The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury

Size: px
Start display at page:

Download "The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury"

Transcription

1 The BMP-7 Smad1/5/8 Pathway Promotes Kidney Repair After Obstruction Induced Renal Injury Scott R. Manson, Robert A. Niederhoff, Keith A. Hruska and Paul F. Austin* From the Division of Pediatric Urology, Department of Surgery, and Division of Pediatric Nephrology, Departments of Medicine and Pediatrics (KAH), Washington University, St. Louis Children s Hospital, St. Louis, Missouri Purpose: Urinary tract obstruction causes hydroureteronephrosis and requires surgical intervention to prevent permanent renal injury. While many studies have focused on the development of renal injury, we examined the molecular mechanisms that promote renal recovery after correcting obstruction. Materials and Methods: A reversible murine model of ureteral obstruction was used to examine the bone morphogenic protein-7 and transforming growth factor- signaling pathways during renal recovery after obstruction induced injury. Analysis was done using standard molecular techniques, including reverse transcriptase-polymerase chain reaction, enzyme-linked immunosorbent assay, immunoblotting and co-immunoprecipitation. Results: After correcting obstruction the up-regulation of bone morphogenic protein-7 inhibited the transforming growth factor- dependent profibrotic pathways that are central to renal injury pathogenesis. The inhibitory effects of bone morphogenic protein-7 were mediated in part by the activation of its downstream target proteins, SMA and MAD related proteins 1, 5 and 8, which suppress the activity of transforming growth factor- dependent Smad proteins and in turn inhibit the expression of transforming growth factor- dependent genes. Activation of the bone morphogenic protein-7-smad related protein 1/5/8 pathway during renal recovery promoted renal architecture restoration and fibrosis resolution in the kidney after correcting obstruction. Conclusions: Together these findings show that the bone morphogenic protein-7 Smad1/5/8 pathway promotes kidney repair after obstruction induced injury. Accordingly the pathway represents an important therapeutic target to stimulate this innate repair mechanisms of the kidney during treatment for obstruction induced renal injury. Abbreviations and Acronyms BMP-7 bone morphogenic protein-7 GAPDH glyceraldehyde-3- phosphate dehydrogenase PBS phosphate buffered saline PCR polymerase chain reaction SMAD SMA and MAD related protein TGF- transforming growth factor- UUO unilateral ureteral obstruction Study received institutional animal care and use committee approval. Supported by the National Institutes of Health and Midwest Stone Institute. * Correspondence: Washington University, 4990 Children s Pl., Suite 1120, Campus Box 8242, St. Louis, Missouri (telephone: ; FAX: ; austinp@ wustl.edu). Key Words: kidney, ureteral obstruction, fibrosis, Smad proteins, mice OBSTRUCTIVE uropathy is a leading cause of renal injury, chronic renal insufficiency and renal failure. 1 3 While current surgical approaches often alleviate urinary tract obstructions, the possibility of irreversible renal injury remains even after treatment. 2,3 Thus, the clinical management of obstructive uropathy would benefit from the development of therapeutic approaches that promote renal recovery after injury. While the development of renal injury is well understood, 2,3 renal recovery after injury is less clearly understood. Although it lacks true regenerative ability, 4 the mature kidney has innate ability to restore its structure and function after injury. However, this reparative ability is decreased after severe renal injury. 5,6 Understanding the processes that promote renal recovery and their molecular regulation may /11/ /0 Vol. 185, , June 2011 THE JOURNAL OF UROLOGY Printed in U.S.A by AMERICAN UROLOGICAL ASSOCIATION EDUCATION AND RESEARCH, INC. DOI: /j.juro

2 2524 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY enable the development of therapeutic approaches to stimulate the innate repair mechanisms of the kidney during treatment for obstruction induced injury. At the molecular level activation of the TGF- pathway has a central role in the pathogenesis of renal injury by promoting apoptosis, epithelial-mesenchymal transformation, matrix protein synthesis and other profibrotic events that lead to the disruption of renal structure and function. 7 Accordingly neutralizing TGF- inhibits the progression of obstruction induced renal injury Another member of the TGF- superfamily, BMP-7, has the distinguishing property of inhibiting TGF- dependent biological functions. 11 TGF- and BMP-7 signal through receptor complexes that phosphorylate Smad transcription factors TGF- and BMP-7 have different functions, in part since they promote the activating phosphorylation of distinct Smad proteins. TGF- activates Smad2/3 while BMP-7 activates Smad1/5/8. These phosphorylated Smad proteins then bind Smad4 protein and regulate the transcription of target genes in a pathway specific manner While the signaling pathways downstream of TGF- and BMP-7 have been well defined, the mechanisms by which BMP-7 counters TGF- in the kidney have not yet been clearly defined. Treatment with exogenous BMP-7 inhibits the development of renal injury We explored the possibility that BMP-7 may inhibit the pathogenesis of renal injury, in part by promoting kidney repair. While several studies show that exogenous BMP-7 reverses the progression of chronic renal injury, 17,18 chronic injury models have not effectively differentiated between the effects of BMP-7 on the development and on the repair of renal injury since in these models the injurious stimuli is continuously present. To begin to determine the role of the BMP-7 pathway in renal recovery after injury several important questions remain to be answered. 1) Is the BMP-7 pathway regulated during renal recovery? 2) By what mechanisms does BMP-7 counter TGF- in the injured kidney and are these counter regulatory mechanisms subject to regulation during renal recovery? 3) Is pharmacological manipulation of the BMP-7 pathway an effective therapeutic approach to stimulate the innate repair mechanisms of the kidney during treatment for renal injury? We began to address these questions to better understand the molecular mechanisms that contribute to renal recovery after obstruction induced injury. MATERIALS AND METHODS Reversible UUO Eight to 10-week-old C57BL/6J mice were obstructed by placing a vascular clamp on the proximal ureter and, when indicated, obstruction was reversed by subsequently removing the clamp. 6 Mice were treated with PBS or 300 g/kg purified BMP-7 (R & D Systems ), as indicated. Histology/Immunostaining Kidneys were fixed in HistoChoice. Slides containing 5 m tissue slices were stained using Masson s trichrome reagent (Richard Allen Scientific, Kalamazoo, Michigan) according to product specifications. Slides were prepared as described, subjected to antigen retrieval by boiling in 10 mm citrate buffer (ph 6.0) and stained using rabbit anti-collagen IV/procollagen IV (Millipore ) and fluorescein isothiocyanate conjugated anti-rabbit antibodies (Sigma ). Three photographs per sample were uniformly taken of the region bounded by the renal capsule and the corticomedullary junction adjacent to the papillae at 200 magnification. Interstitial/tubular volume were visually quantified by overlaying a grid on slide photographs and counting the grid points in the interstitial/tubular regions. 19 Total Kidney Collagen Content Quantification Kidneys were hydrolyzed, resuspended in citrateacetate buffer (ph 6.0) and oxidized with 0.35% chloramine T. Hydroxyproline was quantitated by measuring the conversion of 7% dimethyl-aminobenzaldehyde to a colorimetric product by hydrolyzates using spectrophotometry (558 nm) and comparison to hydroxyproline standards. Collagen content was determined using the approximation that collagen contains 14% hydroxyproline. 20 Reverse Transcriptase-PCR Kidneys were pulverized in liquid nitrogen and homogenized in TRIzol. RNA was isolated according to product specifications. Semiquantitative reverse transcriptase PCR was done using SuperScript for RT-PCR for 24 to 32 cycles with primers for -smooth muscle actin (5=-ctgagcgtggctattccttc-3= and 5=-gggggccaccctataataaa-3=), collagen 1(I) (5=-actggtacatcagcccgaac-3= and 5=-ggtggagggagtttacacga-3=) or GAPDH (5=-actccactcacggcaaattc-3= and 5=-ccttccacaatgccaaagtt-3=). Enzyme-Linked Immunosorbent Assay Kidneys were pulverized in liquid nitrogen and homogenized in 20 mm tris-hcl (ph 7.5), 2 M NaCl, 0.1% Tween and 1 mm ethylenediaminetetraacetic acid. Protein levels were determined using a BMP-7 enzyme-linked immunosorbent assay kit (R & D Systems) according to product specifications. Immunoblotting Kidneys were pulverized in liquid nitrogen and lysed in 83.3 mm tris, 150 mm NaCl, 4% sodium dodecyl sulfate and 100 mm dithiothreitol supplemented with Complete Protease/PhosSTOP inhibitors. Immunoblotting was performed using rabbit anti-phospho-smad 2/3 (Cell Signaling Technology ), rabbit anti-phospho-smad 1/5/8, rabbit anti-smad4 (Santa Cruz Biotechnology, Santa Cruz, California) or mouse anti-gapdh (Chemicon ) and horseradish peroxidase-goat anti-rabbit or horseradish peroxidase-goat anti-mouse secondary antibody (Jackson ImmunoResearch Laboratories, West Grove, Pennsylvania).

3 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY 2525 TRICHROME TYPE IV COLLAGEN to Protein G beads (Dynal ). Immunoblotting was performed as described. SHAM Statistical Analysis Data are shown as the mean SD. Statistical significance was analyzed by NOVA with the Bonferroni correction. 2D UUO 2D UUO/ 3D REC 2D UUO/ 10D REC Figure 1. Repair after UUO injury. Views of kidney in 3 mice each with sham operation (SHAM), 2 days (D) of UUO, 2 days of UUO followed by reversal and 3 days of recovery (REC) or2 days of UUO followed by reversal and 10 days of recovery. Masson s trichrome stain, reduced from 100. Type IV collagen immunofluorescence, reduced from 200. Co-Immunoprecipitation Kidneys were pulverized in liquid nitrogen and lysed in 50 mm tris-hcl, 150 mm NaCl, 1 mm ethylenediaminetetraacetic acid, 1% Triton, 1% sodium deoxycholate and 0.1% sodium dodecyl sulfate supplemented with Complete Protease/PhosSTOP phosphatase inhibitors. Lysates were immunoprecipitated with rabbit anti-smad4 conjugated RESULTS Reversible UUO as Renal Recovery Model To better understand the mechanisms that contribute to renal recovery from obstructive uropathy we studied a model of acute renal injury in response to UUO. 6 In this model the subsequent reversal of obstruction mimics the surgical correction of obstructive uropathy in patients and serves as a model of kidney recovery from acute, obstruction induced injury. Obstructive uropathy potentially results in decreased renal function through the disruption of renal architecture and the promotion of renal fibrosis. 2,3 These deleterious changes were effectively reproduced in our model since UUO causes renal fibrosis (fig. 1), as characterized by interstitial expansion, loss of tubular volume and collagen accumulation (p 0.01, 0.01 and 0.005, respectively, fig. 2). When using the UUO model to examine renal recovery, we found that mice that undergo 2 days of UUO show renal fibrosis but after obstruction reversal and a recovery period much of the renal damage subsides (fig. 1). Obstruction reversal promotes decreased interstitial volume, increased tubular volume and decreased collagen (p 0.005, 0.01 and 0.005, respectively, fig. 2). These findings show that fibrosis resolution and renal architecture restoration are processes that contribute to renal recovery. We next examined the Figure 2. Repair after UUO injury. Kidney findings in 3 mice each underwent sham operation (SHAM), 2 days (D) of UUO, 2 days of UUO followed by reversal and 3 days of recovery (REC) or 2 days of UUO followed by reversal and 10 days of recovery. A, interstitial volume. Single asterisk indicates p Triple asterisks indicate p B, tubular volume. Double asterisks indicate p C, kidney collagen content.

4 2526 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY Figure 3. BMP-7 Smad1/5/8 pathway was activated during renal recovery (REC) after UUO induced renal injury. Three mice each underwent sham operation (SHAM), 2 days (D) of UUO, 2 days of UUO followed by reversal and 3 days of recovery or 2 days of UUO followed by reversal and 10 days of recovery. A, BMP-7 enzyme-linked immunosorbent assay. Triple asterisks indicate p B, Western blot for phospho-smad 1/5/8 and GAPDH as control. Results represent 3 or more independent experiments. molecular regulation of these innate repair mechanisms. Activation of BMP-7 Inhibits Profibrotic Pathways We hypothesized that BMP-7 has a role in renal recovery after obstruction induced injury. When examining this possibility, we found that while BMP-7 was down-regulated after UUO, BMP-7 was restored after UUO reversal (p 0.005, fig. 3, A). Similarly we found that BMP-7 up-regulation was associated with restoration of the activity of its target proteins, Smad1/5/8 (fig. 3, B). Together these findings show that the BMP-7 Smad1/5/8 pathway is activated during the repair of obstruction induced injury. Although the BMP-7 pathway is activated during renal recovery, the possibility remained that the activation of the BMP-7 pathway is merely a consequence of renal recovery itself. To determine the functional importance of BMP-7 we examined the molecular consequences of BMP-7 pathway activation in the injured kidney. Treatment with exogenous BMP-7 inhibited the transcription of several TGF- dependent genes that are central to the pathogenesis of renal injury and are normally increased in the injured kidney, including collagen 1(I), a gene that encodes a protein that is a significant contributor to fibrosis (p 0.05) 21 and -smooth muscle actin, a gene that encodes a protein that contributes to the differentiation of profibrotic myofibroblasts (p 0.005, fig. 4). 22 We next determined the mechanisms by which BMP-7 inhibits the activity of TGF- dependent pathways. Exogenous BMP-7 promoted the formation of BMP-7 regulated Smad1/5/8-Smad4 transcription factor complexes and decreased the obstruction induced formation of TGF- regulated Figure 4. BMP-7 suppressed TGF- dependent profibrotic pathways in injured kidneys. Three mice each underwent sham operation (SHAM) or 2 days (D) of UUO and were treated with PBS as control or 300 g/kg BMP-7 daily. Reverse transcriptase-pcr was done for TGF- dependent target genes. Expression was normalized as ratio to GAPDH and values were compared to those in sham operated mice. A, type I collagen. Single asterisk indicates p B, -smooth muscle actin. Triple asterisks indicate p

5 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY 2527 Figure 5. BMP-7 Smad1/5/8 pathway suppressed formation of TGF- dependent Smad4 transcription factor complexes. Three mice each underwent sham operation (SHAM) or 2 days (D) of UUO and were treated with PBS as control or 300 g/kg BMP-7 daily. A, immunoprecipitation (IP) for anti-smad4, followed by Western blot for phospho-smad 2/3 or 1/5/8, or Smad4 as control. B, Western blot for phospho-smad 2/3 and 1/5/8 proteins, and GAPDH as control. Results represent 3 or more independent experiments. Smad2/3-Smad4 transcription factor complexes in the injured kidney despite continued increased levels of activated/phosphorylated Smad2/3 proteins (fig. 5) and TGF- (data not shown). Together these findings show that activation of the BMP-7 Smad 1/5/8 pathway during renal recovery inhibits the activity of TGF- dependent Smad proteins in the injured kidney. Activation of BMP-7 Promotes Structural Repair of Kidney Given that the BMP-7 up-regulation during renal recovery suppressed TGF- dependent pathways that are central to the pathogenesis of renal injury, we hypothesized that these molecular mechanisms contribute to the repair of renal injury. Accordingly we examined the effects of augmenting BMP-7 activity after correcting obstruction. While mice with 2 days of UUO followed by correction of obstruction and a 3-day recovery period showed a 31.2% decrease in renal collagen during the recovery period, those treated with exogenous BMP-7 during the recovery period showed a 53.1% decrease in renal collagen (p 0.05, fig. 6, A). Similarly BMP-7 treatment during recovery promoted the restoration of renal architecture by stimulating a 59.7% decrease in interstitial volume compared to a 34.9% decrease in untreated mice and a 63.0% decrease in tubular volume loss compared to a 34.5% decrease in untreated mice (each p 0.01, fig. 6, B and C). Together these findings reveal that activation of the BMP-7 path- Figure 6. BMP-7 promoted kidney repair after UUO induced injury. Three mice each underwent sham operation (SHAM), 2 days (D) of UUO or 2 days of UUO followed by reversal and 3 days of recovery (REC). Mice were treated with PBS as control or 300 g/kg BMP-7 daily during obstruction, recovery or obstruction and recovery. A, kidney collagen content. Single asterisk indicates p Double asterisks indicate p B, interstitial volume. Triple asterisks indicate p C, tubular volume.

6 2528 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY way during renal recovery stimulates the restoration of renal architecture and the resolution of fibrosis in the kidney. Notably the renal protective effects of BMP-7 treatment during recovery were only minimally improved by treatment with BMP-7 during obstruction and recovery (fig. 6). Accordingly these findings show that the renal protective effects of BMP-7 during the repair of established renal injury may exceed even those of BMP-7 during the development of renal injury. Figure 7. Model of BMP-7 mediated suppression of TGF- dependent profibrotic pathways during repair of renal injury. During development of UUO induced renal injury activation of TGF- -Smad2/3 pathway unchecked by BMP-7-Smad1/5/8 pathway promoted transcription of TGF- dependent gene products, and renal architecture disruption, renal fibrosis and renal insufficiency. During renal recovery after injury BMP-7 was up-regulated and Smad1/5/8 pathway was activated, resulting in redistribution of Smad4 transcription factor complexes, suppression of activated TGF- dependent Smad2/3 proteins, resolution of fibrotic lesions in kidney and restoration of renal architecture.

7 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY 2529 DISCUSSION An important long-term goal in the treatment of obstructive uropathies is the development of therapeutic approaches to stimulate the regression of fibrosis, the repair of structural damage and ultimately the recovery of renal function after obstruction induced injury. 1 3 However, little progress has been made toward achieving this goal, in part since the processes that promote renal recovery after injury are poorly understood. 5 In our reversible UUO model the BMP-7 Smad1/ 5/8 pathway was activated during kidney repair after acute, reversible obstruction induced injury. Activation of the BMP-7 pathway promoted the resolution of fibrosis and the restoration of renal architecture during renal recovery. While BMP-7 was previously reported to prevent the development of renal injury, our studies reveal that BMP-7 has renal protective effects that extend beyond preventing renal injury per se since BMP-7 also stimulated the repair of established renal injury after the correction of obstruction. In our model the renal protective effects of treatment with exogenous BMP-7 during recovery were only minimally improved by treatment with exogenous BMP-7 during obstruction and recovery. Given the absent synergistic effect, these findings suggest that the repair promoting functions of BMP-7 may have had a significant role in previous studies of the renal protective effects of BMP-7 during the development of obstruction induced renal injury At the molecular level the restoration of BMP-7 levels after obstruction correction is associated with the activation of its downstream target proteins, the Smad1/5/8 proteins. The activation of BMP-7 dependent Smad proteins opposes TGF- dependent pathways in the injured kidney by inhibiting the formation of TGF- dependent Smad2/3-Smad4 transcription factor complexes and the transcription of TGF- dependent genes (fig. 7). Given that TGF- dependent pathways are required for the pathogenesis of renal injury, 7 10 these findings suggest that the activation of BMP-7 dependent Smad proteins has an important role in renal recovery after injury and in the renal protective effects of BMP-7. Nonetheless, the precise molecular mechanisms downstream of BMP-7 that promote renal recovery remain to be elucidated in future studies. It is likely that at least some repair promoting functions of BMP-7 may be attributable to its ability to counter TGF-. For example, BMP-7 may oppose TGF- induced matrix protein synthesis, protease inhibition, and myofibroblast recruitment and differentiation. 7,23 Other repair promoting functions of BMP-7 may be attributable to functions independent of TGF-, such as its ability to act as a renal morphogen. 14 BMP-7 is indispensable for kidney development during embryogenesis 14,23 and in turn for tissue repair and the replacement of damaged cells through regeneration involved processes analogous to embryogenesis. 24 Along with identifying the downstream molecular mechanisms that contribute to BMP-7 stimulated kidney repair, important future goals are to determine why these pathways are impaired in cases of prolonged obstruction that leads to permanent renal injury and also develop therapeutic approaches to reactivate these innate repair mechanisms in the kidney during treatment for obstructive uropathy. CONCLUSIONS As we work toward a better understanding of renal recovery after injury, reversible models of acute renal injury will serve as invaluable tools to elucidate the innate repair mechanisms of the kidney. We report that activation of the BMP-7-Smad1/5/8 pathway promotes the resolution of fibrosis and the restoration of renal architecture during renal recovery after the reversal of obstruction. Together these findings show that the BMP-7 Smad1/5/8 pathway has an important role in the repair of renal injury that results from obstructive uropathy. Accordingly the BMP-7 pathway represents a potential target of adjuvant therapy to stimulate the innate repair mechanisms of the kidney during treatment for obstructive uropathy. REFERENCES 1. Roth KS, Koo HP, Spottswood SE et al: Obstructive uropathy: an important cause of chronic renal failure in children. Clin Pediatr (Phila) 2002; 41: Chevalier RL: Pathogenesis of renal injury in obstructive uropathy. Curr Opin Pediatr 2006; 18: Chevalier RL: Obstructive nephropathy: towards biomarker discovery and gene therapy. Nat Clin Pract Nephrol 2006; 2: Hostetter TH: Progression of renal disease and renal hypertrophy. Annu Rev Physiol 1995; 57: Little MH: Regrow or repair: potential regenerative therapies for the kidney. J Am Soc Nephrol 2006; 17: Cochrane AL, Kett MM, Samuel CS et al: Renal structural and functional repair in a mouse model of reversal of ureteral obstruction. J Am Soc Nephrol 2005; 16: Bottinger EP: TGF-beta in renal injury and disease. Semin Nephrol 2007; 27: Gagliardini E and Benigni A: Role of anti-tgfbeta antibodies in the treatment of renal injury. Cytokine Growth Factor Rev 2006; 17: Isaka Y, Tsujie M, Ando Y et al: Transforming growth factor-beta 1 antisense oligodeoxynucle-

8 2530 BMP-7 SMAD1/5/8 PATHWAY PROMOTES KIDNEY REPAIR AFTER INJURY otides block interstitial fibrosis in unilateral ureteral obstruction. Kidney Int 2000; 58: Miyajima A, Chen J, Lawrence C et al: Antibody to transforming growth factor-beta ameliorates tubular apoptosis in unilateral ureteral obstruction. Kidney Int 2000; 58: Miyazono K, Kusanagi K and Inoue H: Divergence and convergence of TGF-beta/BMP signaling. J Cell Physiol 2001; 187: Massague J: How cells read TGF-beta signals. Nat Rev Mol Cell Biol 2000; 1: Derynck R and Zhang YE: Smad-dependent and Smad-independent pathways in TGF-beta family signalling. Nature 2003; 425: Patel SR and Dressler GR: BMP7 signaling in renal development and disease. Trends Mol Med 2005; 11: Zeisberg M, Bottiglio C, Kumar N et al: Bone morphogenic protein-7 inhibits progression of chronic renal fibrosis associated with two genetic mouse models. Am J Physiol Renal Physiol 2003; 285: F Hruska KA, Guo G, Wozniak M et al: Osteogenic protein-1 prevents renal fibrogenesis associated with ureteral obstruction. Am J Physiol Renal Physiol 2000; 279: F Zeisberg M, Hanai J, Sugimoto H et al: BMP-7 counteracts TGF-beta1-induced epithelial-to-mesenchymal transition and reverses chronic renal injury. Nat Med 2003; 9: Zeisberg M, Shah AA and Kalluri R: Bone morphogenic protein-7 induces mesenchymal to epithelial transition in adult renal fibroblasts and facilitates regeneration of injured kidney. J Biol Chem 2005; 280: Morrissey J, Hruska K, Guo G et al: Bone morphogenetic protein-7 improves renal fibrosis and accelerates the return of renal function. J Am Soc Nephrol, suppl., 2002; 13: S Samuel CS: Determination of collagen content, concentration, and sub-types in kidney tissue. Methods Mol Biol 2009; 466: Ritzenthaler JD, Goldstein RH, Fine A et al: Regulation of the alpha 1(I) collagen promoter via a transforming growth factor-beta activation element. J Biol Chem 1993; 268: Hautmann MB, Madsen CS and Owens GK: A transforming growth factor beta (TGFbeta) control element drives TGFbeta-induced stimulation of smooth muscle alpha-actin gene expression in concert with two CArG elements. J Biol Chem 1997; 272: Hogan BL: Bone morphogenetic proteins: multifunctional regulators of vertebrate development. Genes Dev 1996; 10: Martin P and Parkhurst SM: Parallels between tissue repair and embryo morphogenesis. Development 2004; 131: 3021.

HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy

HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy HDAC Dependent Transcriptional Repression of Bmp-7 Potentiates TGF-b Mediated Renal Fibrosis in Obstructive Uropathy Scott R. Manson, Joseph B. Song, Keith A. Hruska and Paul F. Austin* From the Division

More information

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury

Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Transforming growth factor-b1 stimulates hedgehog signaling to promote epithelial mesenchymal transition after kidney injury Hong Lu 1, Bicheng Chen 2, Weilong Hong 2, Yong Liang 2 and Yongheng Bai 2 1

More information

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity

Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Gallic acid prevents isoproterenol-induced cardiac hypertrophy and fibrosis through regulation of JNK2 signaling and Smad3 binding activity Yuhee Ryu 1,+, Li Jin 1,2+, Hae Jin Kee 1,, Zhe Hao Piao 3, Jae

More information

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice

Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice J Am Soc Nephrol 13: 2464 2477, 2002 Hepatocyte Growth Factor Gene Therapy and Angiotensin II Blockade Synergistically Attenuate Renal Interstitial Fibrosis in Mice JUNWEI YANG, CHUNSUN DAI, and YOUHUA

More information

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling

Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Loss of Klotho Contributes to Kidney Injury by Derepression of Wnt/b-Catenin Signaling Lili Zhou,* Yingjian Li, Dong Zhou, Roderick J. Tan, and Youhua Liu* *Division of Nephrology, Nanfang Hospital, Southern

More information

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral

Downregulation of angiotensin type 1 receptor and nuclear factor-κb. by sirtuin 1 contributes to renoprotection in unilateral ureteral Supplementary Information Downregulation of angiotensin type 1 receptor and nuclear factor-κb by sirtuin 1 contributes to renoprotection in unilateral ureteral obstruction Shao-Yu Yang 1,2, Shuei-Liong

More information

Bone morphogenic protein-7 and the kidney: current concepts and open questions

Bone morphogenic protein-7 and the kidney: current concepts and open questions NDT Advance Access published December 22, 2005 Nephrol Dial Transplant (2005) 1 of 5 doi:10.1093/ndt/gfk010 Editorial Comment Bone morphogenic protein-7 and the kidney: current concepts and open questions

More information

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury

Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting. protein3) regulate autophagy and mitophagy in renal tubular cells in. acute kidney injury Sestrin2 and BNIP3 (Bcl-2/adenovirus E1B 19kDa-interacting protein3) regulate autophagy and mitophagy in renal tubular cells in acute kidney injury by Masayuki Ishihara 1, Madoka Urushido 2, Kazu Hamada

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION FOR Liver X Receptor α mediates hepatic triglyceride accumulation through upregulation of G0/G1 Switch Gene 2 (G0S2) expression I: SUPPLEMENTARY METHODS II: SUPPLEMENTARY FIGURES

More information

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression

Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Enhancer of Zeste Homolog 2 Inhibition Attenuates Renal Fibrosis by Maintaining Smad7 and Phosphatase and Tensin Homolog Expression Xiaoxu Zhou,* Xiujuan Zang,* Murugavel Ponnusamy,* Monica V. Masucci,*

More information

Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function

Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function J Am Soc Nephrol 13: S14 S21, 2002 Bone Morphogenetic Protein-7 Improves Renal Fibrosis and Accelerates the Return of Renal Function JEREMIAH MORRISSEY,* KEITH HRUSKA,* GUANGJIE GUO,* SONG WANG,* QING

More information

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-

(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14- 1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish

More information

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis

Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Genetic or Pharmacologic Blockade of EGFR Inhibits Renal Fibrosis Na Liu,* Jian-Kan Guo, Maoyin Pang, Evelyn Tolbert, Murugavel Ponnusamy, Rujun Gong, George Bayliss, Lance D. Dworkin, Haidong Yan,* and

More information

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry:

General Laboratory methods Plasma analysis: Gene Expression Analysis: Immunoblot analysis: Immunohistochemistry: General Laboratory methods Plasma analysis: Plasma insulin (Mercodia, Sweden), leptin (duoset, R&D Systems Europe, Abingdon, United Kingdom), IL-6, TNFα and adiponectin levels (Quantikine kits, R&D Systems

More information

Hepatocyte Growth Factor Suppresses Renal Interstitial Myofibroblast Activation and Intercepts Smad Signal Transduction

Hepatocyte Growth Factor Suppresses Renal Interstitial Myofibroblast Activation and Intercepts Smad Signal Transduction American Journal of Pathology, Vol. 163, No. 2, August 2003 Copyright American Society for Investigative Pathology Hepatocyte Growth Factor Suppresses Renal Interstitial Myofibroblast Activation and Intercepts

More information

Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System

Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System BASIC RESEARCH www.jasn.org Vitamin D Receptor Attenuates Renal Fibrosis by Suppressing the Renin-Angiotensin System Yan Zhang,* Juan Kong,* Dilip K. Deb,* Anthony Chang, and Yan Chun Li* Departments of

More information

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal

Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal BRIEF COMMUNICATION www.jasn.org Fibroblasts in Kidney Fibrosis Emerge via Endothelialto-Mesenchymal Transition Elisabeth M. Zeisberg,* Scott E. Potenta,* Hikaru Sugimoto,* Michael Zeisberg,* and Raghu

More information

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice

BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice SUPPLEMENTARY MATERIALS BMP6 treatment compensates for the molecular defect and ameliorates hemochromatosis in Hfe knockout mice Elena Corradini, Paul J. Schmidt, Delphine Meynard, Cinzia Garuti, Giuliana

More information

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot

Islet viability assay and Glucose Stimulated Insulin Secretion assay RT-PCR and Western Blot Islet viability assay and Glucose Stimulated Insulin Secretion assay Islet cell viability was determined by colorimetric (3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide assay using CellTiter

More information

Effect of Taurine on Acinar Cell Apoptosis and Pancreatic Fibrosis in Dibutyltin Dichloride-induced Chronic Pancreatitis

Effect of Taurine on Acinar Cell Apoptosis and Pancreatic Fibrosis in Dibutyltin Dichloride-induced Chronic Pancreatitis 212 66 4 329334 Effect of Taurine on Acinar Cell Apoptosis and Pancreatic Fibrosis in Dibutyltin Dichloride-induced Chronic Pancreatitis a,c a* b b a a b a a b c 33 66 4 ʼ 6 6 6 28 6 5 5 5 28 45 ʼ ʼ ʼ

More information

Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy

Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy 638 Losartan attenuates renal interstitial fibrosis and tubular cell apoptosis in a rat model of obstructive nephropathy PING HE, DETIN LI and EIRU ZHNG Department of Nephrology, Shengjing Hospital of

More information

Supplemental Information

Supplemental Information Supplemental Information Tobacco-specific Carcinogen Induces DNA Methyltransferases 1 Accumulation through AKT/GSK3β/βTrCP/hnRNP-U in Mice and Lung Cancer patients Ruo-Kai Lin, 1 Yi-Shuan Hsieh, 2 Pinpin

More information

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression

Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression Supplementary Figure 1 Supplementary Figure 1 Role of Raf-1 in TLR2-Dectin-1-mediated cytokine expression. Quantitative real-time PCR of indicated mrnas in DCs stimulated with TLR2-Dectin-1 agonist zymosan

More information

Regenerative Medicine for Sclerotic Disorders

Regenerative Medicine for Sclerotic Disorders Regenerative Medicine Regenerative Medicine for Sclerotic Disorders JMAJ 7(7): 3 37, Toshikazu NAKAMURA rofessor, Division of Molecular Regenerative Medicine, Course of Advanced Medicine, Osaka University

More information

BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition in human proximal tubule epithelial cells

BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition in human proximal tubule epithelial cells NDT Advance Access published December 4, 2008 Nephrol Dial Transplant (2008) 1 of 10 doi: 10.1093/ndt/gfn662 Original Article BMP-7 fails to attenuate TGF-β1-induced epithelial-to-mesenchymal transition

More information

Niki Prakoura. Calreticulin upregulation in renal fibrosis

Niki Prakoura. Calreticulin upregulation in renal fibrosis Calreticulin upregulation in renal fibrosis Niki Prakoura Section of Histology, Center of Basic Research, Biomedical Research Foundation of the Academy of Athens, Athens, Greece EuroKUP meeting, Madrid,

More information

Hepatocyte growth factor (HGF) has recently emerged

Hepatocyte growth factor (HGF) has recently emerged A Novel Mechanism by which Hepatocyte Growth Factor Blocks Tubular Epithelial to Mesenchymal Transition Junwei Yang,* Chunsun Dai,* and Youhua Liu* *Division of Cellular and Molecular Pathology, Department

More information

RayBio KinaseSTAR TM Akt Activity Assay Kit

RayBio KinaseSTAR TM Akt Activity Assay Kit Activity Assay Kit User Manual Version 1.0 March 13, 2015 RayBio KinaseSTAR TM Akt Activity Kit Protocol (Cat#: 68AT-Akt-S40) RayBiotech, Inc. We Provide You With Excellent Support And Service Tel:(Toll

More information

renoprotection therapy goals 208, 209

renoprotection therapy goals 208, 209 Subject Index Aldosterone, plasminogen activator inhibitor-1 induction 163, 164, 168 Aminopeptidases angiotensin II processing 64 66, 214 diabetic expression 214, 215 Angiotensin I intrarenal compartmentalization

More information

Supplementary Figure 1:

Supplementary Figure 1: Supplementary Figure 1: (A) Whole aortic cross-sections stained with Hematoxylin and Eosin (H&E), 7 days after porcine-pancreatic-elastase (PPE)-induced AAA compared to untreated, healthy control aortas

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR

More information

1. Materials and Methods 1.1 Animals experiments process The experiments were approved by the Institution Animal Ethics Committee of Jilin University

1. Materials and Methods 1.1 Animals experiments process The experiments were approved by the Institution Animal Ethics Committee of Jilin University 1. Materials and Methods 1.1 Animals experiments process The experiments were approved by the Institution Animal Ethics Committee of Jilin University (Reference NO. 2015-003). 96 Kunming (KM) mice (8 weeks;

More information

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry

TFEB-mediated increase in peripheral lysosomes regulates. Store Operated Calcium Entry TFEB-mediated increase in peripheral lysosomes regulates Store Operated Calcium Entry Luigi Sbano, Massimo Bonora, Saverio Marchi, Federica Baldassari, Diego L. Medina, Andrea Ballabio, Carlotta Giorgi

More information

Supplementary data Supplementary Figure 1 Supplementary Figure 2

Supplementary data Supplementary Figure 1 Supplementary Figure 2 Supplementary data Supplementary Figure 1 SPHK1 sirna increases RANKL-induced osteoclastogenesis in RAW264.7 cell culture. (A) RAW264.7 cells were transfected with oligocassettes containing SPHK1 sirna

More information

The Immunoassay Guide to Successful Mass Spectrometry. Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013

The Immunoassay Guide to Successful Mass Spectrometry. Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013 The Immunoassay Guide to Successful Mass Spectrometry Orr Sharpe Robinson Lab SUMS User Meeting October 29, 2013 What is it? Hey! Look at that! Something is reacting in here! I just wish I knew what it

More information

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein

Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Protection against doxorubicin-induced myocardial dysfunction in mice by cardiac-specific expression of carboxyl terminus of hsp70-interacting protein Lei Wang 1, Tian-Peng Zhang 1, Yuan Zhang 2, Hai-Lian

More information

Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury

Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury BASIC RESEARCH www.jasn.org Blockade of Wnt/ -Catenin Signaling by Paricalcitol Ameliorates Proteinuria and Kidney Injury Weichun He, Young Sun Kang, Chunsun Dai, and Youhua Liu Department of Pathology,

More information

hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This

hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Figures Supplementary Figure S1. Binding of full-length OGT and deletion mutants to PIP strips (Echelon Biosciences). Supplementary Figure S2. Binding of the OGT (919-1036) fragments with

More information

Supplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim.

Supplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Supplemental Data TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Molly A. Taylor 1, Khalid Sossey-Alaoui 2, Cheryl L. Thompson 3, David Danielpour 4, and William

More information

PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION

PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION A L L O S O U R C E PROCHONDRIX CARTILAGE RESTORATION MATRIX CONTAINS GROWTH FACTORS NECESSARY FOR HYALINE CARTILAGE REGENERATION Ryan Delaney MS; Carolyn Barrett BS, MBA; Peter Stevens PhD, MBA AlloSource,

More information

Uncovering the mechanisms of wound healing and fibrosis

Uncovering the mechanisms of wound healing and fibrosis Any Questions??? Ask now or contact support support@sabiosciences.com 1-888-503-3187 International customers: SABio@Qiagen.com Uncovering the mechanisms of wound healing and fibrosis Webinar related questions:

More information

Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor

Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor Int J Clin Exp Pathol 2014;7(7):3537-3547 www.ijcep.com /ISSN:1936-2625/IJCEP0000537 Original Article BMP-7 attenuates liver fibrosis via regulation of epidermal growth factor receptor Li-Ping Wang 1*,

More information

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats

Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Analysis on the mechanism of reduced nephron number and the pathological progression of chronic renal failure in Astrin deficient rats Summary of Doctoral Thesis Hidenori Yasuda Graduate School of Veterinary

More information

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.

Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12. Supplementary Figure 1: Hsp60 / IEC mice are embryonically lethal (A) Light microscopic pictures show mouse embryos at developmental stage E12.5 and E13.5 prepared from uteri of dams and subsequently genotyped.

More information

Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit User Manual (v5)

Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit User Manual (v5) Minute TM Plasma Membrane Protein Isolation and Cell Fractionation Kit Catalog number: SM-005 Description Minute TM plasma membrane (PM) protein isolation kit is a novel and patented native PM protein

More information

Supporting Information

Supporting Information Supporting Information Pang et al. 10.1073/pnas.1322009111 SI Materials and Methods ELISAs. These assays were performed as previously described (1). ELISA plates (MaxiSorp Nunc; Thermo Fisher Scientific)

More information

Cellular Physiology and Biochemistry

Cellular Physiology and Biochemistry Original Paper 2015 The Author(s). 2015 Published The Author(s) by S. Karger AG, Basel Published online: November 27, 2015 www.karger.com/cpb Published by S. Karger AG, Basel 2194 1421-9778/15/0376-2194$39.50/0

More information

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2

Online Data Supplement. Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Online Data Supplement Anti-aging Gene Klotho Enhances Glucose-induced Insulin Secretion by Upregulating Plasma Membrane Retention of TRPV2 Yi Lin and Zhongjie Sun Department of physiology, college of

More information

Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the

Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the Supplementary Figure 1. HOPX is hypermethylated in NPC. (a) Methylation levels of HOPX in Normal (n = 24) and NPC (n = 24) tissues from the genome-wide methylation microarray data. Mean ± s.d.; Student

More information

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention

Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention REVIEW J Am Soc Nephrol 15: 1 12, 2004 Epithelial to Mesenchymal Transition in Renal Fibrogenesis: Pathologic Significance, Molecular Mechanism, and Therapeutic Intervention YOUHUA LIU Division of Cellular

More information

Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were

Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were Supplementary Figure 1 CD4 + T cells from PKC-θ null mice are defective in NF-κB activation during T cell receptor signaling. CD4 + T cells were isolated from wild type (PKC-θ- WT) or PKC-θ null (PKC-θ-KO)

More information

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in

hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and function in SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. Fbn1 C1039G/+ hearts display normal cardiac function in the absence of hemodynamic stress. A. Echocardiographic quantification of cardiac dimensions and

More information

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance

Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Salt Sensitivity: Mechanisms, Diagnosis, and Clinical Relevance Matthew R. Weir, MD Professor and Director Division of Nephrology University of Maryland School of Medicine Overview Introduction Mechanisms

More information

Requires Signaling though Akt2 Independent of the. Transcription Factors FoxA2, FoxO1, and SREBP1c

Requires Signaling though Akt2 Independent of the. Transcription Factors FoxA2, FoxO1, and SREBP1c Cell Metabolism, Volume 14 Supplemental Information Postprandial Hepatic Lipid Metabolism Requires Signaling though Akt2 Independent of the Transcription Factors FoxA2, FoxO1, and SREBP1c Min Wan, Karla

More information

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)

(a) Significant biological processes (upper panel) and disease biomarkers (lower panel) Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory

More information

Plasma exposure levels from individual mice 4 hours post IP administration at the

Plasma exposure levels from individual mice 4 hours post IP administration at the Supplemental Figure Legends Figure S1. Plasma exposure levels of MKC-3946 in mice. Plasma exposure levels from individual mice 4 hours post IP administration at the indicated dose mg/kg. Data represent

More information

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation.

Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. Supplementary Figure 1: si-craf but not si-braf sensitizes tumor cells to radiation. (a) Embryonic fibroblasts isolated from wildtype (WT), BRAF -/-, or CRAF -/- mice were irradiated (6 Gy) and DNA damage

More information

Supplementary Materials for

Supplementary Materials for immunology.sciencemag.org/cgi/content/full/2/16/eaan6049/dc1 Supplementary Materials for Enzymatic synthesis of core 2 O-glycans governs the tissue-trafficking potential of memory CD8 + T cells Jossef

More information

Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant

Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant Children's Hospital of Pittsburgh Annual Progress Report: 2008 Formula Grant Reporting Period July 1, 2011 June 30, 2012 Formula Grant Overview The Children's Hospital of Pittsburgh received $958,038 in

More information

HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced

HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced HDAC Inhibition for Prevention of Fibrosis Following Sepsisinduced AKI John A. Kellum, MD, MCCM Professor of Critical Care Medicine, Medicine, Bioengineering and Clinical & Translational Science Vice Chair

More information

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial

Suppl Video: Tumor cells (green) and monocytes (white) are seeded on a confluent endothelial Supplementary Information Häuselmann et al. Monocyte induction of E-selectin-mediated endothelial activation releases VE-cadherin junctions to promote tumor cell extravasation in the metastasis cascade

More information

Summary 255 Research Summary

Summary 255 Research Summary Chapter 10 Summary Nephrolithiasis remains a public health problem around the world, affecting 12% of the adult population. The prevalence and incidence of kidney stones are increasing with global warming,

More information

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair

Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Regulation of the IGF axis by TGF-b during periosteal chondrogenesis: implications for articular cartilage repair Chapter 04 Boek 1_Gie.indb 55 21-05-2007 12:27:33 Chapter 04 Abstract Goal: TGF-b and IGF-I

More information

Product Datasheet. CD133 Antibody NB Unit Size: 0.1 mg

Product Datasheet. CD133 Antibody NB Unit Size: 0.1 mg Product Datasheet CD133 Antibody NB120-16518 Unit Size: 0.1 mg Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 8 Protocols, Publications, Related Products,

More information

Supplementary Information

Supplementary Information Supplementary Information Supplementary Figure 1. CD4 + T cell activation and lack of apoptosis after crosslinking with anti-cd3 + anti-cd28 + anti-cd160. (a) Flow cytometry of anti-cd160 (5D.10A11) binding

More information

PRODUCT INFORMATION & MANUAL

PRODUCT INFORMATION & MANUAL PRODUCT INFORMATION & MANUAL 0.4 micron for Overall Exosome Isolation (Cell Media) NBP2-49826 For research use only. Not for diagnostic or therapeutic procedures. www.novusbio.com - P: 303.730.1950 - P:

More information

Supplementary Materials and Methods

Supplementary Materials and Methods Supplementary Materials and Methods Immunoblotting Immunoblot analysis was performed as described previously (1). Due to high-molecular weight of MUC4 (~ 950 kda) and MUC1 (~ 250 kda) proteins, electrophoresis

More information

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells

MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells MicroRNA sponges: competitive inhibitors of small RNAs in mammalian cells Margaret S Ebert, Joel R Neilson & Phillip A Sharp Supplementary figures and text: Supplementary Figure 1. Effect of sponges on

More information

STAT1 (ps727) (Human/Mouse) ELISA Kit

STAT1 (ps727) (Human/Mouse) ELISA Kit STAT1 (ps727) (Human/Mouse) ELISA Kit Catalog Number KA2171 96 assays Version: 01 Intended for research use only www.abnova.com I. INTRODUCTION STAT1 (ps727) (Human/Mouse) ELISA (Enzyme-Linked Immunosorbent

More information

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands)

MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) Supplemental data Materials and Methods Cell culture MTC-TT and TPC-1 cell lines were cultured in RPMI medium (Gibco, Breda, The Netherlands) supplemented with 15% or 10% (for TPC-1) fetal bovine serum

More information

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences.

SUPPLEMENTARY DATA. Supplementary Table 2. Antibodies used for Immunofluoresence. Supplementary Table 3. Real-time PCR primer sequences. Supplementary Table 2. Antibodies used for Immunofluoresence. Antibody Dilution Source Goat anti-pdx1 1:100 R&D Systems Rabbit anti-hnf6 1:100 Santa Cruz Biotechnology Mouse anti-nkx6.1 1:200 Developmental

More information

The Schedule and the Manual of Basic Techniques for Cell Culture

The Schedule and the Manual of Basic Techniques for Cell Culture The Schedule and the Manual of Basic Techniques for Cell Culture 1 Materials Calcium Phosphate Transfection Kit: Invitrogen Cat.No.K2780-01 Falcon tube (Cat No.35-2054:12 x 75 mm, 5 ml tube) Cell: 293

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 The average sigmoid parametric curves of capillary dilation time courses and average time to 50% peak capillary diameter dilation computed from individual capillary responses averaged

More information

Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator. of the Interaction with Macrophages

Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator. of the Interaction with Macrophages Serum Amyloid A3 Gene Expression in Adipocytes is an Indicator of the Interaction with Macrophages Yohei Sanada, Takafumi Yamamoto, Rika Satake, Akiko Yamashita, Sumire Kanai, Norihisa Kato, Fons AJ van

More information

CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt

CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Supplementary Information CYLD Negatively Regulates Transforming Growth Factor-β Signaling via Deubiquitinating Akt Jae Hyang Lim, Hirofumi Jono, Kensei Komatsu, Chang-Hoon Woo, Jiyun Lee, Masanori Miyata,

More information

The mirna-184 drives renal fibrosis by targeting HIF1AN in vitro and in vivo

The mirna-184 drives renal fibrosis by targeting HIF1AN in vitro and in vivo https://doi.org/10.1007/s11255-018-2025-4 NEPHROLOGY - ORIGINAL PAPER The mirna-184 drives renal fibrosis by targeting HIF1AN in vitro and in vivo Bin Chen 1 Received: 18 December 2017 / Accepted: 3 November

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/8/389/ra79/dc1 Supplementary Materials for HDL-bound sphingosine 1-phosphate acts as a biased agonist for the endothelial cell receptor S1P 1 to limit vascular

More information

Novel therapeutic approach for kidney fibrosis

Novel therapeutic approach for kidney fibrosis University of Sydney Novel therapeutic approach for kidney fibrosis DAVID HARRIS 30/09/17 Westmead Hospital Cadnapaphornchai CJASN 2014;9:889 Liraglutide: Renal Outcomes Mann JFE et al. N Engl J Med 2017;377:839-848

More information

Supplementary Materials:

Supplementary Materials: Supplementary Materials: Supplemental Figure 1: Profibrotic markers in wt/wt or ex/ex mouse kidneys 42 days post IRI. The levels of fibronectin and αsma were examined by immunostaining in ADAM17 wt/wt

More information

Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit

Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit PROTOCOL Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit DESCRIPTION Mitochondrial Trifunctional Protein (TFP) Protein Quantity Microplate Assay Kit Sufficient materials

More information

HIF-P4H-2 deficiency protects against skeletal muscle ischemia-reperfusion injury

HIF-P4H-2 deficiency protects against skeletal muscle ischemia-reperfusion injury J Mol Med 2015 HIF-P4H-2 deficiency protects against skeletal muscle ischemia-reperfusion injury Sara Karsikas; Mikko Myllymäki; Minna Heikkilä; Raija Sormunen; Kari I Kivirikko; Johanna Myllyharju; Raisa

More information

Tissue repair. (3&4 of 4)

Tissue repair. (3&4 of 4) Tissue repair (3&4 of 4) What will we discuss today: Regeneration in tissue repair Scar formation Cutaneous wound healing Pathologic aspects of repair Regeneration in tissue repair Labile tissues rapid

More information

Exosomes Immunocapture and Isolation Tools: Immunobeads

Exosomes Immunocapture and Isolation Tools: Immunobeads Product Insert Exosomes Immunocapture and Isolation Tools: Immunobeads HBM-BOLF-##/##-# HBM-BOLC-##/##-# HBM-BTLF-##/##-# Overall Exosome capture from Human Biological fluids Overall Exosome capture from

More information

Protocol for Gene Transfection & Western Blotting

Protocol for Gene Transfection & Western Blotting The schedule and the manual of basic techniques for cell culture Advanced Protocol for Gene Transfection & Western Blotting Schedule Day 1 26/07/2008 Transfection Day 3 28/07/2008 Cell lysis Immunoprecipitation

More information

Role of Tyk-2 in Th9 and Th17 cells in allergic asthma

Role of Tyk-2 in Th9 and Th17 cells in allergic asthma Supplementary File Role of Tyk-2 in Th9 and Th17 cells in allergic asthma Caroline Übel 1*, Anna Graser 1*, Sonja Koch 1, Ralf J. Rieker 2, Hans A. Lehr 3, Mathias Müller 4 and Susetta Finotto 1** 1 Laboratory

More information

Obstructive nephropathy: Insights from genetically engineered animals

Obstructive nephropathy: Insights from genetically engineered animals Kidney International, Vol. 68 (2005), pp. 925 937 Obstructive nephropathy: Insights from genetically engineered animals JEAN-LOUP BASCANDS and JOOST P. SCHANSTRA Inserm U388, Institut Louis Bugnard, Touluse

More information

Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice

Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice Toll-like receptor 4 promotes fibrosis in bleomycin-induced lung injury in mice X.X. Li 1,2, D.Y. Jiang 1, X.X. Huang 1, S.L. Guo 1, W. Yuan 1 and H.P. Dai 1 1 Beijing Key Laboratory of Respiratory and

More information

Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent Protein.

Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent Protein. prfp-vector RFP Exon1 Intron RFP Exon2 prfp-mir-124 mir-93/124 RFP Exon1 Intron RFP Exon2 Untransfected prfp-vector prfp-mir-93 prfp-mir-124 Supplementary Fig. 1. Delivery of mirnas via Red Fluorescent

More information

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min

Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR-2B cells untreated (-) or stimulated (+) for 45 min Figure S1. Sorting nexin 9 (SNX9) specifically binds psmad3 and not psmad 1/5/8. Lysates from AKR2B cells untreated () or stimulated () for 45 min with 5 ng/ml TGFβ or 10 ng/ml BMP4 were incubated with

More information

References. Plasma renin activity (PRA) PRA was measured by a radioimmunoassay kit (Wallac, Tokyo, Japan).

References. Plasma renin activity (PRA) PRA was measured by a radioimmunoassay kit (Wallac, Tokyo, Japan). Detailed Methods Experiment I enos / mice were purchased from Jackson Laboratory (Bar Harbor, USA). C57BL/6J mice on the same genetic background were purchased from KBT Oriental (Hamamatsu, Japan). Eleven-week-old

More information

condition. Left panel, the HCT-116 cells were lysed with RIPA buffer containing 0.1%

condition. Left panel, the HCT-116 cells were lysed with RIPA buffer containing 0.1% FIGURE LEGENDS Supplementary Fig 1 (A) sumoylation pattern detected under denaturing condition. Left panel, the HCT-116 cells were lysed with RIPA buffer containing 0.1% SDS in the presence and absence

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10188 Supplementary Figure 1. Embryonic epicardial genes are down-regulated from midgestation stages and barely detectable post-natally. Real time qrt-pcr revealed a significant down-regulation

More information

Target Protein Antibody name Product number Manufacturer Species Epitope Dilution Aggrecan Anti-aggrecan AB1031 EMD Millipore Corp Rabbit

Target Protein Antibody name Product number Manufacturer Species Epitope Dilution Aggrecan Anti-aggrecan AB1031 EMD Millipore Corp Rabbit Family history Hypertension/ Maximum Degree of aortic Bicuspid Disease Age/Sex Diagnosed CTD of aortic disease Treated aortic insufficiency/stenosis aortic Aneurysm 63/M No Yes Yes/Yes diameter 59mm 1-2+/None

More information

Hypoxia-induced microrna-155 promotes fibrosis in proximal tubule cells

Hypoxia-induced microrna-155 promotes fibrosis in proximal tubule cells MOLECULAR MEDICINE REPORTS 11: 4555-4560, 2015 Hypoxia-induced microrna-155 promotes fibrosis in proximal tubule cells SHENPING XIE, HUAIZHOU CHEN, FEI LI, SHU WANG and JUNJUN GUO Renal Transplantation

More information

2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy

2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications. DPP-4 Inhibition and Diabetic Nephropathy 2015 ICDM, 15-17, Jejudob Island, Korea Recent Advances in Diabetic Microvascular Complications DPP-4 Inhibition and Diabetic Nephropathy Daisuke Koya Department of Diabetology & Endocrinology Kanazawa

More information

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population.

CHAPTER I INTRODUCTION. Nowadays chronic kidney disease (CKD) becomes one. of the most common diseases found in the population. CHAPTER I INTRODUCTION I.1 Background Nowadays chronic kidney disease (CKD) becomes one of the most common diseases found in the population. Based on community survey that is held by PERNEFRI (Perhimpunan

More information