Strategies for Characterizing Proteins in Proteomics Research
|
|
- Bennett Bernard Allen
- 5 years ago
- Views:
Transcription
1 Strategies for Characterizing Proteins in Proteomics Research Joseph A. Loo Department of Biological Chemistry David Geffen School of Medicine Department of Chemistry and Biochemistry University of California Los Angeles, CA USA
2 Approaches for Protein Identification What is this protein? Molecular weight Isoelectric point (charge) Amino acid composition Other physical/chemical characteristics Partial or complete amino acid sequence Edman (N-terminal sequence) - if N-term. not blocked C-terminal sequence - not commonly performed Mass spectrometry-measured information
3 Electrospray Ionization (ESI) ESI highly charge droplets MS mass/charge (m/z( m/z) Multiple charging More charges for larger molecules MW range > 150 kda Liquid introduction of analyte Interface with liquid separation methods, e.g. liquid chromatography Tandem mass spectrometry (MS/MS) for protein sequencing
4 ESI-MS of Large Proteins distribution of multiply charged molecules (M+15H) (M+14H) (M+16H) 16+ (M+13H) mass m/z ESI-MS (Q-TOF) ph 7.5
5 Matrix-assisted assisted Laser Desorption/Ionization (MALDI) Time-of of-flight (TOF) Analyzer MALDI high voltage v 3 m 3 v 2 m 2 v 1 m 1 detector laser sample drift region m 1 m 2 m 3
6 MALDI Mass Spectrometry of Large Proteins 100 MALDI-MS MS of rat MVP (M+H) + % Intensity (M+2H) m/z
7 Approaches for Protein Sequencing and Identification Top Down MS/MS MIRERICACVLALGMLTGFTHAFGSKDAAADGKPLVVTTIGMIADAVKNIAQGDVHLKGLMGP GVDPHLYTATAGDVEWLGNADLILYNGLHLETKMGEVFSKLRGSRLVVAVSETIPVSQRLSLE EAEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTREFTQRYQAYQQQLDKLDAYVRRKAQS LPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESSI PHKNVEALRDAVQARGHVVQIGGELFSDAMGDAGTSEGTYVGMVTHNIDTIVAALAR Enzymatic or chemical degradation MS/MS Bottom Up
8 Protein Identification by Mass Spectrometry 2-D Gel Electrophoresis MW x Excise separated protein spots pi 1547 In-gel trypsin digest Peptide mass fingerprint by MALDI-TOF or LC-ESI-MS. Additional sequence information can be obtained by MS/MS Recover tryptic peptides m/z Protein identification by searching proteomic or genomic databases
9
10 Quadrupole - Time-of of-flight (QTOF) MALDI ESI Q0 Q1 Q2 select precursor ion of interest tandem mass spectrometry MS/MS fragment precursor ion detect resulting product ions
11
12 De Novo Protein Sequencing of Heat Resistant Proteins Found in Sacred Lotus Lotus, Nelumbo nucifera, has the distinction of having produced the longest living seed, 1300 yr Seed longevity is attributable to its Fruit coat s impermeability to O 2 and water Rapid adaptability to stress Genome is not known de novo protein sequencing Jane Shen-Miller, Kerry Wooding, Yongming Xie
13 SDS-PAGE Lotus protein (>400 yr) boiled embryo extracts 97 kda 64 kda 51 kda 39 kda 28 kda 19 kda 14 kda Heat hardy proteins are soluble in >100 C enable draught protection Lotus Fe-SOD (oxidative repair) retains 65% activity after 1 hr boiling mass spectrometry and de novo sequencing to identify heat stable proteins
14 Isotope Labeling as an Aid to De Novo Sequencing Trypsin Digestion in H 2 18 O (Arg, Lys) R 1 R 2 R 3 R 4...NH-CH CH-CO-NH-CH-CO-NH-CH-CO-NH-CH-COOHCOOH Trypsin / H 16 2 O / H 18 2 O R 1 R 2 NH 2 -CH-CO-NH-CH-CO- 16 OH R 1 R 2 NH 2 -CH-CO-NH-CH-CO- 18 OH 16 O or 18 O Aids interpretation of MS/MS spectra Distinguish b-ions (from N- terminus) and y-ions (from C- terminus): 2 Da shift
15 MALDI-QqTOF Tryptic Peptide Map trypsin digestion performed in H 2 16 O or H 2 18 O Boiled Embryo Extract 45 kda Band H 16 2 O m/z H O m/z
16
17 Enzyme and Chemical Specificity for Proteolysis Arg/Lys - XX Lys - XX Arg - XX Asp/Glu - XX XX - Asp Met - XX Trypsin Lys-C Arg-C V-8 8 protease Asp-N CNBr
18 New Chemistries for Proteomics: Chemical Modification of Cysteine (Cys-specific specific cleavage) N H 2 Br 2-bromoethyl amine Lindley, H. Nature,, 1956, 178,, 647. OH - HS NH O Cysteine H 2 N S N H O Digest with trypsin to cleave after Lys, Arg, Cys S-aminoethyl cysteine Thevis and Loo J. Proteome Res.,, 2003
19 Chemical Modification of Lysine Block Lys-cleavage H 2 N O NH + C H 3 O O CH 3 Lysine Acetic anhydride MeOH H 3 C O H N NH O Digest with trypsin to cleave after Arg, Cys Digest with Lys-C to cleave after Cys Lysine, acetylated (+ 42 Da)
20 Prior to Digestion: Chemical Modification of Cysteine Cys-specific specific cleavage Ionization enhancement of Cys-peptides N H 2 Br OH - HBr N H 2 S R 2-bromoethyl amine S-aminoethyl cysteine Lindley, H. Nature, 1956, 178,, 647. After Digestion: O CH 3 HN NH 2 O-methylisourea H H + N R 2 N N 2 C S H2 NH 2-bromoethyl amine Hale, J.E. et al. Anal. Biochem. 2000, 287,, 110. H H 2 C S + CH 3 OH R homoarginine derivative (improve MALDI response)
21 Human Serum Albumin In-gel derivatization and trypsin digestion MALDI-MS MS % Intensity m/z
22 Human Serum Albumin In-gel derivatization and trypsin digestion (cleavage after Cys, Arg) DAHKSEVAHR FKDLGEENFK ALVLIAFAQY LQQCPFEDHV KLVNEVTEFA KTCVADESAE NCDKSLHTLF GDKLCTVATL RETYGEMADCR CAKQEPERNE CFLQHKDDNP NLPRLVRPEV LVRPEV DVMCTAFHDN EETFLKKYLY EIARRHPYFY APELLFFAKR YKAAFTECCQ AADKAACLLP KLDELRDEGK ASSAKQRLKC ASLQKFGERA FKAWAVARLS QRFPKAEFAE VSKLVTDLTK VHTECCHGDL CHGDL LECADDRADL AKYICENQDS ISSKLKECCE KPLLEKSHCI I AEVENDEMPA DLPSLAADFV ESKDVCKNYA KNYA EAKDVFLGMF LYEYARRHPD YSVVLLLRLA LA KTYETTLEKC CAAADPHECY Y AKVFDEFKPL VEEPQNLIKQ NCELFEQLGE YKFQNALLVR YTKKVPQVST PTLVEVSRNL GKVGSKCCKH PEAKRMPCAE AE DYLSVVLNQL CVLHEKTPVS C DRVTKCCTES LVNRRPCFSA LEVDETYVPK EFNAETFTFH ADICTLSEKE RQIKKQTALV ELVKHKPKAT KEQLKAVMDD FAAFVEKCCK ADDKETCFAE EGKKLVAASQ AALGL Without homoarginine derivatization In addition, with homoarginine derivatization
23 α-lactalbumin In-gel derivatization and trypsin digestion Homoarginine derivatization EQLTKCEVFR ELKDLKGYGG VSLPEWVCTT FHTSGYDTQA IVQNNDSTEY GLFQINNKIW CKDDQNPHSS NICNISC NISCDKF LDDDLTDDIM CVKKILDKVG INYWLAHKAL CSEKLDQWLC EKL 86% sequence coverage D K F L D D D L T D D I M C 14 (homoarg; ) (M+H) + MALDI-MS/MS, MS/MS, QqTOF y 3 y 4 y 7 y 8 y 1 y 2 b 2 b 3 y 5 y 6 y 9 y13 y 10 y 12
24 Why Bother with Intact Protein Masses? The protein s molecular mass defines the native covalent state of a gene s product, including: Post-translational modifications: Glycosylation, Phosphorylation, Oxidation, Deamidation, Lipoylation, Acetylation, Formylation... Post-transcriptional modifications Alternative splicing, Introns/Exons, Frame-shifts, Sequencing Errors Simple confirmation of suspected id s Spotlight the presence of post-translational modifications The fragmentation pattern from proteins can generate sufficient information for identification from sequence databases, particularly when combined with accurate mass measurements of both the intact molecule and its product ions.
25 Combining Gel Electrophoreisis with Mass Spectrometry Building better tools Profiling proteins faster in an automated fashion
26 PAGE-MALDI MALDI-MS: MS: The Virtual 2D Gel Method Potential for automated, high-speed proteomic analysis Rachel Loo
27 Virtual 2-D 2 D Gel Electrophoresis (Analytical Chemistry 73, 4063 (2001)) Identify proteins based on MW and pi Create a database of intact protein masses and provide a direct link to all data produced now and in the future via classical 2D gels Identify proteome-wide posttranslational modifications
28 In-Source Decay (ISD) for Protein Sequencing Peptides and large proteins can be fragmented by ISD Fragmentation occurs in the MALDI ion source not generally well controlled Reflectron TOF not necessary (linear TOF sufficient to measure product ions cut R P F E E D P I T Complete sequence information not present, but extensive stretches of sequence from the N- and/or C-termini observed P E P P E P T P E P T I...TIDE... A G M E N T P E P T I D P E P T I D E
29 Protein ISD from Isoelectric Focusing Gel Counts ptsh 2+ mete S Y W AG N m/z 24 SYWAGNSTREELLAVGRELRARHWDQQKQAGIDLLPVGDFAWYD 67 Counts N-terminal c-ion series S T R E E I/LI/L G R V E I/L R A R H W K/Q D K/Q K/Q K/Q AGIDI/L LP VG D muli F A W Y D Ogorzalek Loo, RR, Cavalcoli, JD, VanBogelen, RA, Mitchell, C, Loo, JA, Moldover, B., and Andrews, PC, Anal. Chem. 73, 4063 (2001). m/z
30 Top-down sequencing of proteins by ESI-MS/MS 100 MW HIV Integrase Catalytic Core (F185K) 827 % m/z
31 Integrase: MS/MS (M+19H) b y % % m/z 764 b y y 2 y 3 y 4 y 5 y 6 y 7 complementary ion pair b Ile -Pro y m/z
32 MS/MS b (m/z 764) b MS/MS/MS or MS 3 can be performed to obtain further sequence information b b b % 1093 b m/z
33 ESI-MS/MS of GroES (97 amino acids) MS/MS yields direct sequence information for the C-terminal 15 amino acid residues. 833 b GroES (Chaperonin-10, MW 10435) b n , n = MS 2 (M+12H) b Difficult to predict fragmentation sites for intact proteins y 5 y y y y y m/z
34 Peptide fragmentation in nozzle-skimmer region of ESI interface Often called nozzleskimmer dissociation Fragmentation can be controlled by adjustment of nozzle-skimmer voltage Low energy CAD peptide fragmentation in atmosphere / vacuum interface Useful for obtaining sequence information for relatively pure samples without the need for a tandem mass spectrometer
35
36
37 Mass Spectrometry as a Tool for Protein Crystallography (see Cohen & Chait, Annu. Rev. Biophys. Biomol. Struct. 2001) Construct Verification Domain Elucidation Define folding domains Improve chances to generate high quality diffracting crystals Limited proteolysis cleaves flexible chains, leaving a more compact folding domain
38 ESI-MS of Intact Protein: ~ 59 kda 3 phosphorylation sites? MW MW Da ESI-MS % m/z
39 Limited Proteolysis for Domain Elucidation ESI-MS Trypsinolysis (15 min) Where are the cleavage sites? Da mass
40 MW MS/MS of Intact Proteins Complex spectra Confirm primary sequence Confirm termini, posttranslational modifications MW (M+18H) 18+ (M+18H) 18+ y-ions b-ions m/z
41 MS/MS of (M+18H) 18+ y-ions similar, but shifted by 80 Da same C-termini, C but phosphorylated MW residues (M+18H) MW residues phospho-site site (M+18H) 18+ y 14+ n y 15+ n y 13+ n m/z
42 Based on homology modeling and limited proteolysis... ESI-MS Trypsinolysis (15 min) (1-150) 150) (1-169) 169) (1-169) 169)-P (1-171) 171)-P ( ) 508)-P mass
43 Conclusions Bottom-up and top-down approaches for protein characterization are complementary Bottom-up methods are robust and lead to efficient processes for identifying proteins Top-down methods are not mature, both experimentally and computationally. Protein fragmentation is not predictable (yet). However, information on protein processing and modifications may be flagged by the top-down approach.
Biological Mass Spectrometry. April 30, 2014
Biological Mass Spectrometry April 30, 2014 Mass Spectrometry Has become the method of choice for precise protein and nucleic acid mass determination in a very wide mass range peptide and nucleotide sequencing
More informationMass Spectrometry. - Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications
- Introduction - Ion sources & sample introduction - Mass analyzers - Basics of biomolecule MS - Applications Adapted from Mass Spectrometry in Biotechnology Gary Siuzdak,, Academic Press 1996 1 Introduction
More informationMass Spectrometry. Mass spectrometer MALDI-TOF ESI/MS/MS. Basic components. Ionization source Mass analyzer Detector
Mass Spectrometry MALDI-TOF ESI/MS/MS Mass spectrometer Basic components Ionization source Mass analyzer Detector 1 Principles of Mass Spectrometry Proteins are separated by mass to charge ratio (limit
More information2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry
Dr. Sanjeeva Srivastava 1. Fundamental of Mass Spectrometry Role of MS and basic concepts 2. Ionization Sources 3. Mass Analyzers 4. Tandem Mass Spectrometry 2 1 MS basic concepts Mass spectrometry - technique
More informationDouble charge of 33kD peak A1 A2 B1 B2 M2+ M/z. ABRF Proteomics Research Group - Qualitative Proteomics Study Identifier Number 14146
Abstract The 2008 ABRF Proteomics Research Group Study offers participants the chance to participate in an anonymous study to identify qualitative differences between two protein preparations. We used
More informationComparison of mass spectrometers performances
Comparison of mass spectrometers performances Instrument Mass Mass Sensitivity resolution accuracy Quadrupole 1 x 10 3 0.1 Da* 0.5-1.0 pmol DE-MALDI 2 x 10 4 20 ppm 1-10 fmol peptide 1-5 pmol protein Ion
More informationREDOX PROTEOMICS. Roman Zubarev.
REDOX PROTEOMICS Roman Zubarev Roman.Zubarev@ki.se Physiological Chemistry I, Department for Medical Biochemistry & Biophysics, Karolinska Institutet, Stockholm What is (RedOx) Proteomics? Proteomics -
More informationLecture 3. Tandem MS & Protein Sequencing
Lecture 3 Tandem MS & Protein Sequencing Nancy Allbritton, M.D., Ph.D. Department of Physiology & Biophysics 824-9137 (office) nlallbri@uci.edu Office- Rm D349 Medical Science D Bldg. Tandem MS Steps:
More informationIntroduction to Proteomics 1.0
Introduction to Proteomics 1.0 CMSP Workshop Pratik Jagtap Managing Director, CMSP Objectives Why are we here? For participants: Learn basics of MS-based proteomics Learn what s necessary for success using
More informationBiomolecular Mass Spectrometry
Lipids ot different than other organic small molecules Carbohydrates Polymers of monosaccharides linked via glycosidic bonds (acetals/ ketals) many different combinationsvery interesting no time ucleic
More informationIon Source. Mass Analyzer. Detector. intensity. mass/charge
Proteomics Informatics Overview of spectrometry (Week 2) Ion Source Analyzer Detector Peptide Fragmentation Ion Source Analyzer 1 Fragmentation Analyzer 2 Detector b y Liquid Chromatography (LC)-MS/MS
More informationPTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System
Application Note LC/MS PTM Discovery Method for Automated Identification and Sequencing of Phosphopeptides Using the Q TRAP LC/MS/MS System Purpose This application note describes an automated workflow
More informationPeptide sequencing using chemically assisted fragmentation (CAF) and Ettan MALDI-ToF Pro mass spectrometry
application note Ett MALDI-ToF Pro Peptide sequencing using chemically assisted fragmentation (CAF) d Ett MALDI-ToF Pro mass spectrometry Key words: MALDI-ToF, PSD, peptide sequencing, chemically assisted
More informationChapter 3. Protein Structure and Function
Chapter 3 Protein Structure and Function Broad functional classes So Proteins have structure and function... Fine! -Why do we care to know more???? Understanding functional architechture gives us POWER
More informationProtein Identification and Phosphorylation Site Determination by de novo sequencing using PepFrag TM MALDI-Sequencing kit
Application Note Tel: +82-54-223-2463 Fax : +82-54-223-2460 http://www.genomine.com venture ldg 306 Pohang techno park Pohang, kyungbuk, Korea(ROK) Protein Identification and Phosphorylation Site Determination
More informationMALDI-TOF. Introduction. Schematic and Theory of MALDI
MALDI-TOF Proteins and peptides have been characterized by high pressure liquid chromatography (HPLC) or SDS PAGE by generating peptide maps. These peptide maps have been used as fingerprints of protein
More informationBiological Mass spectrometry in Protein Chemistry
Biological Mass spectrometry in Protein Chemistry Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi MASS SPECTROMETRY is an analytical technique that identifies the chemical composition of
More informationMass Spectrometry and Proteomics. Professor Xudong Yao Bioanalytical Chemistry Spring 2007
Mass Spectrometry and Proteomics Professor Xudong Yao Bioanalytical Chemistry Spring 2007 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Chemical proteomics Protein, Proteome and
More informationSolving practical problems. Maria Kuhtinskaja
Solving practical problems Maria Kuhtinskaja What does a mass spectrometer do? It measures mass better than any other technique. It can give information about chemical structures. What are mass measurements
More informationSupplementary Information. Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels
Supplementary Information Top-down/bottom-up mass spectrometry workflow using dissolvable polyacrylamide gels Nobuaki Takemori,,* Ayako Takemori,, Piriya Wongkongkathep, Michael Nshanian, Rachel R. Ogorzalek
More informationMass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University
Mass Spectrometry and Proteomics - Lecture 4 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk previously Peptide fragmentation Hybrid instruments 117 The Building Blocks of Life DNA RNA Proteins
More informationMass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010
Mass Spectrometry Course Árpád Somogyi Chemistry and Biochemistry MassSpectrometry Facility) University of Debrecen, April 12-23, 2010 Introduction, Ionization Methods Mass Analyzers, Ion Activation Methods
More informationProteins. Amino acids, structure and function. The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka
Proteins Amino acids, structure and function The Nobel Prize in Chemistry 2012 Robert J. Lefkowitz Brian K. Kobilka O O HO N N HN OH Ser65-Tyr66-Gly67 The Nobel prize in chemistry 2008 Osamu Shimomura,
More informationMethods in Mass Spectrometry. Dr. Noam Tal Laboratory of Mass Spectrometry School of Chemistry, Tel Aviv University
Methods in Mass Spectrometry Dr. Noam Tal Laboratory of Mass Spectrometry School of Chemistry, Tel Aviv University Sample Engineering Chemistry Biology Life Science Medicine Industry IDF / Police Sample
More informationMultiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow
Multiplex Protein Quantitation using itraq Reagents in a Gel-Based Workflow Purpose Described herein is a workflow that combines the isobaric tagging reagents, itraq Reagents, with the separation power
More informationMass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD
Mass spectra of peptides and proteins - and LC analysis of proteomes Stephen Barnes, PhD 4-7117 sbarnes@uab.edu Overview A mass spectrum Electrospray MS Analysis of intact proteins Molecular weight calculations
More information1. Sample Introduction to MS Systems:
MS Overview: 9.10.08 1. Sample Introduction to MS Systems:...2 1.1. Chromatography Interfaces:...3 1.2. Electron impact: Used mainly in Protein MS hard ionization source...4 1.3. Electrospray Ioniztion:
More informationFundamentals of Soft Ionization and MS Instrumentation
Fundamentals of Soft Ionization and MS Instrumentation Ana Varela Coelho varela@itqb.unl.pt Mass Spectrometry Lab Analytical Services Unit Index Mass spectrometers and its components Ionization methods:
More informationChapter 3. Structure of Enzymes. Enzyme Engineering
Chapter 3. Structure of Enzymes Enzyme Engineering 3.1 Introduction With purified protein, Determining M r of the protein Determining composition of amino acids and the primary structure Determining the
More informationQuantitative LC-MS/MS Analysis of Glucagon. Veniamin Lapko, Ph.D June 21, 2011
Quantitative LC-MS/MS Analysis of Glucagon Veniamin Lapko, Ph.D June 21, 2011 Contents Comparison with small molecule LC-MS/MS LC-MS/MS sensitivity of peptides detection Stability: neat vs. matrix solutions
More informationProteins are sometimes only produced in one cell type or cell compartment (brain has 15,000 expressed proteins, gut has 2,000).
Lecture 2: Principles of Protein Structure: Amino Acids Why study proteins? Proteins underpin every aspect of biological activity and therefore are targets for drug design and medicinal therapy, and in
More informationMetabolomics: quantifying the phenotype
Metabolomics: quantifying the phenotype Metabolomics Promises Quantitative Phenotyping What can happen GENOME What appears to be happening Bioinformatics TRANSCRIPTOME What makes it happen PROTEOME Systems
More informationIntroduction to Peptide Sequencing
Introduction to Peptide equencing Quadrupole Ion Traps tructural Biophysics Course December 3, 2014 12/8/14 Introduction to Peptide equencing - athan Yates 1 Why are ion traps used to sequence peptides?
More informationChemical Mechanism of Enzymes
Chemical Mechanism of Enzymes Enzyme Engineering 5.2 Definition of the mechanism 1. The sequence from substrate(s) to product(s) : Reaction steps 2. The rates at which the complex are interconverted 3.
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1
Supplementary Figure 1 The timeline of the NGAG method for extraction of N-linked glycans and glycosite-containing peptides. The timeline can be changed based on the number of samples. Supplementary Figure
More informationPhosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g.
Phosphorylation of proteins Steve Barnes Feb 19th, 2002 in some cases, proteins are found in a stable, hyperphosphorylated state, e.g., casein more interestingly, in most other cases, it is a transient
More informationProteins: Proteomics & Protein-Protein Interactions Part I
Proteins: Proteomics & Protein-Protein Interactions Part I Jesse Rinehart, PhD Department of Cellular & Molecular Physiology Systems Biology Institute DNA RNA PROTEIN DNA RNA PROTEIN Proteins: Proteomics
More informationPrevious Class. Today. Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism. Protein Kinase Catalytic Properties
Previous Class Detection of enzymatic intermediates: Protein tyrosine phosphatase mechanism Today Protein Kinase Catalytic Properties Protein Phosphorylation Phosphorylation: key protein modification
More informationMass Spectrometry Introduction
Mass Spectrometry Introduction Chem 744 Spring 2013 What MS is and is not MS is NOT a spectroscopic method. Molecules are not absorbing EM radiation MS is the generation, separation and characterization
More informationNIH Public Access Author Manuscript J Proteome Res. Author manuscript; available in PMC 2014 July 05.
NIH Public Access Author Manuscript Published in final edited form as: J Proteome Res. 2013 July 5; 12(7): 3071 3086. doi:10.1021/pr3011588. Evaluation and Optimization of Mass Spectrometric Settings during
More informationThe N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold
The N-terminal loop of IRAK-4 death domain regulates ordered assembly of the Myddosome signalling scaffold Anthony C.G. Dossang * 1, Precious G. Motshwene * 1, Yang Yang* 1, Martyn F. Symmons*, Clare E.
More informationNature Methods: doi: /nmeth.3177
Supplementary Figure 1 Characterization of LysargiNase, trypsin and LysN missed cleavages. (a) Proportion of peptides identified in LysargiNase and trypsin digests of MDA-MB-231 cell lysates carrying 0,
More informationABSTRACT. Dr. Catherine Fenselau, Department of Chemistry and Biochemistry. Presented in this work is a novel bottom up proteomics approach to
ABSTRACT Title of Document: INTEGRATION OF ASP-SPECIFIC MICROWAVE-ACCELERATED ACID HYDROLYSIS INTO PROTEOMIC ANALYSES Stephen J. Swatkoski, Ph.D., 2007 Directed By: Dr. Catherine Fenselau, Department of
More informationMass Spectrometry and Proteomics Xudong Yao
Mass Spectrometry and Proteomics Xudong Yao Dept of Chemistry University of Connecticut Storrs, CT April 19, 2005 Proteomics and -omics Roles of mass spectrometry Comparative proteomics Gel or non-gel
More informationQuadrupole and Ion Trap Mass Analysers and an introduction to Resolution
Quadrupole and Ion Trap Mass Analysers and an introduction to Resolution A simple definition of a Mass Spectrometer A Mass Spectrometer is an analytical instrument that can separate charged molecules according
More informationSupporting Information. Lysine Propionylation to Boost Proteome Sequence. Coverage and Enable a Silent SILAC Strategy for
Supporting Information Lysine Propionylation to Boost Proteome Sequence Coverage and Enable a Silent SILAC Strategy for Relative Protein Quantification Christoph U. Schräder 1, Shaun Moore 1,2, Aaron A.
More informationOne Gene, Many Proteins. Applications of Mass Spectrometry to Proteomics. Why Proteomics? Raghothama Chaerkady, Ph.D.
Applications of Mass Spectrometry to Proteomics Raghothama Chaerkady, Ph.D. McKusick-Nathans Institute of Genetic Medicine and the Department of Biological Chemistry Why Proteomics? One Gene, Many Proteins
More informationProtein Analysis using Electrospray Ionization Mass Spectroscopy *
OpenStax-CNX module: m38341 1 Protein Analysis using Electrospray Ionization Mass Spectroscopy * Wilhelm Kienast Andrew R. Barron This work is produced by OpenStax-CNX and licensed under the Creative Commons
More informationA Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization
A Study of Peptide Peptide Interaction by Matrix-Assisted Laser Desorption/Ionization Amina S. Woods and Marilyn A. Huestis Chemistry and Drug Metabolism, NIDA Intramural Research Program, NIDA, NIH, Baltimore,
More informationProtein sequence mapping is commonly used to
Reproducible Microwave-Assisted Acid Hydrolysis of Proteins Using a Household Microwave Oven and Its Combination with LC-ESI MS/MS for Mapping Protein Sequences and Modifications Nan Wang and Liang Li
More informationAgilent Protein In-Gel Tryptic Digestion Kit
Agilent 5188-2749 Protein In-Gel Tryptic Digestion Kit Agilent Protein In-Gel Tryptic Digestion Kit Instructions Kit Contents The Protein In-Gel Tryptic Digestion Kit includes sufficient reagents for approximately
More informationCharacterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry. Supporting Information
Characterization of Disulfide Linkages in Proteins by 193 nm Ultraviolet Photodissociation (UVPD) Mass Spectrometry M. Montana Quick, Christopher M. Crittenden, Jake A. Rosenberg, and Jennifer S. Brodbelt
More informationImpurity Identification using a Quadrupole - Time of Flight Mass Spectrometer QTOF
Impurity Identification using a Quadrupole - Time of Flight Mass Spectrometer QTOF PUSHER TOF DETECTOR ZSPRAY TM Ion Source SAMPLING CONE SKIMMER RF HEXAPOLE RF HEXAPOLE QUADRUPOLE IN NARROW BANDPASS MODE
More informationImprove Protein Analysis with the New, Mass Spectrometry- Compatible ProteasMAX Surfactant
Improve Protein Analysis with the New, Mass Spectrometry- Compatible Surfactant ABSTRACT Incomplete solubilization and digestion and poor peptide recovery are frequent limitations in protein sample preparation
More informationIntroduction to LC/MS/MS
Trends in 2006 Introduction to LC/MS/MS By Crystal Holt, LC/MS Product Specialist, Varian Inc. Toxicology laboratories Increased use of LC/MS Excellent LD Cheaper (still expensive) Much more robust Solves
More informationPROTEINS. Building blocks, structure and function. Aim: You will have a clear picture of protein construction and their general properties
PROTEINS Building blocks, structure and function Aim: You will have a clear picture of protein construction and their general properties Reading materials: Compendium in Biochemistry, page 13-49. Microbiology,
More informationIn-Gel Tryptic Digestion Kit
INSTRUCTIONS In-Gel Tryptic Digestion Kit 3747 N. Meridian Road P.O. Box 117 Rockford, IL 61105 89871 1468.2 Number Description 89871 In-Gel Tryptic Digestion Kit, sufficient reagents for approximately
More informationMeasuring Lipid Composition LC-MS/MS
Project: Measuring Lipid Composition LC-MS/MS Verification of expected lipid composition in nanomedical controlled release systems by liquid chromatography tandem mass spectrometry AUTHORED BY: DATE: Sven
More informationThis exam consists of two parts. Part I is multiple choice. Each of these 25 questions is worth 2 points.
MBB 407/511 Molecular Biology and Biochemistry First Examination - October 1, 2002 Name Social Security Number This exam consists of two parts. Part I is multiple choice. Each of these 25 questions is
More informationMass Spectrometry Infrastructure
Mass Spectrometry Infrastructure Todd Williams, Ph.D. Director KU Mass Spectrometry and Analytical Proteomics Laboratory Mass Spectrometry Lab B025 Malott Hall Mission The Mass Spectrometry and analytical
More informationGentilucci, Amino Acids, Peptides, and Proteins. Peptides and proteins are polymers of amino acids linked together by amide bonds CH 3
Amino Acids Peptides and proteins are polymers of amino acids linked together by amide bonds Aliphatic Side-Chain Amino Acids - - H CH glycine alanine 3 proline valine CH CH 3 - leucine - isoleucine CH
More informationMetabolite identification in metabolomics: Metlin Database and interpretation of MSMS spectra
Metabolite identification in metabolomics: Metlin Database and interpretation of MSMS spectra Jeevan K. Prasain, PhD Department of Pharmacology and Toxicology, UAB jprasain@uab.edu Outline Introduction
More informationCHAPTER 21: Amino Acids, Proteins, & Enzymes. General, Organic, & Biological Chemistry Janice Gorzynski Smith
CHAPTER 21: Amino Acids, Proteins, & Enzymes General, Organic, & Biological Chemistry Janice Gorzynski Smith CHAPTER 21: Amino Acids, Proteins, Enzymes Learning Objectives: q The 20 common, naturally occurring
More informationSUPPORTING INFORMATION. Lysine Carbonylation is a Previously Unrecognized Contributor. to Peroxidase Activation of Cytochrome c by Chloramine-T
Electronic Supplementary Material (ESI) for Chemical Science. This journal is The Royal Society of Chemistry 2019 SUPPORTING INFORMATION Lysine Carbonylation is a Previously Unrecognized Contributor to
More informationMass spectrometry based proteomics
Practice-oriented, student-friendly modernization of the biomedical education for strengthening the international competitiveness of the rural Hungarian universities TÁMOP-4.1.1.C-13/1/KONV-2014-0001 Mass
More informationNew Instruments and Services
New Instruments and Services http://planetorbitrap.com/orbitrap fusion Combining the best of quadrupole, Orbitrap, and ion trap mass analysis in a revolutionary Tribrid architecture, the Orbitrap Fusion
More informationTECHNICAL BULLETIN. R 2 GlcNAcβ1 4GlcNAcβ1 Asn
GlycoProfile II Enzymatic In-Solution N-Deglycosylation Kit Product Code PP0201 Storage Temperature 2 8 C TECHNICAL BULLETIN Product Description Glycosylation is one of the most common posttranslational
More informationMALDI Imaging Mass Spectrometry
MALDI Imaging Mass Spectrometry Nan Kleinholz Mass Spectrometry and Proteomics Facility The Ohio State University Mass Spectrometry and Proteomics Workshop What is MALDI Imaging? MALDI: Matrix Assisted
More information(III) MALDI instrumentation
Dr. Sanjeeva Srivastava (I) Basics of MALDI-TF (II) Sample preparation In-gel digestion Zip-tip sample clean-up Matrix and sample plating (III) MALDI instrumentation 2 1 (I) Basics of MALDI-TF Analyte
More informationCahn - Ingold - Prelog system. Proteins: Evolution, and Analysis Lecture 7 9/15/2009. The Fischer Convention (1) G (2) (3)
Chapter 4 (1) G Proteins: Evolution, and Analysis Lecture 7 9/15/2009 A V L I M P F W Chapter 4 (2) S (3) T N Q Y C K R H D E The Fischer Convention Absolute configuration about an asymmetric carbon related
More informationAn Introduction. 1 Introduction MALDI-TOF/TOF_version100623
MALDI-TOF/TOF mass spectrometry An Introduction 1 Introduction MALDI-TOF/TOF_version100623 MALDI-TOF(/TOF) mass spectrometry MALDI ion source Time-of of-flight (TOF) mass analyzer detector 2 Introduction
More informationCHAPTER 3 Amino Acids, Peptides, Proteins
CHAPTER 3 Amino Acids, Peptides, Proteins Learning goals: Structure and naming of amino acids Structure and properties of peptides Ionization behavior of amino acids and peptides Methods to characterize
More informationPolymer Additive Analysis by EI and APCI
Polymer Additive Analysis by EI and APCI Kate Yu, Eric Block LC/MS Waters Corporation Introduction to polymer additive analysis by LC/MS. Electron Ionization (EI) Advantages Classical spectra Library searchable
More informationEdman Sample Preparation Part 2. Bill Henzel Genentech Inc.
Edman Sample Preparation Part 2 Bill Henzel Genentech Inc. Determining a Protein is Blocked Estimate the amount of protein applied to the protein sequencer. Compare the staining intensity of the band of
More informationAmino acids. Side chain. -Carbon atom. Carboxyl group. Amino group
PROTEINS Amino acids Side chain -Carbon atom Amino group Carboxyl group Amino acids Primary structure Amino acid monomers Peptide bond Peptide bond Amino group Carboxyl group Peptide bond N-terminal (
More information5 Identification of Binding Partners of the Annexin A2 / P11 Complex by Chemical Cross-Linking
5 Identification of Binding Partners of the Annexin A2 / P11 Complex by Chemical Cross-Linking In the quest of the omics sciences for holistic schemes, the identification of binding partners of proteins
More informationThe Detection of Allergens in Food Products with LC-MS
The Detection of Allergens in Food Products with LC-MS Something for the future? Jacqueline van der Wielen Scope of Organisation Dutch Food and Consumer Product Safety Authority: Law enforcement Control
More informationAn Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27
An Alternative Approach: Top-Down Bioanalysis of Intact Large Molecules Can this be part of the future? Lecture 8, Page 27 Top-down HRAM Bioanalysis of Native Proteins/Molecules Relative Abundance 100
More informationMass Spectrometry based metabolomics
Mass Spectrometry based metabolomics Metabolomics- A realm of small molecules (
More informationSequence Identification And Spatial Distribution of Rat Brain Tryptic Peptides Using MALDI Mass Spectrometric Imaging
Sequence Identification And Spatial Distribution of Rat Brain Tryptic Peptides Using MALDI Mass Spectrometric Imaging AB SCIEX MALDI TOF/TOF* Systems Patrick Pribil AB SCIEX, Canada MALDI mass spectrometric
More informationAA s are the building blocks of proteins
Chamras Chemistry 106 Lecture otes Chapter 24: Amino Acids, Peptides, and Proteins General Formula: () n (') α-amino Acids: (n = 1) Example: Amino Acids and Proteins: Glycine Alanine Valine AA s are the
More informationProteomics/Peptidomics
Proteomics/Peptidomics System biology tools and preclinical models for translational research in endometriosis, ESHRE Campus workshop, 4-5 September 2009 E. Waelkens Proteomics: What? Proteins Proteomics
More informationApplications of HPLC-MALDI-TOF MS/MS Phosphoproteomic Analysis in Oncological Clinical Diagnostics
Current Proteomics, 2011, 8, 153-167 153 Applications of HPLC-MALDI-TOF MS/MS Phosphoproteomic Analysis in Oncological Clinical Diagnostics Courtney L. Haddock*,1, Barry Holtz 1, Neil Senzer 1,2,3,4 and
More informationAdvances in Hybrid Mass Spectrometry
The world leader in serving science Advances in Hybrid Mass Spectrometry ESAC 2008 Claire Dauly Field Marketing Specialist, Proteomics New hybrids instruments LTQ Orbitrap XL with ETD MALDI LTQ Orbitrap
More informationRDP Cores Highlights: the CF Analytics Core. Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology
CF@LANTA RDP Cores Highlights: the CF Analytics Core Facundo M. Fernández School of Chemistry and Biochemistry Georgia Institute of Technology CF@LANTA RDP Center The CF@LANTA RDP Center at Emory University
More informationIonization Methods. Neutral species Charged species. Removal/addition of electron(s) Removal/addition of proton(s)
Ionization Methods Neutral species Charged species Removal/addition of electron(s) M + e - (M +. )* + 2e - electron ionization Removal/addition of proton(s) M + (Matrix)-H MH + + (Matrix) - chemical ionization
More informationCan we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016
Can we learn something new about peptide separations after 40 years of RP and HILIC chromatography? Martin Gilar April 12, MASSEP 2016 2015 Waters Corporation 1 Overview 1. 2D RP RP LC of peptides 2. RP-LC
More informationShotgun Proteomics MS/MS. Protein Mixture. proteolysis. Peptide Mixture. Time. Abundance. Abundance. m/z. Abundance. m/z 2. Abundance.
Abundance Abundance Abundance Abundance Abundance Shotgun Proteomics Protein Mixture 1 2 3 MS/MS proteolysis m/z 2 3 Time µlc m/z MS 1 m/z Peptide Mixture m/z Block Diagram of a Mass Spectrometer Sample
More informationComponents of a Mass Spectrometer
Components of a Mass Spectrometer Sample Introduction Inlet GC LC Direct Insertion (Syringe/Probe) Ionization Ion Separation Ion Detection Ion Source EI,CI,,, MALDI Mass Analyzer Under vacuum TOF, Quadrupole,
More informationMASS SPECTROMETRIC CHARACTERIZATION OF ELASTIN PEPTIDES AND THE EFFECT OF SOLAR RADIATION ON ELASTIN. Dissertation
MASS SPECTROMETRIC CHARACTERIZATION OF ELASTIN PEPTIDES AND THE EFFECT OF SOLAR RADIATION ON ELASTIN Dissertation zur Erlangung des akademischen Grades Doktor rerum naturalium (Dr. rer. nat.) vorgelegt
More informationNew Instruments and Services
New Instruments and Services Liwen Zhang Mass Spectrometry and Proteomics Facility The Ohio State University Summer Workshop 2016 Thermo Orbitrap Fusion http://planetorbitrap.com/orbitrap fusion Thermo
More informationProteomic Analysis of Bovine Brain G Protein Subunit Processing Heterogeneity* S
Research Proteomic Analysis of Bovine Brain G Protein Subunit Processing Heterogeneity* S Lana A. Cook, Kevin L. Schey, Michael D. Wilcox, Jane Dingus, Rebecca Ettling, Troy Nelson, Daniel R. Knapp, and
More informationMass Spectrometry at the Laboratory of Food Chemistry. Edwin Bakx Laboratory of Food Chemistry Wageningen University
Mass Spectrometry at the Wageningen University Mass Spectrometry at the 3 UPLC/CE - ESI - Ion trap MS systems UPLC Thermo Acella with a Velos or VelosPro CE Beckman PA800 with a Thermo VelosPro 1 UPLC-
More informationLOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES. Gilles Frache Materials Characterization Day October 14 th 2016
LOCALISATION, IDENTIFICATION AND SEPARATION OF MOLECULES Gilles Frache Materials Characterization Day October 14 th 2016 1 MOLECULAR ANALYSES Which focus? LOCALIZATION of molecules by Mass Spectrometry
More informationSection 1 Proteins and Proteomics
Section 1 Proteins and Proteomics Learning Objectives At the end of this assignment, you should be able to: 1. Draw the chemical structure of an amino acid and small peptide. 2. Describe the difference
More informationSCS Mass Spectrometry Laboratory
SCS Mass Spectrometry Laboratory Contact Information Staff 31 Noyes Laboratory (8:00-5:00 M-F) 217-333-2545 http://scs.illinois.edu/massspec/ Furong Sun (frs@illinois.edu) Furong Sun Director Training
More informationMetabolite identification in metabolomics: Database and interpretation of MSMS spectra
Metabolite identification in metabolomics: Database and interpretation of MSMS spectra Jeevan K. Prasain, PhD Department of Pharmacology and Toxicology, UAB jprasain@uab.edu utline Introduction Putative
More informationFigure S6. A-J) Annotated UVPD mass spectra for top ten peptides found among the peptides identified by Byonic but not SEQUEST + Percolator.
Extending Proteome Coverage by Combining MS/MS Methods and a Modified Bioinformatics Platform adapted for Database Searching of Positive and Negative Polarity 193 nm Ultraviolet Photodissociation Mass
More informationTrypsin Mass Spectrometry Grade
058PR-03 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Trypsin Mass Spectrometry Grade A Chemically Modified, TPCK treated, Affinity Purified
More informationLevels of Protein Structure:
Levels of Protein Structure: PRIMARY STRUCTURE (1 ) - Defined, non-random sequence of amino acids along the peptide backbone o Described in two ways: Amino acid composition Amino acid sequence M-L-D-G-C-G
More information