Title: MYBBP1A suppresses breast cancer tumorigenesis by enhancing the p53 dependent anoikis
|
|
- Cynthia Walters
- 5 years ago
- Views:
Transcription
1 Author's response to reviews Title: MYBBP1A suppresses breast cancer tumorigenesis by enhancing the p53 dependent anoikis Authors: Kensuke Akaogi Wakana Ono Hiroyuki Kishimoto Junn Yanagisawa Yuki Hayashi Version: 2 Date: 21 December 2012 Author's response to reviews: see over
2 December 21, 2012 The Editor of BMC Cancer Dear Editor, RE: MS: "MYBBP1A suppresses breast cancer tumorigenesis by enhancing the p53 dependent anoikis" Thank you very much for your generally positive letter dated November 22 in We have finished additional experiments to address the concerns of Referees 1 and 2. We would like to update you about our progress and provide point-by-point responses to the Referee s comments. We believe that the changes made in response to the comments from the Referees have resulted in a stronger paper. We hope that the revised manuscript is acceptable for publication in BMC Cancer. Yours sincerely, Junn Yanagisawa Ph.D. junny@agbi.tsukuba.ac.jp University of Tsukuba Graduate school of Life and Environmental Sciences Tennodai Tsukuba Science City, Ibaraki-ken JAPAN
3 A detailed list of the revisions that were suggested by the Referee 1 Referee 1 (Comments to the Author): In this manuscript, Akaogi et al. describes tumor suppressor role of MYBBP1A protein via increase in p53-dependent anoikis in MCF7 cells. Authors performed in-silico analysis of breast cancer patients microarray databases, and carried out various in vitro transformation assays to address the potential tumor suppressor role of MYBBP1A. This is a relatively straight-forward study with few concerns as noted below- 1) Authors analyzed Oncomine database to infer the tumor suppressor role of MYBBP1A. Specifically authors use data from three studies. Authors should provide some details of breast carcinoma samples used in these studies. Are they all invasive or from different stages of breast cancer progression. If possible authors should also confirm results from Oncomine database using commercially available TMAs and IHC studies for p53 and MYBBP1A. To address the Referee s comments, we have added the following descriptions in the Methods section. Data sets obtained from TCGA Breast, Finak Breast, and Richardson Breast 2 included various stages, and all cancer samples were invasive. In addition, we performed IHC examinations using tissue microarrays and assessed MYBP1A protein levels in normal and breast tumor tissues. The description of the tissue microarrays is given in the Methods section. Decreased immunoreactivity was observed in breast tumor tissues compared with normal tissues (Figure 1B). These results supported the findings in the Oncomine database. 2) Fig. 2: Authors use a single MYBBP1A shrna, which appears to be very effective. However, there are no data presented to show the specificity of the shrna to rule out its off-target effects. To demonstrate the specificity of the shrna used and to rule out its off-target effects, we have shown the data obtained with two shrnas for MYBBP1A in Figure 2. Both shrnas for MYBBP1A effectively reduced the expression of MYBBP1A and increased the number of colonies. 3) Fig 3 needs a western blot analysis of p53 in indicated set of cells. As shown Figures 3 and 4, we showed the western blot results for p53 in the indicated set of cells.
4 4) Authors should also examine cell death markers to better define the role of MYBB1A in anoikis. To address this, we performed Annexin/PI staining and FACS analysis using cells cultured under detached conditions. p53-dependent cell death was regulated by MYBBP1A under detached conditions (Figure 5). 5) Data obtained with MCF7 cells should be confirmed using another p53 positive or a p53 reconstituted breast cancer cell line. To address this, we performed anoikis assay and real time-pcr using ZR-75-1 cells (p53-positive breast cancer cell line). The results obtained were same as those with MCF-7 cells (Figures 3C, 4B, and 6B). 6) In general, authors do not provide enough experimental details. In response to the Referee s comment, we have rewritten part of the Figure legends and the Methods section. 7) Authors need to follow guidelines to prepare manuscript properly, and have it carefully edited for typos and grammatical mistakes. We have carefully re-checked the instructions for authors and have corrected our manuscript. We have also had a scientific writer check our manuscript.
5 A detailed list of the revisions that were suggested by the Referee 2 Referee 2 (Comments to the Author): This manuscript by Akaogi et al., investigated the role and mechanism of MYBBP1A in breast cancer oncogenesis. The authors report that MYBBP1A through p53 induces anoikis in a breast cancer cell line. Although these are interesting observations, the authors need to address following concerns. Major points 1) The evidence presented for decrease in MYBBP1A expression with breast cancer progression is based on the Oncomine database analysis. The authors need to assess levels of MYBBP1A protein in different breast cancer cell lines and in tumor tissue arrays to validate the finding. In response to the Referee s comments, we compared the MYBBP1A protein levels in MCF-10A, MCF-7, and ZR-75-1 cells. As shown in Figure 1C, immunoblotting results revealed that the MYBBP1A protein levels in MCF-10A cells (mammary epithelial cells) were higher than those in the MCF-7 and ZR-75-1 cells (p53-positive breast cancer cells). In addition, we performed IHC studies using tissue microarrays and assess the levels of MYBP1A protein in normal breast tissues or breast cancer tissues. The decreased immunoreactivity was observed in breast cancer tissues comparing to normal tissues (Figure 1B). These data supports the findings in Oncomine database. 2) Authors have presented the data in one cell line MCF7. The authors should use at least one more cancer cell line and normal cell line MCF10A (as control) for their analysis to address cancer specificity concern. To address this comment, we performed the anoikis assay and Real time-pcr using ZR-75-1 cells and same results as the MCF-7 were obtained (Figures 3C, 4B and 6B). In addition, the anoikis assay using MCF-10A cells showed that p53 and MYBBP1A knockdown increased the number of viable cells under detached conditions (Figure 3A). These results indicate that MYBBP1A regulates anoikis in both normal and cancer cells. 3) The qrt-pcr primers mentioned for GAPDH are not GAPDH but are beta-actin primers-authors please correct. We apologize for this overlook. We have corrected the sequence in the Methods section.
6 4) Is MYBBP1A only induces p53-dependent anoikis? Did the authors assess for apoptosis? We previously showed that MYBBP1A was involved in apoptosis after DNA damage or glucose starvation (Kuroda et al., 2011 and Kumazawa et al., 2011). In this study, we focused on the role of MYBBP1A in p53-dependent anoikis (apoptosis under detached conditions). In response to the Referee s comment, we assessed cellular apoptosis by FACS analysis. This demonstrated that MYBBP1A induced p53-dependent apoptosis under detached conditions (Figure 5). 5) Authors state that detached condition through MYBBP1A accumulates and acetylates p53. There is no experimental proof provided for this statement. As shown in Figure 7A, detached conditions induced the accumulation and acetylation of p53 (lane 3). The accumulation and acetylation of p53 were reduced by MYBBP1A knockdown (lane 4). These results provide evidence for MYBBP1A regulation of p53 accumulation and acetylation. Minor points 6) The figure legends as well as methodology are written relatively brief and need more explanation for conditions of Anoikis assay. The authors should either describe the method in detail or reference an article if it is already published. In response to the Referee s comments, we have rewritten part of the Methods section. 7) Overall the paper is not written well and has several typographic errors and needs to be written in a more scientific language. Authors, please have a scientific writer correct the manuscript. As suggested by the referee, we have had a scientific writer check our manuscript. 8) In the background paragraph five, lane no 8, the authors have mentioned role of MYBBP1A in cancer prevention. Is there any study in which MYBBP1A was studied in relation to cancer prevention? We have rewritten this part of the background paragraph and have cited a previous study. We have added the following sentences. In addition, Sanhueza et al. recently reported that MYBBP1A regulated the proliferation and migration of head and neck squamous cell carcinoma cells [17].
7 However, the role of MYBBP1A in breast cancer prevention and detailed mechanisms underlying these activities has not been determined. 9) The authors have mentioned anoikis assay just by counting cells. Use of more quantitative method, such as MTT assay will be better. To address this, we have placed the quantitative results obtained by MTT assay next to the cell counting results.
Supplementary Figure 1
A B D Relative TAp73 mrna p73 Supplementary Figure 1 25 2 15 1 5 p63 _-tub. MDA-468 HCC1143 HCC38 SUM149 MDA-468 HCC1143 HCC38 SUM149 HCC-1937 MDA-MB-468 ΔNp63_ TAp73_ TAp73β E C Relative ΔNp63 mrna TAp73
More informationCover Letter. Reviewer 1:
Cover Letter Michael Yang, M.D., Ph.D. Managing Editor of Cancer Research Frontiers 1188 Willis Ave, #109, Albertson, NY 11507, USA Phone: +1-917-426-1571 http://cancer-research-frontiers.org/ Dear Dr.
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1 DOT1L regulates the expression of epithelial and mesenchymal markers. (a) The expression levels and cellular localizations of EMT markers were confirmed by
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Confirmation of Dnmt1 conditional knockout out mice. a, Representative images of sorted stem (Lin - CD49f high CD24 + ), luminal (Lin - CD49f low CD24 + )
More informationNFIL3/E4BP4 controls Type 2 T helper cell cytokine expression
Manuscript EMBO-2010-75657 NFIL3/E4BP4 controls Type 2 T helper cell cytokine expression Masaki Kashiwada, Suzanne L. Cassel, John D. Colgan and Paul B. Rothman Corresponding author: Paul Rothman, University
More informationTitle: Cystatin E/M suppresses legumain activity and invasion of human melanoma
Author's response to reviews Title: Cystatin E/M suppresses legumain activity and invasion of human melanoma Authors: Jon J Briggs JJB (jbriggs33@yahoo.com) Mads H Haugen MHH (Mads.Haugen@rr-research.no)
More informationTitle: Peripheral pulmonary nodules: relationship between multi-slice spiral CT perfusion imaging and tumor angiogenesis and VEGF expression
Author's response to reviews Title: Peripheral pulmonary nodules: relationship between multi-slice spiral CT perfusion imaging and tumor angiogenesis and VEGF expression Authors: Shu-Hua Ma (mashuhua6699@sina.com)
More informationDevelopment of important genes during breast carcinogenesis
Nagoya Med. J., 107 Development of important genes during breast carcinogenesis AYA NAIKI-ITO Department of experimental pathology and tumor biology Nagoya City University Graduate School of Medical Sciences
More informationTitle:Effectiveness of a quality management program in dental care practices
Author's response to reviews Title:Effectiveness of a quality management program in dental care practices Authors: Katja Goetz (katja.goetz@med.uni-heidelberg.de) Stephen M Campbell (stephen.campbell@manchester.ac.uk)
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2607 Figure S1 Elf5 loss promotes EMT in mammary epithelium while Elf5 overexpression inhibits TGFβ induced EMT. (a, c) Different confocal slices through the Z stack image. (b, d) 3D rendering
More informationPKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65
SUPPLEMENTARY INFORMATION TITLE: PKCζ Promotes Breast Cancer Invasion by Regulating Expression of E-cadherin and Zonula Occludens-1 (ZO-1) via NFκB-p65 RUNNING TITLE: PKCζ-NFκB Signaling in Breast Cancer
More informationMyelin suppresses axon regeneration by PIR-B/SHPmediated inhibition of Trk activity
Manuscript EMBO-2010-76298 Myelin suppresses axon regeneration by PIR-B/SHPmediated inhibition of Trk activity Yuki Fujita, Shota Endo, Toshiyuki Takai and Toshihide Yamashita Corresponding author: Toshihide
More informationSrc-dependent autophagic degradation of Ret in FAKsignaling defective cancer cells
Manuscript EMBOR-2011-35678 Src-dependent autophagic degradation of Ret in FAKsignaling defective cancer cells Emma Sandilands, Bryan Serrels, Simon Wilkinson and Margaret C Frame Corresponding author:
More informationAuthor's response to reviews
Author's response to reviews Title: Rapid Induction of Orthotopic Hepatocellular Carcinoma in Immune-competent Rats by Ultrasound-guided Method and the Subsequent Low-dose Chemotherapy Authors: Hoi-Hung
More informationTitle: Persistent tumor cells in bone marrow of early breast cancer patients after primary surgery are associated with inferior outcome
Author's response to reviews Title: Persistent tumor cells in bone marrow of early breast cancer patients after primary surgery are associated with inferior outcome Authors: Kjersti Tjensvoll (ktje@sus.no)
More informationmir-509-5p and mir-1243 increase the sensitivity to gemcitabine by inhibiting
mir-509-5p and mir-1243 increase the sensitivity to gemcitabine by inhibiting epithelial-mesenchymal transition in pancreatic cancer Hidekazu Hiramoto, M.D. 1,3, Tomoki Muramatsu, Ph.D. 1, Daisuke Ichikawa,
More informationScientific Editing Report
Acknowledge editing support International publication guidelines such as ICMJE guidelines state that all non-author contributions, including editing, should be acknowledged. If you are satisfied with the
More information(a) Significant biological processes (upper panel) and disease biomarkers (lower panel)
Supplementary Figure 1. Functional enrichment analyses of secretomic proteins. (a) Significant biological processes (upper panel) and disease biomarkers (lower panel) 2 involved by hrab37-mediated secretory
More informationUbiquitination and deubiquitination of NP protein regulates influenza A virus RNA replication
Manuscript EMBO-2010-74756 Ubiquitination and deubiquitination of NP protein regulates influenza A virus RNA replication Tsai-Ling Liao, Chung-Yi Wu, Wen-Chi Su, King-Song Jeng and Michael Lai Corresponding
More informationUTX inhibits EMT-induced breast CSC properties by epigenetic repression of EMT genes in cooperation with LSD1 and HDAC1
EMBO reports - Peer Review Process File - EMBOR-2015-40244 Manuscript EMBOR-2015-40244 UTX inhibits EMT-induced breast CSC properties by epigenetic repression of EMT genes in cooperation with LSD1 and
More informationSupplementary methods:
Supplementary methods: Primers sequences used in real-time PCR analyses: β-actin F: GACCTCTATGCCAACACAGT β-actin [11] R: AGTACTTGCGCTCAGGAGGA MMP13 F: TTCTGGTCTTCTGGCACACGCTTT MMP13 R: CCAAGCTCATGGGCAGCAACAATA
More informationEPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH
EPIGENETIC RE-EXPRESSION OF HIF-2α SUPPRESSES SOFT TISSUE SARCOMA GROWTH Supplementary Figure 1. Supplementary Figure 1. Characterization of KP and KPH2 autochthonous UPS tumors. a) Genotyping of KPH2
More informationTitle:Inhibitory effects of astaxanthin on azoxymethane-induced colonic preneoplastic lesions in C57/BL/KsJ-db/db mice
Author's response to reviews Title:Inhibitory effects of astaxanthin on azoxymethane-induced colonic preneoplastic lesions in C57/BL/KsJ-db/db mice Authors: Takahiro Kochi (kottii924@yahoo.co.jp) Masahito
More informationSALL1 functions as a tumor suppressor in breast cancer by regulating cancer cell senescence and metastasis through the NuRD complex
Ma et al. Molecular Cancer (2018) 17:78 https://doi.org/10.1186/s12943-018-0824-y RESEARCH SALL1 functions as a tumor suppressor in breast cancer by regulating cancer cell senescence and metastasis through
More informationTitle: Human breast cancer associated fibroblasts exhibit subtype specific gene expression profiles
Author's response to reviews Title: Human breast cancer associated fibroblasts exhibit subtype specific gene expression profiles Authors: Julia Tchou (julia.tchou@uphs.upenn.edu) Andrew V Kossenkov (akossenkov@wistar.org)
More informationFang et al. NMuMG. PyVmT unstained Anti-CCR2-PE MDA-MB MCF MCF10A
A NMuMG PyVmT 16.5+.5 47.+7.2 Fang et al. unstained Anti-CCR2-PE 4T1 Control 37.6+6.3 56.1+.65 MCF1A 16.1+3. MCF-7 3.1+5.4 MDA-M-231 42.1+5.5 unstained Secondary antibody only Anti-CCR2 SUPPLEMENTAL FIGURE
More informationTitle: Overlap of Cognitive Concepts in Chronic Widespread Pain: An Exploratory Study
Author's response to reviews Title: Overlap of Cognitive Concepts in Chronic Widespread Pain: An Exploratory Study Authors: Aleid de Rooij (a.d.rooij@reade.nl) Martijn P.M. Steultjens (martijn.steultjens@gcal.ac.uk)
More information(A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939 (5 µm)
Supplementary Figure Legends Figure S1. Tankyrase inhibition suppresses cell proliferation in an axin/β-catenin independent manner. (A) SW480, DLD1, RKO and HCT116 cells were treated with DMSO or XAV939
More informationAuthor s response to reviews
Author s response to reviews Title: Mortality patterns and risk among older men and women with intellectual disability: a Swedish national retrospective cohort study Authors: Nawi Ng (nawi.ng@umu.se) Eva
More informationTitle: Aggrecan heterogeneity in articular cartilage from patients with osteoarthritis
Reviewer s report Title: Aggrecan heterogeneity in articular cartilage from patients with osteoarthritis Version: 0 Date: 21 Dec 2015 Reviewer: Debabrata Patra Reviewer s report: In this article the authors
More informationFunctional genomics reveal that the serine synthesis pathway is essential in breast cancer
Functional genomics reveal that the serine synthesis pathway is essential in breast cancer Results Presented by Stacey Lin Lloyd Lab http://www.amsbio.com/expression-ready-lentiviral-particles.aspx Overview
More informationA DNA/HDAC dual-targeting drug CY with significantly enhanced anticancer potency
A DNA/HDAC dual-targeting drug CY190602 with significantly enhanced anticancer potency Chuan Liu, Hongyu Ding, Xiaoxi Li, Christian P. Pallasch, Liya Hong, Dianwu Guo, Yi Chen, Difei Wang, Wei Wang, Yajie
More informationSupplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2
Supplementary Fig. 1: ATM is phosphorylated in HER2 breast cancer cell lines. (A) ATM is phosphorylated in SKBR3 cells depending on ATM and HER2 activity. Upper panel: Representative histograms for FACS
More informationMYBBP1A suppresses breast cancer tumorigenesis by enhancing the p53 dependent anoikis
kaogi et al. MC Cancer 213, 13:65 http://www.biomedcentral.com/1471-247/13/65 RESERCH RTICLE Open ccess suppresses breast cancer tumorigenesis by enhancing the dependent anoikis Kensuke kaogi 1, Wakana
More informationmicrorna Presented for: Presented by: Date:
microrna Presented for: Presented by: Date: 2 micrornas Non protein coding, endogenous RNAs of 21-22nt length Evolutionarily conserved Regulate gene expression by binding complementary regions at 3 regions
More informationQuantification of early stage lesions for loss of p53 should be shown in the main figures.
Reviewer #1 (Remarks to the Author): Expert in prostate cancer The manuscript "Clonal dynamics following p53 loss of heterozygosity in Kras-driven cancers" uses a number of novel genetically engineered
More informationTitle: Peritumoral Vascular Invasion and NHERF1 expression define an immunophenotype of grade 2 invasive breast cancer associated with poor prognosis
Author's response to reviews Title: Peritumoral Vascular Invasion and NHERF1 expression define an immunophenotype of grade 2 invasive breast cancer associated with poor prognosis Authors: Andrea Malfettone
More informationSupplemental Figure 1
Supplemental Figure 1 A S100A4: SFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDK Overlap: SF G DE KLM LD N D VDFQEY VFL I M N FF G PD S100A2: SFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDR
More informationFibroadipogenic progenitors mediate the ability of HDAC inhibitors to promote regeneration in dystrophic muscles of young, but not old mdx mice
Fibroadipogenic progenitors mediate the ability of HDAC inhibitors to promote regeneration in dystrophic muscles of young, but not old mdx mice Mozzetta C., Consalvi S., Saccone V., Tierney M., Diamantini
More informationTitle:Role of LPAR3, PKC and EGFR in LPA-induced cell migration in oral squamous carcinoma cells
Author's response to reviews Title:Role of LPAR3, PKC and EGFR in LPA-induced cell migration in oral squamous carcinoma cells Authors: Ingvild J Brusevold (i.j.brusevold@medisin.uio.no) Ingun H Tveteraas
More informationAuthor s response to reviews
Author s response to reviews Title: Association between Charlson comorbidity index score and outcome in patients with stage IIIB-IV non-small cell lung cancer Authors: Lei Zhao (zhaoleilei0507@126.com)
More informationSupplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with
Supplementary Figure 1. Repression of hepcidin expression in the liver of mice treated with DMN Immunohistochemistry for hepcidin and H&E staining (left). qrt-pcr assays for hepcidin in the liver (right).
More informationAuthor s response to reviews
Author s response to reviews Title: The involvement of young people in school- and community-based noncommunicable disease prevention interventions: a scoping review of designs and outcomes Authors: Didier
More informationTitle: In vitro tooth whitening effect of two medicated chewing gums compared to a whitening gum and saliva
Author's response to reviews Title: In vitro tooth whitening effect of two medicated chewing gums compared to a whitening gum and saliva Authors: Michael Moore (moorem@ipfw.edu) Nathalie Hasler-Nguyen
More informationTitle:Video-confidence: a qualitative exploration of videoconferencing for psychiatric emergencies
Author's response to reviews Title:Video-confidence: a qualitative exploration of videoconferencing for psychiatric emergencies Authors: Marianne V Trondsen (marianne.trondsen@telemed.no) Stein Roald Bolle
More informationSupplementary Table S1. Tumor samples used for analysis Tumor size (cm) BNG (grade) ERα PR. pn-
Supplementary Table S1. Tumor samples used for analysis Sample# Age Tumor size (cm) pn- Stage Stage BNG (grade) ERα PR HER2 (FISH) Triple negative T1 46 3 N1a III 2 Pos Neg N T2 58 1 N(i-) I 3 Pos Neg
More informationTitle: The effects of videogames therapy on balance and attention in chronic ambulatory traumatic brain injury: an exploratory study.
Author s response to reviews Title: The effects of videogames therapy on balance and attention in chronic ambulatory traumatic brain injury: an exploratory study. Authors: sofia straudi (s.straudi@ospfe.it)
More informationTitle: LATS2 is De-methylated and Overexpressed in Nasopharyngeal Carcinoma and Predicts Poor Prognosis of the Patients
Author's response to reviews Title: LATS2 is De-methylated and Overexpressed in Nasopharyngeal Carcinoma and Predicts Poor Prognosis of the Patients Authors: Yan Zhang (zhangy2@sysucc.org.cn) Chun-Fang
More informationDeveloping language writing convincingly (Example from undergraduate Cultural Studies)
Developing language writing convincingly (Example from undergraduate Cultural Studies) Read the paragraph below and consider the following questions: Which sentences are presented as fact and which as
More informationTitle: Bradykinin and adenosine receptors mediate desflurane induced postconditioning in human myocardium: role of reactive oxygen species
Author's response to reviews Title: Bradykinin and adenosine receptors mediate desflurane induced postconditioning in human myocardium: role of reactive oxygen species Authors: Sandrine Lemoine (sand.lemoine2@wanadoo.fr)
More informationTitle:Lymph node enlargement after definitive chemoradiotherapy for clinical stage I esophageal squamous cell carcinoma
Author's response to reviews Title:Lymph node enlargement after definitive chemoradiotherapy for clinical stage I esophageal squamous cell carcinoma Authors: Yoshito Hayashi (y.hayashi@gh.med.osaka-u.ac.jp)
More informationa) List of KMTs targeted in the shrna screen. The official symbol, KMT designation,
Supplementary Information Supplementary Figures Supplementary Figure 1. a) List of KMTs targeted in the shrna screen. The official symbol, KMT designation, gene ID and specifities are provided. Those highlighted
More informationAuthor's response to reviews
Author's response to reviews Title: Characteristic mtor activity in Hodgkin-lymphomas offers a potential therapeutic target in high risk disease - a combined tissue microarray, in vitro and in vivo study
More informationTitle: Eye movements in patients with Whiplash Associated Disorders: a systematic review
Author s response to reviews Title: Eye movements in patients with Whiplash Associated Disorders: a systematic review Authors: Britta K Ischebeck (bischebeck@sjcn.nl;b.ischebeck@erasmusmc.nl) Jurryt de
More informationSupplemental Data. TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim.
Supplemental Data TGF-β-mediated mir-181a expression promotes breast cancer metastasis by targeting Bim. Molly A. Taylor 1, Khalid Sossey-Alaoui 2, Cheryl L. Thompson 3, David Danielpour 4, and William
More informationSUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Figure S1. Clinical significance of ZNF322A overexpression in Caucasian lung cancer patients. (A) Representative immunohistochemistry images of ZNF322A protein expression in tissue
More informationTitle: Co-morbidities, complications and causes of death among people with femoral neck fracture - A three-year follow-up study.
Author s response to reviews Title: Co-morbidities, complications and causes of death among people with femoral neck fracture - A three-year follow-up study. Authors: Monica Berggren (monica.langstrom@umu.se)
More informationTitle: Socioeconomic conditions and number of pain sites in women
Author's response to reviews Title: Socioeconomic conditions and number of pain sites in women Authors: Finn E Skjeldestad (fisk@fhi.no) Toril Rannestad (Toril.Rannestad@hist.no) Version: 2 Date: 17 January
More informationAuthor's response to reviews
Author's response to reviews Title:microRNA alterations in mammary epithelial stem cells: a crucial contributing factor towards breast cancer risk reduction in case of early pregnancy Authors: Sushmita
More informationManaging Editor from BMC Compplementary and Alternative Medicine
Author s response to reviews Title: Euphorbia tirucalli modulates gene expression in larynx squamous cell carcinoma Authors: Gabriela Franco-Salla (gabi.bfranco@gmail.com) Janesly Prates (janeslyprates@hotmail.com)
More informationSupplementary Information Titles Journal: Nature Medicine
Supplementary Information Titles Journal: Nature Medicine Article Title: Corresponding Author: Supplementary Item & Number Supplementary Fig.1 Fig.2 Fig.3 Fig.4 Fig.5 Fig.6 Fig.7 Fig.8 Fig.9 Fig. Fig.11
More informationTEB. Id4 p63 DAPI Merge. Id4 CK8 DAPI Merge
a Duct TEB b Id4 p63 DAPI Merge Id4 CK8 DAPI Merge c d e Supplementary Figure 1. Identification of Id4-positive MECs and characterization of the Comma-D model. (a) IHC analysis of ID4 expression in the
More informationParalemmin Splice Variants and mrna and Protein Expression in Breast Cancer
University of Massachusetts Amherst ScholarWorks@UMass Amherst Masters Theses 1911 - February 2014 January 2008 Paralemmin Splice Variants and mrna and Protein Expression in Breast Cancer Casey M. Turk
More informationTable 1. Clinicopathological features of melanoma samples (shown in Fig. 2) exhibiting higher XYZ mrna levels.
Sheikh MS et al., Privileged communication. Probe: N T N T N T N T N T N T Table 1. Clinicopathological features of melanoma samples (shown in Fig. 2) exhibiting higher mrna levels. Patient No. Age (yrs)
More informationOpposing activities of the Ras and Hippo pathways converge on regulation of YAP protein turnover
The EMBO Journal Peer Review Process File - EMBO-2014-89385 Manuscript EMBO-2014-89385 Opposing activities of the Ras and Hippo pathways converge on regulation of YAP protein turnover Xin Hong, Hung Thanh
More informationTitle: Sports activity and combined use of snus and cigarette smoking among young males in Finland in
Author's response to reviews Title: Sports activity and combined use of snus and cigarette smoking among young males in Finland in 1999-2010 Authors: Ville M Mattila (ville.mattila@uta.fi) Susanna Raisamo
More informationEpstein-Barr virus driven promoter hypermethylated genes in gastric cancer
RESEARCH FUND FOR THE CONTROL OF INFECTIOUS DISEASES Epstein-Barr virus driven promoter hypermethylated genes in gastric cancer J Yu *, KF To, QY Liang K e y M e s s a g e s 1. Somatostatin receptor 1
More informationTitle: Concurrence of villous adenoma and non-muscle invasive bladder cancer arising in the bladder: a case report
Author's response to reviews Title: Concurrence of villous adenoma and non-muscle invasive bladder cancer arising in the bladder: a case report Authors: Yoichiro Kato (j2c789@bma.biglobe.ne.jp) Susumu
More informationTitle:Continuity of GP care is associated with lower use of complementary and alternative medical providers A population-based cross-sectional survey
Author's response to reviews Title:Continuity of GP care is associated with lower use of complementary and alternative medical providers A population-based cross-sectional survey Authors: Anne Helen Hansen
More informationTitle: Prevalence and incidence of multiple sclerosis in central Poland,
Author s response to reviews Title: Prevalence and incidence of multiple sclerosis in central Poland, 2010-2014 Authors: Waldemar Brola (wbrola@wp.pl) Piotr Sobolewski (piotrsobolewski@poczta.onet.pl)
More informationPlasma exposure levels from individual mice 4 hours post IP administration at the
Supplemental Figure Legends Figure S1. Plasma exposure levels of MKC-3946 in mice. Plasma exposure levels from individual mice 4 hours post IP administration at the indicated dose mg/kg. Data represent
More informationWe have addressed each of the reviewers comments point by point below, and marked all changes to the revised manuscript in red.
Author s response to reviews Title: A novel frameshift GRN mutation results in frontotemporal lobar degeneration with a distinct clinical phenotype in two siblings: case report and literature review Authors:
More informationIn addition, we have asked an English-editing service to edit the text, and you will find an English-edited version of the paper submitted as well.
Author s response to reviews Title: Resource Use and Disease Course in Dementia - Nursing Home (REDIC-NH): A Norwegian Cohort Study from Admission to a Nursing Home until Death. A description of study
More informationTitle:Fulvic acid attenuates homocysteine-induced cyclooxygenase-2 expression in human monocytes
Author's response to reviews Title:Fulvic acid attenuates homocysteine-induced cyclooxygenase-2 expression Authors: Shao-Ju Chien (csjdc@adm.cgmh.org.tw) Te-Chuan Chen (ma4671@gmail.com) Hsing-Chun Kuo
More informationSREBP-2 promotes stem cell-like properties and metastasis by transcriptional activation of c-myc in prostate cancer
SREBP-2 promotes stem cell-like properties and metastasis by transcriptional activation of c-myc in prostate cancer Supplementary Material Supplementary Methods Supplementary References Supplementary Figure
More informationTitle:Continuous Professional Competence (CPC) for Irish Paramedics and Advanced Paramedics: a national study
Author's response to reviews Title:Continuous Professional Competence (CPC) for Irish Paramedics and Advanced Paramedics: a national study Authors: Shane Knox Mr (shaneknox7@gmail.com) Walter Cullen Professor
More informationAuthor's response to reviews
Author's response to reviews Title: Measles transmission from an anthroposophic community to the general population, Germany 2008 - Effect of early intervention on size and duration of measles clusters
More informationHunk is required for HER2/neu-induced mammary tumorigenesis
Research article Hunk is required for HER2/neu-induced mammary tumorigenesis Elizabeth S. Yeh, 1 Thomas W. Yang, 1 Jason J. Jung, 1 Heather P. Gardner, 1 Robert D. Cardiff, 2 and Lewis A. Chodosh 1 1 Department
More informationReviewer's report. Version: 1 Date: 24 May Reviewer: Cathy Moelans. Reviewer's report:
Reviewer's report Title: Validation of HER2 testing with core needle biopsy specimens from primary breast cancers in terms of interobserver reproducibility and concordance with surgically resected specimens
More informationRE: Title: Practical fecal calprotectin cut-off value for Japanese patients with ulcerative colitis
September 10, 2018 Professor Xue-Jiao Wang, MD Science Editor Editorial Office 'World Journal of Gastroenterology' RE: 40814 Title: Practical fecal calprotectin cut-off value for Japanese patients with
More informationMANUSCRIPT TITLE: Protein kinase C δ signaling is required for dietary prebiotic-induced strengthening of intestinal epithelial barrier function
MANUSCRIPT TITLE: Protein kinase C δ signaling is required for dietary prebiotic-induced strengthening of intestinal epithelial barrier function Authors: Richard Y. Wu 1,2, Majd Abdullah 1, Pekka Määttänen
More informationTitle: Synuclein Gamma Predicts Poor Clinical Outcome in Colon Cancer with Normal Levels of Carcinoembryonic Antigen
Author's response to reviews Title: Synuclein Gamma Predicts Poor Clinical Outcome in Colon Cancer with Normal Levels of Carcinoembryonic Antigen Authors: Caiyun Liu (liucaiyun23@yahoo.com.cn) Bin Dong
More informationTitle: Childhood osteomyelitis-incidence and differentiation from other acute onset musculoskeletal features in a population-based study
Author's response to reviews Title: Childhood osteomyelitis-incidence and differentiation from other acute onset musculoskeletal features in a population-based study Authors: Øystein Riise (oystein.riise@rikshospitalet.no)
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 EGFR inhibition activates signaling pathways (a-b) EGFR inhibition activates signaling pathways (a) U251EGFR cells were treated with erlotinib (1µM) for the indicated times followed
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/7/310/ra11/dc1 Supplementary Materials for STAT3 Induction of mir-146b Forms a Feedback Loop to Inhibit the NF-κB to IL-6 Signaling Axis and STAT3-Driven Cancer
More informationTITLE: Induction of Ephs/Ephrins-Mediated Tumor Cells-Endothelial Cells Repulsion as an Anti-Cancer Therapeutic Approach
AD Award Number: W81XWH-04-1-0661 TITLE: Induction of Ephs/Ephrins-Mediated Tumor Cells-Endothelial Cells Repulsion as an Anti-Cancer Therapeutic Approach PRINCIPAL INVESTIGATOR: Gerald Batist, M.D. CONTRACTING
More informationSuppression of Aurora-A-FLJ10540 signaling axis prohibits the malignant state of head and neck cancer
Chen et al. Molecular Cancer (2015) 14:83 DOI 10.1186/s12943-015-0348-7 RESEARCH Open Access Suppression of Aurora-A-FLJ10540 signaling axis prohibits the malignant state of head and neck cancer Chang-Han
More informationSupplementary Information
Supplementary Information TABLE S1. SUBJECT CHARACTERISTICS* Normal Control Subjects Subjects with Asthma p Value Number 23 48 Age (years) 35±10 35±10 0.75 Sex, M:F (% F) 9:12 (57) 17:26 (60) 0.76 FEV1
More informationAuthor's response to reviews
Author's response to reviews Title: Brain metastasis development and poor survival associated with carcinoembryonic antigen (CEA) level in advanced non-small cell lung cancer: a prospective analysis Authors:
More informationGENETIC ANALYSIS OF RAS SIGNALING PATHWAYS IN CELL PROLIFERATION, MIGRATION AND SURVIVAL
Manuscript EMBO-2009-72496 GENETIC ANALYSIS OF RAS SIGNALING PATHWAYS IN CELL PROLIFERATION, MIGRATION AND SURVIVAL Matthias Drosten, Alma Dhawahir, Eleanor Sum, Jelena Urosevic, Carmen Lechuga, Luis Esteban,
More informationSupplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or
Supplementary Figure 1. The CagA-dependent wound healing or transwell migration of gastric cancer cell. AGS cells transfected with vector control or 3xflag-CagA expression vector were wounded using a pipette
More informationTitle: Expression of AE1/p16 promoted degradation of AE2 in gastric cancer cells
Author s response to reviews Title: Expression of AE1/p16 promoted degradation of AE2 in gastric cancer cells Authors: Guo-Hui Fu (fuguhu@263.net) Ting Wang (wangting_tina@126.com) Hong-Jun Fei (feihongjun1@126.com)
More informationTankyrase 1 regulates centrosome function by controlling CPAP stability
Manuscript EMBOR-2011-35655 Tankyrase 1 regulates centrosome function by controlling CPAP stability Mi Kyung Kim, Charles Dudognon and Susan Smith Corresponding author: Susan Smith, The Skirball Institute
More informationAuthor's response to reviews
Author's response to reviews Title: Gender, ethnicity, health behaviour & self-rated health in Singapore Authors: Wei-Yen Lim (Lim_Wei_Yen@moh.gov.sg) Stefan Ma (Stefan_Ma@moh.gov.sg) Derrick Heng (Derrick_Heng@moh.gov.sg)
More informationAuthor's response to reviews
Author's response to reviews Title: Characteristic mtor activity in Hodgkin-lymphomas offers a potential therapeutic target in high risk disease - a combined tissue microarray, in vitro and in vivo study
More informationhexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This
SUPPLEMENTAL FIGURE LEGEND Fig. S1. Generation and characterization of. (A) Coomassie staining of soluble hexahistidine tagged GRP78 devoid of the KDEL motif (GRP78-His) on SDS-PAGE. This protein was expressed
More informationBmi-1 regulates stem cell-like properties of gastric cancer cells via modulating mirnas
Wang et al. Journal of Hematology & Oncology (2016) 9:90 DOI 10.1186/s13045-016-0323-9 RESEARCH Bmi-1 regulates stem cell-like properties of gastric cancer cells via modulating mirnas Open Access Xiaofeng
More informationFigures S1-S5, Figure Legends, Table S1 List of primers used in the study
Insulin receptor alternative splicing is regulated by insulin signaling and modulates beta cell survival Pushkar Malakar,4, Lital Chartarifsky,4, Ayat Hija, Gil Leibowitz 3, Benjamin Glaser 3, Yuval Dor,
More informationWNT10B/β-catenin Signaling Induces HMGA2 and Proliferation in Metastatic Triple-Negative Breast Cancer
WNT10B/β-catenin Signaling Induces HMGA2 and Proliferation in Metastatic Triple-Negative Breast Cancer Peter Wend, Stephanie Runke, Korinna Wend, Brenda Anchondo, Maria Yesayan, Meghan Jardon, Natalie
More information(A) PCR primers (arrows) designed to distinguish wild type (P1+P2), targeted (P1+P2) and excised (P1+P3)14-
1 Supplemental Figure Legends Figure S1. Mammary tumors of ErbB2 KI mice with 14-3-3σ ablation have elevated ErbB2 transcript levels and cell proliferation (A) PCR primers (arrows) designed to distinguish
More information