Vaccine Design: A Statisticans Overview

Size: px
Start display at page:

Download "Vaccine Design: A Statisticans Overview"

Transcription

1 GoBack

2 : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #1

3 The Chinese are credited with making the observation that deliberately infecting people with mild forms of smallpox could prevent infection with more deadly forms and provide life long protection. Introduction of first generation of vaccines for use in humans 1798 Smallpox 1926 Pertussis 1885 Rabies 1927 Tuberculosis (BCG) 1897 Plague 1923 Diphtheria 1927 Tetanus 1935 Yellow Fever Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #2

4 Live attenuated vaccines Inactivated or killed vaccines Recombinant sub-unit envelope vaccines Recombinant vectored vaccines DNA vaccines and replicons Involve HIV genetic sequences which, once injected, induce expression of HIV antigens by human cells. In the case of replicons, these sequences are wrapped in the outer coat of an unrelated virus. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #3

5 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #4

6 Major Histo Compatibility, also known as human leukocyte antigens or HLA Present on various human cells e.g. dendritic cells. Typically epitopes of length 9. MHC I animation MHC I movie 1 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #5

7 Mechanism different from MHC I. More complicated as the binding length may be more than 9. MHC II animation MHC II movie 2 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #6

8 Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #7

9 >A85A_MYCTU 48 GLPVEYLQV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85A_MYCTU 242 KLIANNTRV MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA >A85B_MYCTU 239 KLVANNTRL MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGR DIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYS DWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKL VANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG THSWEYWGAQLNAMKGDLQSSLGAG >ACTB_HUMAN 180 ALPHAILRL MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #8

10 MHC class I genes (HLA-A, HLA-B and HLA-C) MHC class II genes (HLA-DP, HLA-DQ and HLA-DR) Database ALPHAILRL Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #9

11 We want to classify the peptides into Binders and non Binders. Binders of specific HLA-super types. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #10

12 A supermotif is a motif which confers the ability to bind to several different HLA A supertype, the corresponding assembly of HLA As of October 2001, nine major HLA class I supertypes have been defined HLA-A1, A2, A3, A24 HLA-B7, B27, B44, B58, B62 e.g the 5 alleles belonging to HLA-A3 supertype: A*0301 A*1101 A*3101 A*3301 A*6801. Sette et al, Immunogenetics (1999) 50: Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #11

13 Mostly +ve examples. No good database of -ve examples. Include structural information of peptides in the classifier. In case of we do not know the position of binding. Supertypes are still being defined. Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #12

14 British: Tularaemia Pathogen: Francisella tularensis Infects small mammals ground squirrels, rabbits, hares, voles, muskrats, water rats and other rodents Arthropod vectors: ticks, biting flies, mosquitoes Uncommon zoonosis 125 cases/year in USA farmers, hunters, walkers, forest workers kills less than 50 people a year worldwide Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #13

15 Why is it important. Tested by Japan in WWII as potential bioweapon Weaponised and stockpiled by USA and USSR during Cold War Highly infectious: inhalation of 10 bacteria can cause disease Avenues: ingestion (water and food), inhalation, direct contact, arthropod intermediates, animal bites No person to person spread Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #14

16 Ulceroglandular Incubation period 3-6 days Sudden onset flu like symptoms Ulcer at site of infection Enlargement of draining nodes Typhoidal syndrome: septicemia without ulcer or lymphadenopathy Oropharyngeal: sore throat, enlarged tonsils, yellow-white pseudomembrane Gastrointestinal: persistent diarrhea, bowel ulceration - acute fatal disease Pneumonia Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #15

17 A World Health Organization model for a sizeable tularemia release over a metropolitan area with 5 million inhabitants predicted 250,000 people incapacitated and 19,000 deaths, Dennis cited. With antibiotic treatment, tularemia mortality rate is under 10treatment. Work in Progress... Slides produced with HA-prosper latex package Surajit Ray Samsi PostDoc Seminar: Nov 2: slide #16

Vaccine Design: A Statisticans Overview

Vaccine Design: A Statisticans Overview GoBack : A Statisticans Overview. Surajit Ray sray@samsi.info Surajit Ray Samsi PostDoc Seminar: Nov 2: 2004 - slide #1 The Chinese are credited with making the observation that deliberately infecting

More information

Francisella tularensis. Patricia Bolivar MS., CLS, PHM

Francisella tularensis. Patricia Bolivar MS., CLS, PHM Francisella tularensis Patricia Bolivar MS., CLS, PHM Case A 42 year old male hunter presents with a painful, purulent conjunctivitis. Ulcerations were present on the conjunctiva. Cervical lymphadenopathy

More information

By:Reham Alahmadi NOV The production of antibodies and vaccination technology

By:Reham Alahmadi NOV The production of antibodies and vaccination technology By:Reham Alahmadi NOV 2018 The production of antibodies and vaccination technology Antibody Production The blood contains two types of white blood cell or leukocyte Phagocytes ingest bacteria by endocytosis

More information

Acute respiratory illness This is a disease that typically affects the airways in the nose and throat (the upper respiratory tract).

Acute respiratory illness This is a disease that typically affects the airways in the nose and throat (the upper respiratory tract). Influenza glossary Adapted from the Centers for Disease Control and Prevention, US https://www.cdc.gov/flu/glossary/index.htm and the World Health Organization http://www.wpro.who.int/emerging_diseases/glossary_rev_sept28.pdf?ua=1

More information

July 1, 2005 Page 1 of 5

July 1, 2005 Page 1 of 5 Abstract: Consensus Statement: Tularemia as a Biological Weapon: Medical and Public Health Abstracted from Dennis DT, Inglesby TV, Henderson DA, et al. Journal of the American Medical Association, June

More information

Appendix B: Provincial Case Definitions for Reportable Diseases

Appendix B: Provincial Case Definitions for Reportable Diseases Infectious Diseases Protocol Appendix B: Provincial Case Definitions for Reportable Diseases Disease: Tularemia Revised Tularemia 1.0 Provincial Reporting Confirmed and probable cases of disease 2.0 Type

More information

CE Unit. Viruses and Vaccines

CE Unit. Viruses and Vaccines CE Unit Viruses and Vaccines DO NOT WRITE What is a virus? Have you ever had a virus? What is a vaccine? How is a virus different from bacteria? What are the deadliest viruses? 10. Dengue fever 50 million

More information

Infection, Detection, Prevention...

Infection, Detection, Prevention... Infection, Detection, Prevention... A disease is any change that disrupts the normal function of one or more body systems. Non infectious diseases are typically caused by exposure to chemicals or are inherited.

More information

Advisory on Plague WHAT IS PLAGUE? 19 October 2017

Advisory on Plague WHAT IS PLAGUE? 19 October 2017 19 October 2017 Advisory on Plague WHAT IS PLAGUE? Plague is an infectious disease caused by the zoonotic bacteria, Yersinia pestis. This bacteria often infects small rodents (like rats, mice, and squirrels)

More information

Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel:

Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel: Immunization (I) Dr. Aws Alshamsan Department of Pharmaceu5cs Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1 Realize the significance

More information

Infectious Diseases through Viruses. Obj. 3.c. & 3.g.

Infectious Diseases through Viruses. Obj. 3.c. & 3.g. Infectious Diseases through Viruses Obj. 3.c. & 3.g. Diseases Caused By Cells A disease is a condition that stops the body from functioning normally. Non-infectious diseases are not spread from person

More information

VACCINATION. DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M.

VACCINATION. DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M. VACCINATION DR.FATIMA ALKHALEDY M.B.Ch.B;F.I.C.M.S/C.M. IMMUNIZATION Immunization is defined as the procedure by which the body is prepared to fight against a specific disease. It is used to induce the

More information

Gene Vaccine Dr. Sina Soleimani

Gene Vaccine Dr. Sina Soleimani Gene Vaccine Dr. Sina Soleimani Human Viral Vaccines Quality Control Laboratory (HVVQC) Titles 1. A short Introduction of Vaccine History 2. First Lineage of Vaccines 3. Second Lineage of Vaccines 3. New

More information

MMG 301 Lec. 35 Epidemiology and Bioterrorism

MMG 301 Lec. 35 Epidemiology and Bioterrorism MMG 301 Lec. 35 Epidemiology and Bioterrorism Questions for Today: (consider Med Micro course) 1. What is epidemiology? 2. How is epidemiology important to public health? 3. What pathogens are important

More information

Trends in vaccinology

Trends in vaccinology Trends in vaccinology Mathieu Peeters, MD Joint Conference of European Human Pharmacological Societies and Joint Conference of European Human Pharmacological Societies and 20th Anniversary of AGAH March

More information

Blood and Lymphatic Infections Lecture 24 Dr. Gary Mumaugh

Blood and Lymphatic Infections Lecture 24 Dr. Gary Mumaugh Blood and Lymphatic Infections Lecture 24 Dr. Gary Mumaugh Subacute Bacterial Endocarditis o Marked fatigue and slight fever o Typically become ill gradually Slowly lose energy over a period of weeks or

More information

CE Unit 7. Viruses and Vaccines

CE Unit 7. Viruses and Vaccines CE Unit 7 Viruses and Vaccines DO NOT WRITE What is a virus? Have you ever had a virus? What is a vaccine? How is a virus different from bacteria? What are the deadliest viruses? 10. Dengue fever 50 million

More information

Class 9 th Why do we fall ill?

Class 9 th Why do we fall ill? Class 9 th Why do we fall ill? Health: health is a state of physical, mental and social well being. The health of all individuals is dependent on their physical environment, social environment, and their

More information

Viruses. Objectives At the end of this sub section students should be able to:

Viruses. Objectives At the end of this sub section students should be able to: Name: 3.5 Responses to Stimuli Objectives At the end of this sub section students should be able to: 3.5.4 Viruses 1. Explain the problem of defining what a virus is - living or non-living? 2. show you

More information

Downloaded from

Downloaded from Class IX: Biology Chapter: Why do we fall ill Chapter Notes Key learnings: 1) Our body s well-being is dependent on the proper functioning of its cells and tissues. 2) All our body parts and activities

More information

Annual Epidemiological Report

Annual Epidemiological Report August 2018 Annual Epidemiological Report 1 Vectorborne disease in Ireland, 2017 Key Facts 2017: 10 cases of dengue were notified, corresponding to a crude incidence rate (CIR) of 0.2 per 100,000 population

More information

OPERATION ENDURING FREEDOM

OPERATION ENDURING FREEDOM OPERATION ENDURING FREEDOM Re-Deployment Medical Threat Briefing Name & Unit Prepared by: Office of the Surgeon USAREUR and Europe Regional Medical Command Office of Force Health Protection DSN (314) 370-5680/(314)371-2629

More information

Tularemia IMMEDIATELY REPORTABLE DISEASE

Tularemia IMMEDIATELY REPORTABLE DISEASE Tularemia IMMEDIATELY REPORTABLE DISEASE Per N.J.A.C. 8:57, healthcare providers and administrators shall immediately report by telephone confirmed and suspected cases of tularemia to the health officer

More information

Vaccine. Specific defenses Immunity. natural. acquired. Live vaccines. Killed Inactivated vaccines. Cellular fraction vaccines

Vaccine. Specific defenses Immunity. natural. acquired. Live vaccines. Killed Inactivated vaccines. Cellular fraction vaccines Introduction Vaccine has been a importance medical breakthrough in preventing morbidity and mortality from infectious diseases worldwide. Vaccination has managed to eradicate the deadly and mutilating

More information

Copyright regulations Warning

Copyright regulations Warning COMMONWEALTH OF AUSTRALIA Copyright regulations 1969 Warning This material has been reproduced and communicated to you by or on behalf of the University of Melbourne pursuant to part VB of the Copyright

More information

BBS 2711 Virology. Virus Vaccines

BBS 2711 Virology. Virus Vaccines BBS 2711 Virology Virus Vaccines Dr Paul Young, Department of Microbiology & Parasitology. p.young@mailbox.uq.edu.au Virus Vaccines First vaccine developed by Jenner in late 1700's against smallpox virus

More information

Pathogens: Microorganisms that are capable of causing disease Infection: Results when a pathogen invades and begins growing within the host Disease:

Pathogens: Microorganisms that are capable of causing disease Infection: Results when a pathogen invades and begins growing within the host Disease: Infectious Diseases Pathogens: Microorganisms that are capable of causing disease Infection: Results when a pathogen invades and begins growing within the host Disease: Results only if and when normal

More information

Vaccines and other immunological antimicrobial therapy 1

Vaccines and other immunological antimicrobial therapy 1 Vaccines and other immunological antimicrobial therapy 1 Vaccines Vaccine: a biological preparation that provides active acquired immunity to a particular disease. Vaccine typically contains an agent that

More information

Surface Water Surveillance to Substantiate a Suspicion for Endemic Tularemia

Surface Water Surveillance to Substantiate a Suspicion for Endemic Tularemia Surface Water Surveillance to Substantiate a Suspicion for Endemic Tularemia Ingmar Janse, Rozemarijn van der Plaats (MLU-RIVM) Miriam Maas, Marieta Braks, Joke van der Giessen (D&V-RIVM) Jolianne Rijks

More information

Communicable Diseases

Communicable Diseases Chapter 23 Communicable Diseases Disease that s spread from one living organism to another or through the environment Infection occurs when pathogens in the body multiply and damage body cells Main Pathogens

More information

Vaccines. Vaccines ( continued 1) February 21, 2017 Department of Public Health Sciences

Vaccines. Vaccines ( continued 1) February 21, 2017 Department of Public Health Sciences Infectious Disease Epidemiology BMTRY 713 (A. Selassie, DrPH) Lecture 11 Vaccines Past, Present, Future Learning Objectives 1. Identify the various types of vaccines 2. Describe the role of vaccine in

More information

Stainless-steel vs Single-use: The Vaccines Perspective

Stainless-steel vs Single-use: The Vaccines Perspective Stainless-steel vs Single-use: The Vaccines Perspective CMO-Biomanufacturer Panel Tue 21 April, Noon-1:30pm, Exhibit Hall Daniel C.Vellom, PhD Sr. Director Global Technology Innovation 2015 INTERPHEX 1

More information

Infectious Disease. Unit 6 Lesson 1

Infectious Disease. Unit 6 Lesson 1 Infectious Disease Unit 6 Lesson 1 Reminder Getting Started Pick up your Infectious Disease Notes Objectives Identify five types of infectious agents Describe ways in which infections can spread Explain

More information

The Major Histocompatibility Complex (MHC)

The Major Histocompatibility Complex (MHC) The Major Histocompatibility Complex (MHC) An introduction to adaptive immune system before we discuss MHC B cells The main cells of adaptive immune system are: -B cells -T cells B cells: Recognize antigens

More information

Outline. Origin and Biogeography of Human Infectious Disease. Advantages of virulence. Diseases differ in virulence. Serial passage experiments

Outline. Origin and Biogeography of Human Infectious Disease. Advantages of virulence. Diseases differ in virulence. Serial passage experiments Outline Origin and Biogeography of Human Infectious Disease Alan R. Rogers Evolution of virulence (Ewald 1983) Origin of human infectious diseases (Wolfe et al 2007). Biogeography of human infectious diseases

More information

Burton's Microbiology for the Health Sciences

Burton's Microbiology for the Health Sciences Burton's Microbiology for the Health Sciences Chapter 11. Epidemiology and Public Health Chapter 11 Outline Epidemiology Interactions Among Pathogens, Hosts and the Environment Chain of Infection Reservoirs

More information

Viral Taxonomic Classification

Viral Taxonomic Classification Viruses Part I Viral Taxonomic Classification Order>> -virales Family>> - viridae Subfamily>> -virinae Genus>> -virus Species Order>> Picornavirales Family>> Picornaviridae Subfamily>> Picornavirinae Genus>>

More information

(b) Describe the role of antigen presentation in the body s specific immune response to infection by viruses. (4)

(b) Describe the role of antigen presentation in the body s specific immune response to infection by viruses. (4) 1 The human body responds to infection by viruses in a number of ways. The non-specific response involves interferon. The specific immune response requires antigen presentation to the cells of the immune

More information

Viral Genetics. BIT 220 Chapter 16

Viral Genetics. BIT 220 Chapter 16 Viral Genetics BIT 220 Chapter 16 Details of the Virus Classified According to a. DNA or RNA b. Enveloped or Non-Enveloped c. Single-stranded or double-stranded Viruses contain only a few genes Reverse

More information

Linking Pandemic Influenza Preparedness with Bioterrorism Vaccination Planning

Linking Pandemic Influenza Preparedness with Bioterrorism Vaccination Planning Linking Pandemic Influenza Preparedness with Bioterrorism Vaccination Planning APHA Annual Meeting San Francisco, California Lara Misegades, MS Director of Infectious Disease Policy November 18, 2003 Overview

More information

Biotechnology-Based Vaccines. Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel:

Biotechnology-Based Vaccines. Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel: Biotechnology-Based Vaccines Dr. Aws Alshamsan Department of Pharmaceutics Office: AA87 Tel: 4677363 aalshamsan@ksu.edu.sa Objectives of this lecture By the end of this lecture you will be able to: 1.

More information

Chapter 17. Infectious Diseases

Chapter 17. Infectious Diseases Chapter 17 Infectious Diseases Lesson 1 What is an infectious disease? Infectious disease Is any disease that is caused by an agent that can be passed from one living thing to another. Disease causing

More information

Chapters 21-26: Selected Viral Pathogens

Chapters 21-26: Selected Viral Pathogens Chapters 21-26: Selected Viral Pathogens 1. DNA Viral Pathogens 2. RNA Viral Pathogens 1. DNA Viral Pathogens Smallpox (pp. 623-4) Caused by variola virus (dsdna, enveloped): portal of entry is the respiratory

More information

Flu is a more severe form of what people generally associate with as Cough, Cold and Fever and symptoms are usually incapacitating.

Flu is a more severe form of what people generally associate with as Cough, Cold and Fever and symptoms are usually incapacitating. SEASONAL HUMAN INFLUENZA (THE FLU) What is Seasonal Human Influenza? Seasonal Influenza is a viral infection that affects millions of people worldwide. It is transmitted from person to person through direct

More information

Immunity and how vaccines work

Immunity and how vaccines work Immunity and how vaccines work Dr Mary O Meara National Immunisation Office Objectives of session An understanding of the following principles Overview of immunity Different types of vaccines and vaccine

More information

OPERATION IRAQI FREEDOM

OPERATION IRAQI FREEDOM Notes/Changes Briefer if service members are completing the health assessment through AKO you may hide/omit/modify slides 25 though 31. They are for use if the service member is filling out the hard copy

More information

1/29/2013. Viruses and Bacteria. Infectious Disease. Pathogens cause disease by: Chapters 16 and 17

1/29/2013. Viruses and Bacteria. Infectious Disease. Pathogens cause disease by: Chapters 16 and 17 Viruses and Bacteria Chapters 16 and 17 Infectious Disease Caused by the invasion of a host by agents whose activities harm the host s tissues Can be transmitted to others Pathogen microorganisms that

More information

Sanofi Pasteur: A partner in eradicating vaccine preventable diseases and improving access to vaccines

Sanofi Pasteur: A partner in eradicating vaccine preventable diseases and improving access to vaccines Sanofi Pasteur: A partner in eradicating vaccine preventable diseases and improving access to vaccines 1 Vaccines: the single most effective medical intervention 2 Vaccines save lives Millions of cases

More information

RESPIRATORY TRACT INFECTIONS. CLS 212: Medical Microbiology Zeina Alkudmani

RESPIRATORY TRACT INFECTIONS. CLS 212: Medical Microbiology Zeina Alkudmani RESPIRATORY TRACT INFECTIONS CLS 212: Medical Microbiology Zeina Alkudmani Lower Respiratory Tract Upper Respiratory Tract Anatomy of the Respiratory System Nasopharynx Oropharynx Respiratory Tract Infections

More information

Economics of Vaccine Development A Vaccine Manufacturer s Perspective

Economics of Vaccine Development A Vaccine Manufacturer s Perspective Economics of Vaccine Development A Vaccine Manufacturer s Perspective Gerald Voss The Value of Vaccines 2 29 diseases are currently preventable by vaccination Global public health Cervical cancer 1 Diphtheria

More information

The Science of Vaccines:

The Science of Vaccines: The Science of Vaccines: Addressing Common Concerns Paul A. Offit Division of Infectious Diseases Children s Hospital of Philadelphia Perelman School of Medicine The University of Pennsylvania Are vaccines

More information

Multiple Choice Questions

Multiple Choice Questions Multiple Choice Questions 1. Which one of the following is not a viral disease? (a) Dengue (b) AIDS (c) Typhoid (d) Influenza 2. Which one of the following is not a bacterial disease? (a) Cholera (b) Tuberculosis

More information

Chapter 08 Lecture Outline

Chapter 08 Lecture Outline Chapter 08 Lecture Outline See separate PowerPoint slides for all figures and tables preinserted into PowerPoint without notes. Copyright 2016 McGraw-Hill Education. Permission required for reproduction

More information

CHAPTER ONE: EXECUTIVE SUMMARY. The Global Vaccine Industry CHAPTER TWO: INTRODUCTION TO VACCINES

CHAPTER ONE: EXECUTIVE SUMMARY. The Global Vaccine Industry CHAPTER TWO: INTRODUCTION TO VACCINES CHAPTER ONE: EXECUTIVE SUMMARY The Global Vaccine Industry o Scope and Methodology o Overview o Pediatric Preventative Vaccines o The Market o Adult Preventative Vaccines o The Market o Total Market o

More information

Scientific and Medical Differences of Category A Pathogens

Scientific and Medical Differences of Category A Pathogens Scientific and Medical Differences of Category A Pathogens Richard Gorman, M.D. Chair, Pediatric and Obstetrics Integrated Program Team HHS Office of the Assistant Secretary for Preparedness and Response

More information

Study Guide 23, 24 & 47

Study Guide 23, 24 & 47 Study Guide 23, 24 & 47 STUDY GUIDE SECTION 23-3 Bacteria and Humans Name Period Date 1. One bacterial disease that is transmitted by contaminated drinking water is a. Lyme disease b. gonorrhea c. tuberculosis

More information

Nipah and Other Diseases Caused by Virus, Fungi & Bacteria - GK Notes

Nipah and Other Diseases Caused by Virus, Fungi & Bacteria - GK Notes Nipah and Other Diseases Caused by Virus, Fungi & Bacteria - GK Notes The recent outbreak of Nipah Virus is spreading very fast getting highlights in current scenario. There are many Diseases which have

More information

OTHER COMMUNICABLE DISEASES. Sandra Pinzón and Diana Sánchez. Andalusian School of Public Health Gábor Ternák. University of Pécs

OTHER COMMUNICABLE DISEASES. Sandra Pinzón and Diana Sánchez. Andalusian School of Public Health Gábor Ternák. University of Pécs OTHER COMMUNICABLE DISEASES Sandra Pinzón and Diana Sánchez. Andalusian School of Public Health Gábor Ternák. University of Pécs Viral diseases Hepatitis A Hepatitis B Hepatitis C STI HIV Other viral diseases

More information

Immunology Project - by Nicola Heath

Immunology Project - by Nicola Heath Part A - Pathogens Immunology Project - by Nicola Heath Pathogens are a biological agent that causes disease or illness to its host. We come in contact with pathogens everyday. Most of the time our body

More information

Overview Existing, Emerging, and Re-Emerging Communicable Diseases

Overview Existing, Emerging, and Re-Emerging Communicable Diseases Overview Existing, Emerging, and Re-Emerging Communicable Diseases Many communicable diseases have existed with us since the beginning of time. Communicable diseases, which are infections we catch from

More information

How does the body defend itself?

How does the body defend itself? Prevention of Infection 2 Immunisation 3 rd BDS B. Martin Major World Causes Of Death COUNTRIES Developing Developed Total x10-6 Population 5400 (80%) 1200 (20%) 6600 CAUSE OF DEATH % % % Infectious diseases

More information

Annex 1. WHO Recommendations, Guidelines and other documents related to the manufacture and quality control of biological substances used in medicine

Annex 1. WHO Recommendations, Guidelines and other documents related to the manufacture and quality control of biological substances used in medicine WHO related to the manufacture and quality control of biological substances used in medicine WHO are intended to provide guidance to those responsible for the production of biological substances as well

More information

The Gram-negative coccobacilli Prof. dr hab. Beata M. Sobieszczańska Department of Microbiology University of Medicine

The Gram-negative coccobacilli Prof. dr hab. Beata M. Sobieszczańska Department of Microbiology University of Medicine The Gram-negative coccobacilli Prof. dr hab. Beata M. Sobieszczańska Department of Microbiology University of Medicine The Gram-Negative Coccobacilli This group includes: Haemophilus Neisseria Bordetella

More information

Bacterial Mechanisms of Pathogenicity

Bacterial Mechanisms of Pathogenicity Bacterial Mechanisms of Pathogenicity 1 st Lecture Introduction Infection and Disease A. Definitions B. Generalized Stages of Infection C. Virulence Factors and Toxins A. Definitions Disease and Infectious

More information

Name Date Class. The Immune System. In the space at the left, write the letter of the term or phrase that best answers each question.

Name Date Class. The Immune System. In the space at the left, write the letter of the term or phrase that best answers each question. Chapter Test A CHAPTER 37 The Immune System Part A: Multiple Choice In the space at the left, write the letter of the term or phrase that best answers each question 1 Which is an infectious disease? A

More information

The Immune System: Your Defense Against Disease

The Immune System: Your Defense Against Disease The Immune System: Your Defense Against Disease Terms: Immune System: body s primary defense against disease-causing microorganisms. Immune: condition in which a body is able to permanently fight a disease.

More information

Chapter 6: Fighting Disease

Chapter 6: Fighting Disease Chapter 6: Fighting Disease Lesson 1: Infectious Disease How Do Pathogens Cause Disease? Ancient times, people had different ideas about what caused disease. - Evil spirits - Swamp air - Imbalance of four

More information

LECTURE topics: 1. Immunology. 2. Emerging Pathogens

LECTURE topics: 1. Immunology. 2. Emerging Pathogens LECTURE 23 2 topics: 1. Immunology 2. Emerging Pathogens Benefits of the Normal Flora: 1. Protect us from colonization by other bacteria and fungi (competitive exclusion). 2. Many synthesize vitamins,

More information

Immunizations for Children and Teens with Suppressed Immune Systems

Immunizations for Children and Teens with Suppressed Immune Systems Immunizations for Children and Teens with Suppressed Immune Systems Your child is starting treatment that will suppress the immune system. This will affect how your child s body responds to routine immunizations

More information

CS/PoliSci/Statistics C79 Societal Risks & The Law

CS/PoliSci/Statistics C79 Societal Risks & The Law CS/PoliSci/Statistics C79 Societal Risks & The Law Nicholas P. Jewell Department of Statistics & School of Public Health (Biostatistics) University of California, Berkeley March 19, 2013 1 Nicholas P.

More information

Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii. Ringworm fungus HIV Influenza

Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii. Ringworm fungus HIV Influenza Helminth worm, Schistosomiasis Trypanosomes, sleeping sickness Pneumocystis carinii Ringworm fungus HIV Influenza Candida Staph aureus Mycobacterium tuberculosis Listeria Salmonella Streptococcus Levels

More information

2/20/2019. The need for adult vaccinations. Update on Adult Immunizations. The Need for Adult Vaccinations. Objectives:

2/20/2019. The need for adult vaccinations. Update on Adult Immunizations. The Need for Adult Vaccinations. Objectives: The need for adult vaccinations Update on Adult Immunizations Objectives: Recall the latest recommendations on adult vaccinations Detail the importance of adult vaccinations I m not a kid.. Why are you

More information

Unit 5: The Kingdoms of Life Module 12: Simple Organisms

Unit 5: The Kingdoms of Life Module 12: Simple Organisms Unit 5: The Kingdoms of Life Module 12: Simple Organisms NC Essential Standard: 1.2.3 Explain how specific cell adaptations help cells survive in particular environments 2.1.2 Analyze how various organisms

More information

Communicable Diseases

Communicable Diseases Lesson 5.1 Communicable Diseases By Carone Fitness You have probably been in a situation similar to Corry's. The common cold is a communicable disease. 1 Defined Communicable diseases are illnesses that

More information

Objective 3 Viruses & Bacteria genetic material capsule Pili DNA

Objective 3 Viruses & Bacteria genetic material capsule Pili DNA Objective 3 Viruses & Bacteria 1. Compare the structure and functions of viruses to cells and describe the role of viruses in causing diseases and conditions such as acquired immune deficiency syndrome,

More information

CNA Training Advisor

CNA Training Advisor CNA Training Advisor Volume 11 Issue No. 8 August 2013 Vaccinations are an important part of being healthy, and they become even more important as we grow older. With age, the body s defenses against disease

More information

4-3 Infection and Response Trilogy

4-3 Infection and Response Trilogy 4-3 Infection and Response Trilogy. Pathogens are disease-causing microorganisms. Draw one line from each disease to the correct disease-causing microorganism. [3 marks] Disease Measles Microorganism Virus

More information

Unit 4 Student Guided Notes

Unit 4 Student Guided Notes Structure of Viruses Discovery of the Virus Unit 4 Student Guided Notes Many human epidemics were well documented and observed in history, but. The following 3 discoveries shaped our knowledge of viruses

More information

Unit 5: The Kingdoms of Life Module 12: Simple Organisms

Unit 5: The Kingdoms of Life Module 12: Simple Organisms Unit 5: The Kingdoms of Life Module 12: Simple Organisms NC Essential Standard: 1.2.3 Explain how specific cell adaptations help cells survive in particular environments 2.1.2 Analyze how various organisms

More information

VIRUSES. Biology Applications Control. David R. Harper. Garland Science Taylor & Francis Group NEW YORK AND LONDON

VIRUSES. Biology Applications Control. David R. Harper. Garland Science Taylor & Francis Group NEW YORK AND LONDON VIRUSES Biology Applications Control David R. Harper GS Garland Science Taylor & Francis Group NEW YORK AND LONDON vii Chapter 1 Virus Structure and 2.2 VIRUS MORPHOLOGY 26 Infection 1 2.3 VIRAL CLASSIFICATION

More information

CONVENTIONAL VACCINE DEVELOPMENT

CONVENTIONAL VACCINE DEVELOPMENT CONVENTIONAL VACCINE DEVELOPMENT PROBLEM Lethal germ Dead mouse LIVE VACCINES Related but harmless germ gives protection against lethal pathogen. Examples are the original pox vaccine and some TB vaccines

More information

Fundamental Principles about Bioterrorism

Fundamental Principles about Bioterrorism Fundamental Principles about Bioterrorism The following discussion provides a useful framework for putting into perspective the enormous volume of information being disseminated regarding health and Bioterrorism.

More information

The Struggle with Infectious Disease. Lecture 6

The Struggle with Infectious Disease. Lecture 6 The Struggle with Infectious Disease Lecture 6 HIV/AIDS It is generally believed that: Human Immunodeficiency Virus --------- causes ------------- Acquired Immunodeficiency Syndrome History of HIV HIV

More information

Understanding and Confronting Emerging Disease

Understanding and Confronting Emerging Disease Understanding and Confronting Emerging Disease Michael J. Buchmeier, PhD. Professor, Departments of Molecular Biology and Biochemistry, and Div. of Infectious Disease, Department of Medicine, UCI Deputy

More information

The Immune System and Pathology

The Immune System and Pathology The Immune System and Pathology The Immune System in Action When a mosquito bites When you breathe When you have allergies When you get a blood transfusion When you die...also called the Lymphatic System

More information

Understanding and Confronting Emerging Disease

Understanding and Confronting Emerging Disease Understanding and Confronting Emerging Disease Michael J. Buchmeier, PhD. Professor, Departments of Molecular Biology and Biochemistry, and Div. of Infectious Disease, Department of Medicine, UCI Deputy

More information

DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report

DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report July 2016 Report Description Reportable Events among all beneficiaries received from the Services over the past 5 years are used to create ranges

More information

DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report

DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report DEPARTMENT OF DEFENSE AFHSB Reportable Events Monthly Report May 2016 Report Description Reportable Events among all beneficiaries received from the Services over the past 5 years are used to create ranges

More information

Introduction. Infections acquired by travellers

Introduction. Infections acquired by travellers Introduction The number of Australians who travel overseas has increased steadily over recent years and now between 3.5 and 4.5 million exits are made annually. Although many of these trips are to countries

More information

D-LAB HEALTH SP 725. Jose Gomez-Marquez

D-LAB HEALTH SP 725. Jose Gomez-Marquez SP 725 Jose Gomez-Marquez 1 Vaccine Preventable Diseases Causes of 2.5 million child deaths out of 10.5 million child deaths globally, 2002 Source: WHO Wkly Epidemiol Rec. (2006) 81:189-196. 2 Rationale

More information

Chapter 13. Preventing Infectious Diseases. Copyright by Holt, Rinehart and Winston. All rights reserved.

Chapter 13. Preventing Infectious Diseases. Copyright by Holt, Rinehart and Winston. All rights reserved. Preventing Infectious Diseases Preventing Infectious Diseases Contents Section 1 What Are Infectious Diseases? Section 2 Protecting Yourself from Infectious Diseases Section 3 Common Infectious Diseases

More information

TRAINER: Read this page ahead of time to prepare for teaching the module.

TRAINER: Read this page ahead of time to prepare for teaching the module. Module 2 Overview: Employee Illness TRAINER: Read this page ahead of time to prepare for teaching the module. PARTICIPANTS WILL: 1. Describe FOODBORNE ILLNESS symptoms. 2. Explain the difference between

More information

Infectious Diseases Weekly Report. 14 March 2013 / Number 10

Infectious Diseases Weekly Report. 14 March 2013 / Number 10 Infectious Diseases Weekly Report TOKYOIDWR Tokyo Metropolitan Infectious Disease Surveillance Center 14 March / Number 10 Surveillance System in Tokyo, Japan The infectious diseases which all physicians

More information

CHILD HEALTH. There is a list of references at the end where you can find more information. FACT SHEETS

CHILD HEALTH. There is a list of references at the end where you can find more information. FACT SHEETS SOME 18,000 CHILDREN STILL DIE EVERY DAY FROM DISEASES THAT ARE MOSTLY PREVENTABLE. This fact sheet outlines some of the basic information related to the health and wellbeing of children under five years

More information

Clue # 1: Before. After

Clue # 1: Before. After Clue # 1: Bacteria can be divided into two groups (gram positive and gram negative) based on their appearance after iodine staining. This method was developed in 1884 (OVER 100 YEARS AGO) but is still

More information

SWABCHA Fact Sheet: Tuberculosis (TB)

SWABCHA Fact Sheet: Tuberculosis (TB) SWABCHA (TB) Text sourced from the SWABCHA Change Agent Training Guide - 2012 Introduction to TB Microscopic bacteria called Mycobacterium tuberculosis causes TB Only TB of the lungs or throat may be infectious.

More information

Pharmacologyonline 1: (2011) ewsletter Gaware et al. TULAREMIA A SERIOUS I FECTIOUS DISEASE: A REVIEW

Pharmacologyonline 1: (2011) ewsletter Gaware et al. TULAREMIA A SERIOUS I FECTIOUS DISEASE: A REVIEW TULAREMIA A SERIOUS I FECTIOUS DISEASE: A REVIEW Vinayak Gaware* 1, Kiran Kotade 2, Ramdas Dolas 3, Kiran Dhamak 1, Sachin Somwanshi 3, Vikrant Nikam 3, Atul Khadse 1, Vivekanand Kashid 3 1. Department

More information

Immune System. How your body goes to war to keep you well

Immune System. How your body goes to war to keep you well Immune System How your body goes to war to keep you well WATCH OUT! Millions of bacteria and viruses are everywhere. Many aim to find a host and invade the body. HOW CAN WE DEFEND AGAINST IT? The Bad Guys

More information

Yersinia pestis. Yersinia and plague. Dr. Hala Al Daghistani

Yersinia pestis. Yersinia and plague. Dr. Hala Al Daghistani Yersinia pestis Dr. Hala Al Daghistani Yersinia species Short, pleomorphic gram-negative rods that can exhibit bipolar staining. Catalase positive, and microaerophilic or facultatively anaerobic. Animals

More information

Thank you for not chewing gum!

Thank you for not chewing gum! March 25 th, 2015 What do I need today? 1. Pencil 2. Science Notebook 3. Epidemiology note sheet Learning Target: Today we will continue to learn about the fascinating world of disease and epidemiology

More information