Product Datasheet. MMR/CD206/Mannose Receptor Antibody (5C11) H M02. Unit Size: 0.1 mg

Transcription

1 Product Datasheet MMR/CD206/Mannose Receptor Antibody (5C11) H M02 Unit Size: 0.1 mg Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Publications: 14 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 4/17/2017 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 H M02 MMR/CD206/Mannose Receptor Antibody (5C11) Product Information Unit Size Concentration Storage Clonality Clone Preservative Isotype Purity 0.1 mg Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Monoclonal 5C11 No Preservative IgG1 Kappa IgG purified Buffer PBS (ph 7.4) Product Description Host Mouse Gene ID 4360 Gene Symbol Species MRC1 Human, Fungi Reactivity Notes Fungi reactivity reported in scientific literature (PMID: ). Specificity/Sensitivity Immunogen Notes MRC1 (5C11) Page 1 of 4 v.20.1 Updated 4/17/2017 MRC1 (NP_002429, 22 a.a a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLC LGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNI MLY Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan. Product Application Details Applications Recommended Dilutions Application Notes Western Blot, ELISA, Immunohistochemistry-Paraffin Western Blot, ELISA, Immunohistochemistry-Paraffin Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

3 Images Western Blot: MMR/CD206/Mannose Receptor Antibody (5C11) [H M02] - MRC1 monoclonal antibody (M02), clone 5C11. Analysis of MRC1 expression in human pancreas. Page 2 of 4 v.20.1 Updated 4/17/2017 Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (5C11) [H M02] - Analysis of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml. ELISA: MMR/CD206/Mannose Receptor Antibody (5C11) [H M02] - Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.

4 Publications Itano MS, Graus MS, Pehlke C et al. Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites. Frontiers in Physics 2014 Jul 18 (ICC/IF, Human) Weber M, Schlittenbauer T, Moebius P et al. Macrophage polarization differs between apical granulomas, radicular cysts, and dentigerous cysts. Clin Oral Investig 2017 May 13 [PMID: ] Nakagawa T, Ohnishi K, Kosaki Y et al. Optimum immunohistochemical procedures for analysis of macrophages in human and mouse formalin fixed paraffin-embedded tissue samples. J Clin Exp Hematop 2017 May 8 [PMID: ] Olmes G, Buttner-Herold M, Ferrazzi F et al. CD163+ M2c-like macrophages predominate in renal biopsies from patients with lupus nephritis. Arthritis Res Ther 2016 Apr 18 [PMID: ] Weber M, Lliopoulos C, Moebius P et al. Prognostic significance of macrophage polarization in early stage oral squamous cell carcinomas. Oral Oncology 2015 Nov 19 [PMID: ] Itano MS, Graus MS, Pehlke C et al. Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites. Front. Phys [PMID: ] Zhuang PY, Zhu MJ, Wang JD et al. Xanthogranulomatous cholecystitis: A clinicopathological study of its association with gallbladder carcinoma. J Dig Dis Sep 21 [PMID: ] Weber M, Buttner-Herold M, Hyckel P et al. Small oral squamous cell carcinomas with nodal lymphogenic metastasis show increased infiltration of M2 polarized macrophages - an immunohistochemical analysis. Journal of Cranio- Maxillofacial Surgery [PMID: ] Hirata Y, Tabata M, Kurobe H et al. Coronary Atherosclerosis Is Associated With Macrophage Polarization in Epicardial Adipose Tissue. J Am Coll Cardiol Jul 12 [PMID: ] Canna SW, Costa-Reis P, Bernal WE et al. Alternative activation of laser-captured murine hemophagocytes. Arthritis Rheumatol Jan 27 [PMID: ] Wehrhan F, Buttner-Herold M, Hyckel P et al. Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study. BMC Cancer Jul 21 [PMID: ] Holder GE, McGary CM, Johnson EM et al. Expression of the Mannose Receptor CD206 in HIV and SIV Encephalitis: A Phenotypic Switch of Brain Perivascular Macrophages with Virus Infection. J Neuroimmune Pharmacol Aug 22 [PMID: ] More publications at Page 3 of 4 v.20.1 Updated 4/17/2017

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to H M02 HAF007 NB720-B NBP mg NBP PEP Goat anti-mouse IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Rabbit anti-mouse IgG (H+L) Secondary Antibody [Biotin] Mouse, Human IgG1 Kappa Light Chain Isotype Control (P ) MMR/CD206/Mannose Receptor Recombinant Protein Antigen Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: