Vaccine Design: A Statisticans Overview
|
|
- Jonathan Morgan
- 5 years ago
- Views:
Transcription
1 GoBack
2 : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #1
3 The Chinese are credited with making the observation that deliberately infecting people with mild forms of smallpox could prevent infection with more deadly forms and provide life long protection. Introduction of first generation of vaccines for use in humans 1798 Smallpox 1926 Pertussis 1885 Rabies 1927 Tuberculosis (BCG) 1897 Plague 1923 Diphtheria 1927 Tetanus 1935 Yellow Fever Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #2
4 Live attenuated vaccines Inactivated or killed vaccines Recombinant sub-unit envelope vaccines Recombinant vectored vaccines DNA vaccines and replicons Involve HIV genetic sequences which, once injected, induce expression of HIV antigens by human cells. In the case of replicons, these sequences are wrapped in the outer coat of an unrelated virus. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #3
5 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #4
6 Major Histo Compatibility, also known as human leukocyte antigens or HLA Present on various human cells e.g. dendritic cells. Typically epitopes of length 9. MHC I animation MHC I movie 1 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #5
7 Mechanism different from MHC I. More complicated as the binding length may be more than 9. MHC II animation MHC II movie 2 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #6
8 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #7
9 >A85A_MYCTU 48 GLPVEYLQV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85A_MYCTU 242 KLIANNTRV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85B_MYCTU 239 KLVANNTRL MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGR DIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYS DWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKL VANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG THSWEYWGAQLNAMKGDLQSSLGAG >ACTB_HUMAN 180 ALPHAILRL MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #8
10 MHC class I genes (HLA-A, HLA-B and HLA-C) MHC class II genes (HLA-DP, HLA-DQ and HLA-DR) Database ALPHAILRL Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #9
11 We want to classify the peptides into Binders and non Binders. Binders of specific HLA-super types. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #10
12 A supermotif is a motif which confers the ability to bind to several different HLA A supertype, the corresponding assembly of HLA As of October 2001, nine major HLA class I supertypes have been defined HLA-A1, A2, A3, A24 HLA-B7, B27, B44, B58, B62 e.g the 5 alleles belonging to HLA-A3 supertype: A*0301 A*1101 A*3101 A*3301 A*6801. Sette et al, Immunogenetics (1999) 50: Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #11
13 Mostly +ve examples. No good database of -ve examples. Include structural information of peptides in the classifier. In case of we do not know the position of binding. Supertypes are still being defined. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #12
14 British: Tularaemia Pathogen: Francisella tularensis Infects small mammals ground squirrels, rabbits, hares, voles, muskrats, water rats and other rodents Arthropod vectors: ticks, biting flies, mosquitoes Uncommon zoonosis 125 cases/year in USA farmers, hunters, walkers, forest workers kills less than 50 people a year worldwide Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #13
15 Why is it important. Tested by Japan in WWII as potential bioweapon Weaponised and stockpiled by USA and USSR during Cold War Highly infectious: inhalation of 10 bacteria can cause disease Avenues: ingestion (water and food), inhalation, direct contact, arthropod intermediates, animal bites No person to person spread Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #14
16 Ulceroglandular Incubation period 3-6 days Sudden onset flu like symptoms Ulcer at site of infection Enlargement of draining nodes Typhoidal syndrome: septicemia without ulcer or lymphadenopathy Oropharyngeal: sore throat, enlarged tonsils, yellow-white pseudomembrane Gastrointestinal: persistent diarrhea, bowel ulceration - acute fatal disease Pneumonia Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #15
17 A World Health Organization model for a sizeable tularemia release over a metropolitan area with 5 million inhabitants predicted 250,000 people incapacitated and 19,000 deaths, Dennis cited. With antibiotic treatment, tularemia mortality rate is under 10treatment. Work in Progress... Slides produced with HA-prosper latex package Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #16
Vaccine Design: A Statisticans Overview
GoBack : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: 2004 - slide #1 The Chinese are credited with making the observation that deliberately infecting
More informationFrancisella tularensis. Patricia Bolivar MS., CLS, PHM
Francisella tularensis Patricia Bolivar MS., CLS, PHM Case A 42 year old male hunter presents with a painful, purulent conjunctivitis. Ulcerations were present on the conjunctiva. Cervical lymphadenopathy
More informationBy:Reham Alahmadi NOV The production of antibodies and vaccination technology
By:Reham Alahmadi NOV 2018 The production of antibodies and vaccination technology Antibody Production The blood contains two types of white blood cell or leukocyte Phagocytes ingest bacteria by endocytosis
More informationAcute respiratory illness This is a disease that typically affects the airways in the nose and throat (the upper respiratory tract).
Influenza glossary Adapted from the Centers for Disease Control and Prevention, US https://www.cdc.gov/flu/glossary/index.htm and the World Health Organization http://www.wpro.who.int/emerging_diseases/glossary_rev_sept28.pdf?ua=1
More informationJuly 1, 2005 Page 1 of 5
Abstract: Consensus Statement: Tularemia as a Biological Weapon: Medical and Public Health Abstracted from Dennis DT, Inglesby TV, Henderson DA, et al. Journal of the American Medical Association, June
More informationAppendix B: Provincial Case Definitions for Reportable Diseases
Infectious Diseases Protocol Appendix B: Provincial Case Definitions for Reportable Diseases Disease: Tularemia Revised Tularemia 1.0 Provincial Reporting Confirmed and probable cases of disease 2.0 Type
More informationCE Unit. Viruses and Vaccines
CE Unit Viruses and Vaccines DO NOT WRITE What is a virus? Have you ever had a virus? What is a vaccine? How is a virus different from bacteria? What are the deadliest viruses? 10. Dengue fever 50 million
More informationInfection, Detection, Prevention...
Infection, Detection, Prevention... A disease is any change that disrupts the normal function of one or more body systems. Non infectious diseases are typically caused by exposure to chemicals or are inherited.
More informationAdvisory on Plague WHAT IS PLAGUE? 19 October 2017
19 October 2017 Advisory on Plague WHAT IS PLAGUE? Plague is an infectious disease caused by the zoonotic bacteria, Yersinia pestis. This bacteria often infects small rodents (like rats, mice, and squirrels)
More informationImmunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel:
Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1 Realize the significance
More informationInfectious Diseases through Viruses. Obj. 3.c. & 3.g.
Infectious Diseases through Viruses Obj. 3.c. & 3.g. Diseases Caused By Cells A disease is a condition that stops the body from functioning normally. Non-infectious diseases are not spread from person
More informationVACCINATION. DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M.
VACCINATION DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M. IMMUNIZATION Immunization is defined as the procedure by which the body is prepared to fight against a specific disease. It is used to induce the
More informationGene Vaccine Dr. Sina Soleimani
Gene Vaccine Dr. Sina Soleimani Human Viral Vaccines Quality Control Laboratory (HVVQC) Titles 1. A short Introduction of Vaccine History 2. First Lineage of Vaccines 3. Second Lineage of Vaccines 3. New
More informationMMG 301 Lec. 35 Epidemiology and Bioterrorism
MMG 301 Lec. 35 Epidemiology and Bioterrorism Questions for Today: (consider Med Micro course) 1. What is epidemiology? 2. How is epidemiology important to public health? 3. What pathogens are important
More informationTrends in vaccinology
Trends in vaccinology Mathieu Peeters, MD Joint Conference of European Human Pharmacological Societies and Joint Conference of European Human Pharmacological Societies and 20th Anniversary of AGAH March
More informationBlood and Lymphatic Infections Lecture 24 Dr. Gary Mumaugh
Blood and Lymphatic Infections Lecture 24 Dr. Gary Mumaugh Subacute Bacterial Endocarditis o Marked fatigue and slight fever o Typically become ill gradually Slowly lose energy over a period of weeks or
More informationCE Unit 7. Viruses and Vaccines
CE Unit 7 Viruses and Vaccines DO NOT WRITE What is a virus? Have you ever had a virus? What is a vaccine? How is a virus different from bacteria? What are the deadliest viruses? 10. Dengue fever 50 million
More informationClass 9 th Why do we fall ill?
Class 9 th Why do we fall ill? Health: health is a state of physical, mental and social well being. The health of all individuals is dependent on their physical environment, social environment, and their
More informationViruses. Objectives At the end of this sub section students should be able to:
Name: 3.5 Responses to Stimuli Objectives At the end of this sub section students should be able to: 3.5.4 Viruses 1. Explain the problem of defining what a virus is - living or non-living? 2. show you
More informationDownloaded from
Class IX: Biology Chapter: Why do we fall ill Chapter Notes Key learnings: 1) Our body s well-being is dependent on the proper functioning of its cells and tissues. 2) All our body parts and activities
More informationAnnual Epidemiological Report
August 2018 Annual Epidemiological Report 1 Vectorborne disease in Ireland, 2017 Key Facts 2017: 10 cases of dengue were notified, corresponding to a crude incidence rate (CIR) of 0.2 per 100,000 population
More informationOPERATION ENDURING FREEDOM
OPERATION ENDURING FREEDOM Re-Deployment Medical Threat Briefing Name & Unit Prepared by: Office of the Surgeon USAREUR and Europe Regional Medical Command Office of Force Health Protection DSN (314) 370-5680/(314)371-2629
More informationTularemia IMMEDIATELY REPORTABLE DISEASE
Tularemia IMMEDIATELY REPORTABLE DISEASE Per N.J.A.C. 8:57, healthcare providers and administrators shall immediately report by telephone confirmed and suspected cases of tularemia to the health officer
More informationVaccine. Specific defenses Immunity. natural. acquired. Live vaccines. Killed Inactivated vaccines. Cellular fraction vaccines
Introduction Vaccine has been a importance medical breakthrough in preventing morbidity and mortality from infectious diseases worldwide. Vaccination has managed to eradicate the deadly and mutilating
More informationCopyright regulations Warning
COMMONWEALTH OF AUSTRALIA Copyright regulations 1969 Warning This material has been reproduced and communicated to you by or on behalf of the University of Melbourne pursuant to part VB of the Copyright
More informationBBS 2711 Virology. Virus Vaccines
BBS 2711 Virology Virus Vaccines Dr Paul Young, Department of Microbiology & Parasitology. p.young@mailbox.uq.edu.au Virus Vaccines First vaccine developed by Jenner in late 1700's against smallpox virus
More informationPathogens: Microorganisms that are capable of causing disease Infection: Results when a pathogen invades and begins growing within the host Disease:
Infectious Diseases Pathogens: Microorganisms that are capable of causing disease Infection: Results when a pathogen invades and begins growing within the host Disease: Results only if and when normal
More informationVaccines and other immunological antimicrobial therapy 1
Vaccines and other immunological antimicrobial therapy 1 Vaccines Vaccine: a biological preparation that provides active acquired immunity to a particular disease. Vaccine typically contains an agent that
More informationSurface Water Surveillance to Substantiate a Suspicion for Endemic Tularemia
Surface Water Surveillance to Substantiate a Suspicion for Endemic Tularemia Ingmar Janse, Rozemarijn van der Plaats (MLU-RIVM) Miriam Maas, Marieta Braks, Joke van der Giessen (D&V-RIVM) Jolianne Rijks
More informationCommunicable Diseases
Chapter 23 Communicable Diseases Disease that s spread from one living organism to another or through the environment Infection occurs when pathogens in the body multiply and damage body cells Main Pathogens
More informationVaccines. Vaccines ( continued 1) February 21, 2017 Department of Public Health Sciences
Infectious Disease Epidemiology BMTRY 713 (A. Selassie, DrPH) Lecture 11 Vaccines Past, Present, Future Learning Objectives 1. Identify the various types of vaccines 2. Describe the role of vaccine in
More informationStainless-steel vs Single-use: The Vaccines Perspective
Stainless-steel vs Single-use: The Vaccines Perspective CMO-Biomanufacturer Panel Tue 21 April, Noon-1:30pm, Exhibit Hall Daniel C.Vellom, PhD Sr. Director Global Technology Innovation 2015 INTERPHEX 1
More informationInfectious Disease. Unit 6 Lesson 1
Infectious Disease Unit 6 Lesson 1 Reminder Getting Started Pick up your Infectious Disease Notes Objectives Identify five types of infectious agents Describe ways in which infections can spread Explain
More informationThe Major Histocompatibility Complex (MHC)
The Major Histocompatibility Complex (MHC) An introduction to adaptive immune system before we discuss MHC B cells The main cells of adaptive immune system are: -B cells -T cells B cells: Recognize antigens
More informationOutline. Origin and Biogeography of Human Infectious Disease. Advantages of virulence. Diseases differ in virulence. Serial passage experiments
Outline Origin and Biogeography of Human Infectious Disease Alan R. Rogers Evolution of virulence (Ewald 1983) Origin of human infectious diseases (Wolfe et al 2007). Biogeography of human infectious diseases
More informationBurton's Microbiology for the Health Sciences
Burton's Microbiology for the Health Sciences Chapter 11. Epidemiology and Public Health Chapter 11 Outline Epidemiology Interactions Among Pathogens, Hosts and the Environment Chain of Infection Reservoirs
More informationViral Taxonomic Classification
Viruses Part I Viral Taxonomic Classification Order>> -virales Family>> - viridae Subfamily>> -virinae Genus>> -virus Species Order>> Picornavirales Family>> Picornaviridae Subfamily>> Picornavirinae Genus>>
More information(b) Describe the role of antigen presentation in the body s specific immune response to infection by viruses. (4)
1 The human body responds to infection by viruses in a number of ways. The non-specific response involves interferon. The specific immune response requires antigen presentation to the cells of the immune
More informationViral Genetics. BIT 220 Chapter 16
Viral Genetics BIT 220 Chapter 16 Details of the Virus Classified According to a. DNA or RNA b. Enveloped or Non-Enveloped c. Single-stranded or double-stranded Viruses contain only a few genes Reverse
More informationLinking Pandemic Influenza Preparedness with Bioterrorism Vaccination Planning
Linking Pandemic Influenza Preparedness with Bioterrorism Vaccination Planning APHA Annual Meeting San Francisco, California Lara Misegades, MS Director of Infectious Disease Policy November 18, 2003 Overview
More informationBiotechnology-Based Vaccines. Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel:
Biotechnology-Based Vaccines Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1.
More informationChapter 17. Infectious Diseases
Chapter 17 Infectious Diseases Lesson 1 What is an infectious disease? Infectious disease Is any disease that is caused by an agent that can be passed from one living thing to another. Disease causing
More informationChapters 21-26: Selected Viral Pathogens
Chapters 21-26: Selected Viral Pathogens 1. DNA Viral Pathogens 2. RNA Viral Pathogens 1. DNA Viral Pathogens Smallpox (pp. 623-4) Caused by variola virus (dsdna, enveloped): portal of entry is the respiratory
More informationFlu is a more severe form of what people generally associate with as Cough, Cold and Fever and symptoms are usually incapacitating.
SEASONAL HUMAN INFLUENZA (THE FLU) What is Seasonal Human Influenza? Seasonal Influenza is a viral infection that affects millions of people worldwide. It is transmitted from person to person through direct
More informationImmunity and how vaccines work
Immunity and how vaccines work Dr Mary O Meara National Immunisation Office Objectives of session An understanding of the following principles Overview of immunity Different types of vaccines and vaccine
More informationOPERATION IRAQI FREEDOM
Notes/Changes Briefer if service members are completing the health assessment through AKO you may hide/omit/modify slides 25 though 31. They are for use if the service member is filling out the hard copy
More information1/29/2013. Viruses and Bacteria. Infectious Disease. Pathogens cause disease by: Chapters 16 and 17
Viruses and Bacteria Chapters 16 and 17 Infectious Disease Caused by the invasion of a host by agents whose activities harm the host s tissues Can be transmitted to others Pathogen microorganisms that
More informationSanofi Pasteur: A partner in eradicating vaccine preventable diseases and improving access to vaccines
Sanofi Pasteur: A partner in eradicating vaccine preventable diseases and improving access to vaccines 1 Vaccines: the single most effective medical intervention 2 Vaccines save lives Millions of cases
More informationRESPIRATORY TRACT INFECTIONS. CLS 212: Medical Microbiology Zeina Alkudmani
RESPIRATORY TRACT INFECTIONS CLS 212: Medical Microbiology Zeina Alkudmani Lower Respiratory Tract Upper Respiratory Tract Anatomy of the Respiratory System Nasopharynx Oropharynx Respiratory Tract Infections
More informationEconomics of Vaccine Development A Vaccine Manufacturer s Perspective
Economics of Vaccine Development A Vaccine Manufacturer s Perspective Gerald Voss The Value of Vaccines 2 29 diseases are currently preventable by vaccination Global public health Cervical cancer 1 Diphtheria
More informationThe Science of Vaccines:
The Science of Vaccines: Addressing Common Concerns Paul A. Offit Division of Infectious Diseases Children s Hospital of Philadelphia Perelman School of Medicine The University of Pennsylvania Are vaccines
More informationMultiple Choice Questions
Multiple Choice Questions 1. Which one of the following is not a viral disease? (a) Dengue (b) AIDS (c) Typhoid (d) Influenza 2. Which one of the following is not a bacterial disease? (a) Cholera (b) Tuberculosis
More informationChapter 08 Lecture Outline
Chapter 08 Lecture Outline See separate PowerPoint slides for all figures and tables preinserted into PowerPoint without notes. Copyright 2016 McGraw-Hill Education. Permission required for reproduction
More informationCHAPTER ONE: EXECUTIVE SUMMARY. The Global Vaccine Industry CHAPTER TWO: INTRODUCTION TO VACCINES
CHAPTER ONE: EXECUTIVE SUMMARY The Global Vaccine Industry o Scope and Methodology o Overview o Pediatric Preventative Vaccines o The Market o Adult Preventative Vaccines o The Market o Total Market o
More informationScientific and Medical Differences of Category A Pathogens
Scientific and Medical Differences of Category A Pathogens Richard Gorman, M.D. Chair, Pediatric and Obstetrics Integrated Program Team HHS Office of the Assistant Secretary for Preparedness and Response
More informationStudy Guide 23, 24 & 47
Study Guide 23, 24 & 47 STUDY GUIDE SECTION 23-3 Bacteria and Humans Name Period Date 1. One bacterial disease that is transmitted by contaminated drinking water is a. Lyme disease b. gonorrhea c. tuberculosis
More informationNipah and Other Diseases Caused by Virus, Fungi & Bacteria - GK Notes
Nipah and Other Diseases Caused by Virus, Fungi & Bacteria - GK Notes The recent outbreak of Nipah Virus is spreading very fast getting highlights in current scenario. There are many Diseases which have
More informationOTHER COMMUNICABLE DISEASES. Sandra Pinzón and Diana Sánchez. Andalusian School of Public Health Gábor Ternák. University of Pécs
OTHER COMMUNICABLE DISEASES Sandra Pinzón and Diana Sánchez. Andalusian School of Public Health Gábor Ternák. University of Pécs Viral diseases Hepatitis A Hepatitis B Hepatitis C STI HIV Other viral diseases
More informationImmunology Project - by Nicola Heath
Part A - Pathogens Immunology Project - by Nicola Heath Pathogens are a biological agent that causes disease or illness to its host. We come in contact with pathogens everyday. Most of the time our body
More informationOverview Existing, Emerging, and Re-Emerging Communicable Diseases
Overview Existing, Emerging, and Re-Emerging Communicable Diseases Many communicable diseases have existed with us since the beginning of time. Communicable diseases, which are infections we catch from
More informationHow does the body defend itself?
Prevention of Infection 2 Immunisation 3 rd BDS B. Martin Major World Causes Of Death COUNTRIES Developing Developed Total x10-6 Population 5400 (80%) 1200 (20%) 6600 CAUSE OF DEATH % % % Infectious diseases
More informationAnnex 1. WHO Recommendations, Guidelines and other documents related to the manufacture and quality control of biological substances used in medicine
WHO related to the manufacture and quality control of biological substances used in medicine WHO are intended to provide guidance to those responsible for the production of biological substances as well
More informationThe Gram-negative coccobacilli Prof. dr hab. Beata M. Sobieszczańska Department of Microbiology University of Medicine
The Gram-negative coccobacilli Prof. dr hab. Beata M. Sobieszczańska Department of Microbiology University of Medicine The Gram-Negative Coccobacilli This group includes: Haemophilus Neisseria Bordetella
More informationBacterial Mechanisms of Pathogenicity
Bacterial Mechanisms of Pathogenicity 1 st Lecture Introduction Infection and Disease A. Definitions B. Generalized Stages of Infection C. Virulence Factors and Toxins A. Definitions Disease and Infectious
More informationName Date Class. The Immune System. In the space at the left, write the letter of the term or phrase that best answers each question.
Chapter Test A CHAPTER 37 The Immune System Part A: Multiple Choice In the space at the left, write the letter of the term or phrase that best answers each question 1 Which is an infectious disease? A
More informationThe Immune System: Your Defense Against Disease
The Immune System: Your Defense Against Disease Terms: Immune System: body s primary defense against disease-causing microorganisms. Immune: condition in which a body is able to permanently fight a disease.
More informationChapter 6: Fighting Disease
Chapter 6: Fighting Disease Lesson 1: Infectious Disease How Do Pathogens Cause Disease? Ancient times, people had different ideas about what caused disease. - Evil spirits - Swamp air - Imbalance of four
More informationLECTURE topics: 1. Immunology. 2. Emerging Pathogens
LECTURE 23 2 topics: 1. Immunology 2. Emerging Pathogens Benefits of the Normal Flora: 1. Protect us from colonization by other bacteria and fungi (competitive exclusion). 2. Many synthesize vitamins,
More informationImmunizations for Children and Teens with Suppressed Immune Systems
Immunizations for Children and Teens with Suppressed Immune Systems Your child is starting treatment that will suppress the immune system. This will affect how your child s body responds to routine immunizations
More informationCS/PoliSci/Statistics C79 Societal Risks & The Law
CS/PoliSci/Statistics C79 Societal Risks & The Law Nicholas P. Jewell Department of Statistics & School of Public Health (Biostatistics) University of California, Berkeley March 19, 2013 1 Nicholas P.
More informationHelminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii. Ringworm fungus HIV Influenza
Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii Ringworm fungus HIV Influenza Candida Staph aureus Mycobacterium tuberculosis Listeria Salmonella Streptococcus Levels
More information2/20/2019. The need for adult vaccinations. Update on Adult Immunizations. The Need for Adult Vaccinations. Objectives:
The need for adult vaccinations Update on Adult Immunizations Objectives: Recall the latest recommendations on adult vaccinations Detail the importance of adult vaccinations I m not a kid.. Why are you
More informationUnit 5: The Kingdoms of Life Module 12: Simple Organisms
Unit 5: The Kingdoms of Life Module 12: Simple Organisms NC Essential Standard: 1.2.3 Explain how specific cell adaptations help cells survive in particular environments 2.1.2 Analyze how various organisms
More informationCommunicable Diseases
Lesson 5.1 Communicable Diseases By Carone Fitness You have probably been in a situation similar to Corry's. The common cold is a communicable disease. 1 Defined Communicable diseases are illnesses that
More informationObjective 3 Viruses & Bacteria genetic material capsule Pili DNA
Objective 3 Viruses & Bacteria 1. Compare the structure and functions of viruses to cells and describe the role of viruses in causing diseases and conditions such as acquired immune deficiency syndrome,
More informationCNA Training Advisor
CNA Training Advisor Volume 11 Issue No. 8 August 2013 Vaccinations are an important part of being healthy, and they become even more important as we grow older. With age, the body s defenses against disease
More information4-3 Infection and Response Trilogy
4-3 Infection and Response Trilogy. Pathogens are disease-causing microorganisms. Draw one line from each disease to the correct disease-causing microorganism. [3 marks] Disease Measles Microorganism Virus
More informationUnit 4 Student Guided Notes
Structure of Viruses Discovery of the Virus Unit 4 Student Guided Notes Many human epidemics were well documented and observed in history, but. The following 3 discoveries shaped our knowledge of viruses
More informationUnit 5: The Kingdoms of Life Module 12: Simple Organisms
Unit 5: The Kingdoms of Life Module 12: Simple Organisms NC Essential Standard: 1.2.3 Explain how specific cell adaptations help cells survive in particular environments 2.1.2 Analyze how various organisms
More informationVIRUSES. Biology Applications Control. David R. Harper. Garland Science Taylor & Francis Group NEW YORK AND LONDON
VIRUSES Biology Applications Control David R. Harper GS Garland Science Taylor & Francis Group NEW YORK AND LONDON vii Chapter 1 Virus Structure and 2.2 VIRUS MORPHOLOGY 26 Infection 1 2.3 VIRAL CLASSIFICATION
More informationCONVENTIONAL VACCINE DEVELOPMENT
CONVENTIONAL VACCINE DEVELOPMENT PROBLEM Lethal germ Dead mouse LIVE VACCINES Related but harmless germ gives protection against lethal pathogen. Examples are the original pox vaccine and some TB vaccines
More informationFundamental Principles about Bioterrorism
Fundamental Principles about Bioterrorism The following discussion provides a useful framework for putting into perspective the enormous volume of information being disseminated regarding health and Bioterrorism.
More informationThe Struggle with Infectious Disease. Lecture 6
The Struggle with Infectious Disease Lecture 6 HIV/AIDS It is generally believed that: Human Immunodeficiency Virus --------- causes ------------- Acquired Immunodeficiency Syndrome History of HIV HIV
More informationUnderstanding and Confronting Emerging Disease
Understanding and Confronting Emerging Disease Michael J. Buchmeier, PhD. Professor, Departments of Molecular Biology and Biochemistry, and Div. of Infectious Disease, Department of Medicine, UCI Deputy
More informationThe Immune System and Pathology
The Immune System and Pathology The Immune System in Action When a mosquito bites When you breathe When you have allergies When you get a blood transfusion When you die...also called the Lymphatic System
More informationUnderstanding and Confronting Emerging Disease
Understanding and Confronting Emerging Disease Michael J. Buchmeier, PhD. Professor, Departments of Molecular Biology and Biochemistry, and Div. of Infectious Disease, Department of Medicine, UCI Deputy
More informationDEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report
DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report July 2016 Report Description Reportable Events among all beneficiaries received from the Services over the past 5 years are used to create ranges
More informationDEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report
DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report May 2016 Report Description Reportable Events among all beneficiaries received from the Services over the past 5 years are used to create ranges
More informationIntroduction. Infections acquired by travellers
Introduction The number of Australians who travel overseas has increased steadily over recent years and now between 3.5 and 4.5 million exits are made annually. Although many of these trips are to countries
More informationD-LAB HEALTH SP 725. Jose Gomez-Marquez
SP 725 Jose Gomez-Marquez 1 Vaccine Preventable Diseases Causes of 2.5 million child deaths out of 10.5 million child deaths globally, 2002 Source: WHO Wkly Epidemiol Rec. (2006) 81:189-196. 2 Rationale
More informationChapter 13. Preventing Infectious Diseases. Copyright by Holt, Rinehart and Winston. All rights reserved.
Preventing Infectious Diseases Preventing Infectious Diseases Contents Section 1 What Are Infectious Diseases? Section 2 Protecting Yourself from Infectious Diseases Section 3 Common Infectious Diseases
More informationTRAINER: Read this page ahead of time to prepare for teaching the module.
Module 2 Overview: Employee Illness TRAINER: Read this page ahead of time to prepare for teaching the module. PARTICIPANTS WILL: 1. Describe FOODBORNE ILLNESS symptoms. 2. Explain the difference between
More informationInfectious Diseases Weekly Report. 14 March 2013 / Number 10
Infectious Diseases Weekly Report TOKYOIDWR Tokyo Metropolitan Infectious Disease Surveillance Center 14 March / Number 10 Surveillance System in Tokyo, Japan The infectious diseases which all physicians
More informationCHILD HEALTH. There is a list of references at the end where you can find more information. FACT SHEETS
SOME 18,000 CHILDREN STILL DIE EVERY DAY FROM DISEASES THAT ARE MOSTLY PREVENTABLE. This fact sheet outlines some of the basic information related to the health and wellbeing of children under five years
More informationClue # 1: Before. After
Clue # 1: Bacteria can be divided into two groups (gram positive and gram negative) based on their appearance after iodine staining. This method was developed in 1884 (OVER 100 YEARS AGO) but is still
More informationSWABCHA Fact Sheet: Tuberculosis (TB)
SWABCHA (TB) Text sourced from the SWABCHA Change Agent Training Guide - 2012 Introduction to TB Microscopic bacteria called Mycobacterium tuberculosis causes TB Only TB of the lungs or throat may be infectious.
More informationPharmacologyonline 1: (2011) ewsletter Gaware et al. TULAREMIA A SERIOUS I FECTIOUS DISEASE: A REVIEW
TULAREMIA A SERIOUS I FECTIOUS DISEASE: A REVIEW Vinayak Gaware* 1, Kiran Kotade 2, Ramdas Dolas 3, Kiran Dhamak 1, Sachin Somwanshi 3, Vikrant Nikam 3, Atul Khadse 1, Vivekanand Kashid 3 1. Department
More informationImmune System. How your body goes to war to keep you well
Immune System How your body goes to war to keep you well WATCH OUT! Millions of bacteria and viruses are everywhere. Many aim to find a host and invade the body. HOW CAN WE DEFEND AGAINST IT? The Bad Guys
More informationYersinia pestis. Yersinia and plague. Dr. Hala Al Daghistani
Yersinia pestis Dr. Hala Al Daghistani Yersinia species Short, pleomorphic gram-negative rods that can exhibit bipolar staining. Catalase positive, and microaerophilic or facultatively anaerobic. Animals
More informationThank you for not chewing gum!
March 25 th, 2015 What do I need today? 1. Pencil 2. Science Notebook 3. Epidemiology note sheet Learning Target: Today we will continue to learn about the fascinating world of disease and epidemiology
More information