and up to 1.5 million children die each year due to diseases which could
19/06/2013. Viruses are not organisms (do not belong to any kingdom). Viruses are not made of cells, have no cytoplasm, and no membranes.
VIRUSES Many diseases of plants and animals are caused by bacteria or viruses that invade the body. Bacteria and viruses are NOT similar kinds of micro-organisms. Bacteria are classified as living organisms,
Glossary of Terms - Vaccinology 101 Nurse TIP Webcast
Glossary of Terms - Vaccinology 101 Nurse TIP Webcast Adaptive Immune response Adaptive immune response or adaptive immunity is the response of antigen-specific lymphocytes to antigen, including the development
Stainless-steel vs Single-use: The Vaccines Perspective
Stainless-steel vs Single-use: The Vaccines Perspective CMO-Biomanufacturer Panel Tue 21 April, Noon-1:30pm, Exhibit Hall Daniel C.Vellom, PhD Sr. Director Global Technology Innovation 2015 INTERPHEX 1
M.Sc. III Semester Biotechnology End Semester Examination, 2013 Model Answer LBTM: 302 Advanced Immunology
Code : AS-2246 M.Sc. III Semester Biotechnology End Semester Examination, 2013 Model Answer LBTM: 302 Advanced Immunology A. Select one correct option for each of the following questions:- 2X10=10 1. (b)
Biotechnology-Based Vaccines. Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel:
Biotechnology-Based Vaccines Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1.
M I C R O B I O L O G Y
ninth edition TORTORA FUNKE CASE M I C R O B I O L O G Y a n i n t r o d u c t i o n 18 Practical Applications of Immunology PowerPoint Lecture Slide Presentation prepared by Christine L. Case Vaccine
Page 4: Antigens: Self-Antigens The body has a vast number of its own antigens called self-antigens. These normally do not trigger immune responses.
Common Characteristics of B and T Lymphocytes Graphics are used with permission of Pearson Education Inc., publishing as Benjamin Cummings (http://www.aw-bc.com). Page 1: Introduction While B and T lymphocytes
CELL BIOLOGY - CLUTCH CH THE IMMUNE SYSTEM.
!! www.clutchprep.com CONCEPT: OVERVIEW OF HOST DEFENSES The human body contains three lines of against infectious agents (pathogens) 1. Mechanical and chemical boundaries (part of the innate immune system)
chapter 17: specific/adaptable defenses of the host: the immune response
chapter 17: specific/adaptable defenses of the host: the immune response defense against infection & illness body defenses innate/ non-specific adaptable/ specific epithelium, fever, inflammation, complement,
CHAPTER 18: Immune System
CHAPTER 18: Immune System 1. What are four characteristics of the specific immune system? a. b. c. d. 2. List the two main types of defense mechanisms and briefly describe features of each. 3. Give examples
Vaccination. Artificially induced specific adaptive immunity
Vaccination Artificially induced specific adaptive immunity Is vaccination useful? http://sphweb.bumc.bu.edu/otlt/mph-modules/ph/ma-surveillance/ma-surveillance7.html Good vaccine characteristics Live
HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol
HLA and antigen presentation Department of Immunology Charles University, 2nd Medical School University Hospital Motol MHC in adaptive immunity Characteristics Specificity Innate For structures shared
Adaptive immune responses: T cell-mediated immunity
MICR2209 Adaptive immune responses: T cell-mediated immunity Dr Allison Imrie allison.imrie@uwa.edu.au 1 Synopsis: In this lecture we will discuss the T-cell mediated immune response, how it is activated,
Structure and Function of Antigen Recognition Molecules
MICR2209 Structure and Function of Antigen Recognition Molecules Dr Allison Imrie allison.imrie@uwa.edu.au 1 Synopsis: In this lecture we will examine the major receptors used by cells of the innate and
The Adaptive Immune Responses
The Adaptive Immune Responses The two arms of the immune responses are; 1) the cell mediated, and 2) the humoral responses. In this chapter we will discuss the two responses in detail and we will start
Third line of Defense
Chapter 15 Specific Immunity and Immunization Topics -3 rd of Defense - B cells - T cells - Specific Immunities Third line of Defense Specific immunity is a complex interaction of immune cells (leukocytes)
Adaptive (acquired) immunity. Professor Peter Delves University College London
Adaptive (acquired) immunity Professor Peter Delves University College London p.delves@ucl.ac.uk Haematopoiesis Haematopoiesis Lymphocytes = adaptive response Recognition of pathogens by adaptive cells,
HLA and more. Ilias I.N. Doxiadis. Geneva 03/04/2012.
www.ebmt.org HLA and more Ilias I.N. Doxiadis Geneva 03/04/2012 HLA and more HLA and more / Doxiadis 2 Topic of the day Compatibility testing is a type of testing used to ensure compatibility of the system/application/website
General information. Cell mediated immunity. 455 LSA, Tuesday 11 to noon. Anytime after class.
General information Cell mediated immunity 455 LSA, Tuesday 11 to noon Anytime after class T-cell precursors Thymus Naive T-cells (CD8 or CD4) email: lcoscoy@berkeley.edu edu Use MCB150 as subject line
Alessandra Franco MD PhD UCSD School of Medicine Department of Pediatrics Division of Allergy Immunology and Rheumatology
Immunodominant peptides derived from the heavy constant region of IgG1 stimulate natural regulatory T cells: identification of pan- HLA binders for clinical translation Alessandra Franco MD PhD UCSD School
A general overview of Immune system and. Shuyan Li 2/4/2009
A general overview of Immune system and Immunology Shuyan Li 2/4/2009 Definition Immune system a collection of biological processes within an organism that protects against disease by identifying and killing
5. Over the last ten years, the proportion of HIV-infected persons who are women has: a. Increased b. Decreased c. Remained about the same 1
Epidemiology 227 April 24, 2009 MID-TERM EXAMINATION Select the best answer for the multiple choice questions. There are 60 questions and 9 pages on the examination. Each question will count one point.
ACTIVATION AND EFFECTOR FUNCTIONS OF CELL-MEDIATED IMMUNITY AND NK CELLS. Choompone Sakonwasun, MD (Hons), FRCPT
ACTIVATION AND EFFECTOR FUNCTIONS OF CELL-MEDIATED IMMUNITY AND NK CELLS Choompone Sakonwasun, MD (Hons), FRCPT Types of Adaptive Immunity Types of T Cell-mediated Immune Reactions CTLs = cytotoxic T lymphocytes
Chapter 1. Chapter 1 Concepts. MCMP422 Immunology and Biologics Immunology is important personally and professionally!
MCMP422 Immunology and Biologics Immunology is important personally and professionally! Learn the language - use the glossary and index RNR - Reading, Note taking, Reviewing All materials in Chapters 1-3
CONVENTIONAL VACCINE DEVELOPMENT
CONVENTIONAL VACCINE DEVELOPMENT PROBLEM Lethal germ Dead mouse LIVE VACCINES Related but harmless germ gives protection against lethal pathogen. Examples are the original pox vaccine and some TB vaccines
Transplantation. Immunology Unit College of Medicine King Saud University
Transplantation Immunology Unit College of Medicine King Saud University Objectives To understand the diversity among human leukocyte antigens (HLA) or major histocompatibility complex (MHC) To know the
Two categories of immune response. immune response. infection. (adaptive) Later immune response. immune response
Ivana FELLNEROVÁ E-mail: fellneri@hotmail.com, mob. 732154801 Basic immunogenetic terminology innate and adaptive immunity specificity and polymorphism immunoglobuline gene superfamily immunogenetics MHC
Cytotoxicity assays. Rory D. de Vries, PhD 1. Viroscience lab, Erasmus MC, Rotterdam, the Netherlands
Cytotoxicity assays Rory D. de Vries, PhD 1 1 Viroscience lab, Erasmus MC, Rotterdam, the Netherlands Anti-influenza immunity Humoral / CD4+ / CD8+ / NK? Function of CTL Elimination of virus-infected cells?
Vaccines. Vaccines ( continued 1) February 21, 2017 Department of Public Health Sciences
Infectious Disease Epidemiology BMTRY 713 (A. Selassie, DrPH) Lecture 11 Vaccines Past, Present, Future Learning Objectives 1. Identify the various types of vaccines 2. Describe the role of vaccine in
Practical Solution: presentation to cytotoxic T cells. How dendritic cells present antigen. How dendritic cells present antigen
Christian Kurts Institutes of Molecular Medicine and Experimental Immunology University of Bonn, Germany - presentation and (CTL) activation - I presentation and CD4 + T cell (Th cell) activation Different
Cellular Pathology of immunological disorders
Cellular Pathology of immunological disorders SCBM344 Cellular and Molecular Pathology Witchuda Payuhakrit, Ph.D (Pathobiology) witchuda.pay@mahidol.ac.th Objectives Describe the etiology of immunological
The Immune System. These are classified as the Innate and Adaptive Immune Responses. Innate Immunity
The Immune System Biological mechanisms that defend an organism must be 1. triggered by a stimulus upon injury or pathogen attack 2. able to counteract the injury or invasion 3. able to recognise foreign
Basel - 6 September J.-M. Tiercy National Reference Laboratory for Histocompatibility (LNRH) University Hospital Geneva
Basel - 6 eptember 2012 J.-M. Tiercy National Reference Laboratory for Histocompatibility (LNRH) University Hospital Geneva Outline the HLA system is (a) complex anti-hla immunisation and alloreactivity
Overview: The immune responses of animals can be divided into innate immunity and acquired immunity.
GUIDED READING - Ch. 43 - THE IMMUNE SYSTEM NAME: Please print out these pages and HANDWRITE the answers directly on the printouts. Typed work or answers on separate sheets of paper will not be accepted.
Antigens and Immunogens
Background 1. Medical Importance of Immune System (vaccines, immunodeficiency diseases, hypersensitivity) 2. How the Immune System Works (innate & adaptive immune mech., B/T cells, Abs, Cytokines) 2. Cells
How HIV Causes Disease Prof. Bruce D. Walker
How HIV Causes Disease Howard Hughes Medical Institute Massachusetts General Hospital Harvard Medical School 1 The global AIDS crisis 60 million infections 20 million deaths 2 3 The screen versions of
Antigen capture and presentation to T lymphocytes
Antigen capture and presentation to T lymphocytes What T lymphocytes see Innate Immunity Immediately available or Very broad specificity rapidly recruited Adaptive Immunity Rare and naïve cells require
9/10/2018. Principles of Vaccination. Immunity. Antigen. September 2018
Centers for Disease Control and Prevention National Center for Immunization and Respiratory Diseases Principles of Vaccination September 2018 Chapter 1 September 2018 Photographs and images included in
Please read Chapters 5, 6 and 7 of your vaccine text for next Wednesday s lecture. Chapters 9, 17 and 8 for next Friday s lectures
Valerie Daggett Please read Chapters 5, 6 and 7 of your vaccine text for next Wednesday s lecture Chapters 9, 17 and 8 for next Friday s lectures ppt files for first 2 lectures Past exams Principles of
Third line of Defense. Topic 8 Specific Immunity (adaptive) (18) 3 rd Line = Prophylaxis via Immunization!
Topic 8 Specific Immunity (adaptive) (18) Topics - 3 rd Line of Defense - B cells - T cells - Specific Immunities 1 3 rd Line = Prophylaxis via Immunization! (a) A painting of Edward Jenner depicts a cow
HLA and antigen presentation. Department of Immunology Charles University, 2nd Medical School University Hospital Motol
HLA and antigen presentation Department of Immunology Charles University, 2nd Medical School University Hospital Motol MHC in adaptive immunity Characteristics Specificity Innate For structures shared
Viral Genetics. BIT 220 Chapter 16
Viral Genetics BIT 220 Chapter 16 Details of the Virus Classified According to a. DNA or RNA b. Enveloped or Non-Enveloped c. Single-stranded or double-stranded Viruses contain only a few genes Reverse
Introduction to Immune System
Introduction to Immune System Learning outcome You will be able to understand, at a fundamental level, the STRUCTURES and FUNCTIONS of cell surface and soluble molecules involved in recognition of foreign
Annex 1. WHO Recommendations, Guidelines and other documents related to the manufacture and quality control of biological substances used in medicine
WHO related to the manufacture and quality control of biological substances used in medicine WHO are intended to provide guidance to those responsible for the production of biological substances as well
MHC class I MHC class II Structure of MHC antigens:
MHC class I MHC class II Structure of MHC antigens: MHC class I antigens consist of a transmembrane heavy chain (α chain) that is non-covalently associated with β2- microglobulin. Membrane proximal domain
Major Histocompatibility Complex (MHC) and T Cell Receptors
Major Histocompatibility Complex (MHC) and T Cell Receptors Historical Background Genes in the MHC were first identified as being important genes in rejection of transplanted tissues Genes within the MHC
Mucosal Immune System
Exam Format 100 points - 60 pts mandatory; 40 points where 4, 10 point questions will be chosen Some open-ended questions, some short answer. Kuby question Cytokines Terminology How do cytokines achieve
Immunology Basics Relevant to Cancer Immunotherapy: T Cell Activation, Costimulation, and Effector T Cells
Immunology Basics Relevant to Cancer Immunotherapy: T Cell Activation, Costimulation, and Effector T Cells Andrew H. Lichtman, M.D. Ph.D. Department of Pathology Brigham and Women s Hospital and Harvard
TCR, MHC and coreceptors
Cooperation In Immune Responses Antigen processing how peptides get into MHC Antigen processing involves the intracellular proteolytic generation of MHC binding proteins Protein antigens may be processed
HACKING HIV: CREATING AND ASSESSING A NOVEL CTL-BASED HIV-1 VACCINE
HACKING HIV: CREATING AND ASSESSING A NOVEL CTL-BASED HIV-1 VACCINE Craig Rouskey Immunity Project Waag Society, Amsterdam, NL September 9, 2014 IMMUNITY PROJECT Immunity Project is a non-profit initiative
Overview. Barriers help animals defend against many dangerous pathogens they encounter.
Immunity Overview Barriers help animals defend against many dangerous pathogens they encounter. The immune system recognizes foreign bodies and responds with the production of immune cells and proteins.
There are 2 major lines of defense: Non-specific (Innate Immunity) and. Specific. (Adaptive Immunity) Photo of macrophage cell
There are 2 major lines of defense: Non-specific (Innate Immunity) and Specific (Adaptive Immunity) Photo of macrophage cell Development of the Immune System ery pl neu mφ nk CD8 + CTL CD4 + thy TH1 mye
Definition of MHC supertypes through clustering of MHC peptide binding repertoires
Definition of MHC supertypes through clustering of MHC peptide binding repertoires Pedro A. Reche and Ellis L. Reinherz Laboratory of Immunobiology and Department of Medical Oncology, Dana-Farber Cancer
Immunobiology. Readiness Exam. Immune Response (two phases)
BIO401 Immunobiology BOOK Kuby 6 th Edition* EXAMS - 3 exams - 100 points - Final--> 100 points - Quizzes 50 points TOTAL: 450 points FINAL GRADE: Lab: 25% (300 points) Lecture: 75% (450 points) Immunobiology
Adaptive Immunity: Humoral Immune Responses
MICR2209 Adaptive Immunity: Humoral Immune Responses Dr Allison Imrie 1 Synopsis: In this lecture we will review the different mechanisms which constitute the humoral immune response, and examine the antibody
VIRUSES. Biology Applications Control. David R. Harper. Garland Science Taylor & Francis Group NEW YORK AND LONDON
VIRUSES Biology Applications Control David R. Harper GS Garland Science Taylor & Francis Group NEW YORK AND LONDON vii Chapter 1 Virus Structure and 2.2 VIRUS MORPHOLOGY 26 Infection 1 2.3 VIRAL CLASSIFICATION
Development of B and T lymphocytes
Development of B and T lymphocytes What will we discuss today? B-cell development T-cell development B- cell development overview Stem cell In periphery Pro-B cell Pre-B cell Immature B cell Mature B cell
FOCiS. Lecture outline. The immunological equilibrium: balancing lymphocyte activation and control. Immunological tolerance and immune regulation -- 1
1 Immunological tolerance and immune regulation -- 1 Abul K. Abbas UCSF FOCiS 2 Lecture outline Principles of immune regulation Self-tolerance; mechanisms of central and peripheral tolerance Inhibitory
Chapter 17B: Adaptive Immunity Part II
Chapter 17B: Adaptive Immunity Part II 1. Cell-Mediated Immune Response 2. Humoral Immune Response 3. Antibodies 1. The Cell-Mediated Immune Response Basic Steps of Cell-Mediated IR 1 2a CD4 + MHC cl.
Cell Mediated Immunity CELL MEDIATED IMMUNITY. Basic Elements of Cell Mediated Immunity (CMI) Antibody-dependent cell-mediated cytotoxicity (ADCC)
Chapter 16 CELL MEDIATED IMMUNITY Cell Mediated Immunity Also known as Cellular Immunity or CMI The effector phase T cells Specificity for immune recognition reactions TH provide cytokines CTLs do the