Study the Evolution of the Avian Influenza Virus

Size: px
Start display at page:

Download "Study the Evolution of the Avian Influenza Virus"

Transcription

1 Designing an Algorithm to Study the Evolution of the Avian Influenza Virus Arti Khana Mentor: Takis Benos Rachel Brower-Sinning Department of Computational Biology University of Pittsburgh

2 Overview Introduction Background Goals Methods Results Acknowledgements

3 Introduction Study evolutionary aspects of flu viruses Develop genetic algorithm (GA) given Starting flu genome sequence Set of amino acid substitutions Mutation rate Fitness function

4 Background Avian influenza A (H5N1) Ten main proteins shown

5 Background Avian virus can mutate to fully adapt to humans Types of mutations Point Mutation Deletion Insertion Inversion

6 Background Position-Specific Scoring Matrix Assign probabilities Include pseudo counts Log of probabilities

7 Goals Develop an algorithm that given an initial human and avian DNA sequence it will generate N new sequences based on some parameters. Rate of mutations Number of successive mutations Selection of mutated sequences Number of generations Assign probabilities for each sequence and use a position-specific scoring matrix to align and score sequences. Selecting top X sequences (e.g., X=100) and repeat K number of times. If two sequences are given in the input, then evolve both and every T time recombine their segments randomly.

8 Methods Flow Chart of Algorithm Implemented Avian Sequence Human Sequence Generate Mutate Translate Fitness Function Select Score

9 Methods Read in human nucleotide sequence Translate sequence Read in avian nucleotide sequence For a given number of generations Mutate avian sequences Translate avian sequences Read translated sequences into fitness function Select sequences Print best sequence and score

10 Results Mutated sequences >gi gb AB _/Avian/5(NP)/... ATGGCGCTTCAAGGCACCAAACGATCTTATGAGCAGATGGAAACTGGTGGGGAACGCCAGA ATGCTACTGAGATCAGAGCATCTGTTGGGAGAATGGTTGGTGGAATCGGAAGATTCTACATA CAGATGTGCACTGAACTCAAACTCAGCGACTACGAAGGCAGGCTGATCCAAAACAGCATAAC AATAGAGAGAATGGTCCTCTCCGCATTTGATGAAAGGAGGAACAGATACCTGGAAGAAAGTC CCAGTGCGGGGAAAGATCCGAAGAAAACTGGAGGTCCAATCTACAAAAGAAGGGAAGGAAA GTGGGTGAGAGAGCTGATTTTGTATGACAAGGAGGAGATCAGGAGAATTTGGCGTCAAGCG AACAATGGAGAAGACGCAACTGCTGGCCTCACCCATCTGATGATCTGGCATTCCAATCTGAA TGATGCCACATATCAAAGAACAAGAGCTCTAGTGCGTACTGGGATGGACCCCAGAATGTGTT CTCTGATGCAAGGATCAACTCTCCCGAGAAGATCAGGAGCTGCTGGTGCAGCAGTAAAGGG AATTGGGACAATGGTGATGGAACTAATTCGGATGATAAAGCGGGGAATCAATAACCGGAATT TCTGG >gi gb AB _/Avian/5(NP)... ATGGCGCTTCAAGGCACCAAACGATCTTATGAGCAGATGGAAACTGGTGGGGAACGCCAGA ATGCTACTGAGATCAGAGCATCTGTTGGGAGAATGGTTGGTGGAATCGGAAGATTCTACATA CAGATGTGCACTGAACTCAAACTCAGCGACTACGAAGGCAGGCTGATCCAAAACAGCATAAC AATAGAGAGAATGGTCCTCTCCGCATTTGATGAAAGGAGGAACAGATACCTGGAAGAAAGTC CCAGTGCGGGGAAAGATCCGAAGAAAACTGGAGGTCCAATCTACAAAAGAAGGGAAGGAAA GTGGGTGAGAGAGCTGATTTTGTATGACAAGGAGGAGATCAGGAGAATTTGGCGTCAAGCG AACAATGGAGAAGACGCAACTGCTGGCCTCACCCATCTGATGATCTGGCATTCCAATCTGAA TGATGCCACATATGAAAGAACAAGAGCTCTAGTGCGTACTGGGATGGACCCCAGAATGTGTT CTCTGATGCAAGGATCAACTCTCCCGAGAAGATCAGGAGCTGCTGGTGCAGCAGTAAAGGG AATTGGGACAATGGTGATGGAACTAATTCGGATGATAAAGCGGGGAATCAATAACCGGAATT TCTGG

11 Results Scored Sequences max possible score >gi gb AF _/Avian/5(NP)/... MALQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSAFDERRNRYLEENPSAGKDPKK TGGPIYKRREGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG AAVKGIGTMVMELIRMIKRGINDRNFWRGDNGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAH KSCLPACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRSNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVIPRGQLSTRGV QIASNENMETIDSSTLELRSRYWAIRTRSGGNTNQHRASAGQISVQPTFSVQRSLPFERATIMAAFTGNTEGRTSDMRTEIIRMMENAKPE DVSFQGRGVFELSDEKATNPIVPSFDMSNEG >gi gb AF _/Avian/5(NP)/... MALQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSAFDERRNRYLEENPSAGKDPKK TGGPIYKRREGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG AAIKGIGTMVMELIRMIKRGINDRNFWRGDNGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAH KSCLPACVYGLAVASGYDFDREGYSLVGIDPFRLLQNSQVFNLIRSNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVIPRGQLSTRGV QIASNENMETIDSSTLELRSRYWAIRTRSGGNTNQHRASAGQISVQPTFSVQRSLPFERATIMAAFTGNTEGRTSDMRTEIIRMMENAKPE DVSFQGRGVFELSDEKATNPIVPSFDMSNE >gi gb AM _/Avian/5(NP... MASQGTKRSYEQMETGGERQNATEIRASVGRMISGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSAFDERRNRYLEEHPSAGKDPKK TGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEGATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG AAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVA HKSCLPACVYGLAVAGGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVVPRGQLSTR GVQIASNENTEAMDSNTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPFERATIMAAFTGNTEGRTSDMRTEIIRMMESAR PEDVSFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFGD >gi gb AF _/Avian/5(NP)/... MALQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSAFDERRNRYLEENPSAGKDPKK TGGIYKRREGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGP AVKGIGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMVDQVRESRNPGNAEIEDLIFLARSALILRGSVAHK SCLPACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRSNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVVPRGQLSTRVVQ IASNENMETIDSSTLELRSRYWAIRTRSGGNTNQHRASAGQISVQPTFSVQRSLPFERATIMAAFTGNTEGRTSDMRTEIIRMMESAKPEDV SFQGRGVFELSDEKATNPIVPSFDMNNEGSYFFGDNA

12 Future Research

13 Acknowledgements Takis Benos Department of Computational Biology at the University of Pittsburgh Rachel Brower-Sinning Department of Computational Biology at the University of Pittsburgh

Phylogenetic Methods

Phylogenetic Methods Phylogenetic Methods Multiple Sequence lignment Pairwise distance matrix lustering algorithms: NJ, UPM - guide trees Phylogenetic trees Nucleotide vs. amino acid sequences for phylogenies ) Nucleotides:

More information

Lecture 19 Evolution and human health

Lecture 19 Evolution and human health Lecture 19 Evolution and human health The evolution of flu viruses The evolution of flu viruses Google Flu Trends data US data Check out: http://www.google.org/flutrends/ The evolution of flu viruses the

More information

Patterns of hemagglutinin evolution and the epidemiology of influenza

Patterns of hemagglutinin evolution and the epidemiology of influenza 2 8 US Annual Mortality Rate All causes Infectious Disease Patterns of hemagglutinin evolution and the epidemiology of influenza DIMACS Working Group on Genetics and Evolution of Pathogens, 25 Nov 3 Deaths

More information

a. From the grey navigation bar, mouse over Analyze & Visualize and click Annotate Nucleotide Sequences.

a. From the grey navigation bar, mouse over Analyze & Visualize and click Annotate Nucleotide Sequences. Section D. Custom sequence annotation After this exercise you should be able to use the annotation pipelines provided by the Influenza Research Database (IRD) and Virus Pathogen Resource (ViPR) to annotate

More information

DETECTION OF LOW FREQUENCY CXCR4-USING HIV-1 WITH ULTRA-DEEP PYROSEQUENCING. John Archer. Faculty of Life Sciences University of Manchester

DETECTION OF LOW FREQUENCY CXCR4-USING HIV-1 WITH ULTRA-DEEP PYROSEQUENCING. John Archer. Faculty of Life Sciences University of Manchester DETECTION OF LOW FREQUENCY CXCR4-USING HIV-1 WITH ULTRA-DEEP PYROSEQUENCING John Archer Faculty of Life Sciences University of Manchester HIV Dynamics and Evolution, 2008, Santa Fe, New Mexico. Overview

More information

LESSON 4.4 WORKBOOK. How viruses make us sick: Viral Replication

LESSON 4.4 WORKBOOK. How viruses make us sick: Viral Replication DEFINITIONS OF TERMS Eukaryotic: Non-bacterial cell type (bacteria are prokaryotes).. LESSON 4.4 WORKBOOK How viruses make us sick: Viral Replication This lesson extends the principles we learned in Unit

More information

EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS. R. Burke Squires

EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS. R. Burke Squires EVOLUTIONARY TRAJECTORY ANALYSIS: RECENT ENHANCEMENTS R. Burke Squires Pandemic H1N1 2009 Origin? April / May 2009 Cases of an Influenza-like Illness (ILI) occurred in California, Texas and Mexico New

More information

Evolution of influenza

Evolution of influenza Evolution of influenza Today: 1. Global health impact of flu - why should we care? 2. - what are the components of the virus and how do they change? 3. Where does influenza come from? - are there animal

More information

For all of the following, you will have to use this website to determine the answers:

For all of the following, you will have to use this website to determine the answers: For all of the following, you will have to use this website to determine the answers: http://blast.ncbi.nlm.nih.gov/blast.cgi We are going to be using the programs under this heading: Answer the following

More information

Evolutionary distances between proteins of the Influenza A Virus

Evolutionary distances between proteins of the Influenza A Virus Evolutionary distances between proteins of the Influenza A Virus Hatem Nassrat B00393388 Bioinformatics: Winter 06/07 Dr. Christian Blouin Table of Contents Evolutionary distances between proteins of the

More information

Modeling the Antigenic Evolution of Influenza Viruses from Sequences

Modeling the Antigenic Evolution of Influenza Viruses from Sequences Modeling the Antigenic Evolution of Influenza Viruses from Sequences Taijiao Jiang Center of Systems Medicine, Chinese Academy of Medical Sciences Suzhou Institute of Systems Medicine October 8-10, 2015.

More information

CONSTRUCTION OF PHYLOGENETIC TREE USING NEIGHBOR JOINING ALGORITHMS TO IDENTIFY THE HOST AND THE SPREADING OF SARS EPIDEMIC

CONSTRUCTION OF PHYLOGENETIC TREE USING NEIGHBOR JOINING ALGORITHMS TO IDENTIFY THE HOST AND THE SPREADING OF SARS EPIDEMIC CONSTRUCTION OF PHYLOGENETIC TREE USING NEIGHBOR JOINING ALGORITHMS TO IDENTIFY THE HOST AND THE SPREADING OF SARS EPIDEMIC 1 MOHAMMAD ISA IRAWAN, 2 SITI AMIROCH 1 Institut Teknologi Sepuluh Nopember (ITS)

More information

A Bioinformatics Method for Identifying RNA Structures within Human Cells

A Bioinformatics Method for Identifying RNA Structures within Human Cells Wright State University CORE Scholar Physics Seminars Physics 11-1-2013 A Bioinformatics Method for Identifying RNA Structures within Human Cells Stephen Donald Huff Follow this and additional works at:

More information

Overview: Chapter 19 Viruses: A Borrowed Life

Overview: Chapter 19 Viruses: A Borrowed Life Overview: Chapter 19 Viruses: A Borrowed Life Viruses called bacteriophages can infect and set in motion a genetic takeover of bacteria, such as Escherichia coli Viruses lead a kind of borrowed life between

More information

INFLUENZA EVOLUTION: Challenges for diagnosis

INFLUENZA EVOLUTION: Challenges for diagnosis INFLUENZA EVOLUTION: Challenges for diagnosis Jairo A. Méndez-Rico Influenza Team PAHO/WHO, Washington, DC Overview Every year, influenza infects up to one in five people around the world, and causes up

More information

Supplementary Figure 1 Weight and body temperature of ferrets inoculated with

Supplementary Figure 1 Weight and body temperature of ferrets inoculated with Supplementary Figure 1 Weight and body temperature of ferrets inoculated with A/Anhui/1/2013 (H7N9) influenza virus. (a) Body temperature and (b) weight change of ferrets after intranasal inoculation with

More information

Lecture 18 Evolution and human health

Lecture 18 Evolution and human health Lecture 18 Evolution and human health Evolution and human health 1. Genetic factors 2. Infectious diseases Evolution and human health 1. Genetic factors Evolution and human health 1. Genetic factors P

More information

Module 3. Genomic data and annotations in public databases Exercises Custom sequence annotation

Module 3. Genomic data and annotations in public databases Exercises Custom sequence annotation Module 3. Genomic data and annotations in public databases Exercises Custom sequence annotation Objectives Upon completion of this exercise, you will be able to use the annotation pipelines provided by

More information

Bacteriophage Reproduction

Bacteriophage Reproduction Bacteriophage Reproduction Lytic and Lysogenic Cycles The following information is taken from: http://student.ccbcmd.edu/courses/bio141/lecguide/unit3/index.html#charvir Bacteriophage Structure More complex

More information

Sequence Analysis of Human Immunodeficiency Virus Type 1

Sequence Analysis of Human Immunodeficiency Virus Type 1 Sequence Analysis of Human Immunodeficiency Virus Type 1 Stephanie Lucas 1,2 Mentor: Panayiotis V. Benos 1,3 With help from: David L. Corcoran 4 1 Bioengineering and Bioinformatics Summer Institute, Department

More information

Grade Level: Grades 9-12 Estimated Time Allotment Part 1: One 50- minute class period Part 2: One 50- minute class period

Grade Level: Grades 9-12 Estimated Time Allotment Part 1: One 50- minute class period Part 2: One 50- minute class period The History of Vaccines Lesson Plan: Viruses and Evolution Overview and Purpose: The purpose of this lesson is to prepare students for exploring the biological basis of vaccines. Students will explore

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Sirkka-Liisa Varvio sirkka-liisa.varvio@helsinki.fi Autumn 2009, I period www.cs.helsinki.fi/mbi/courses/09-10/itb 582606 Introduction to Bioinformatics, Autumn 2009 8. Sept

More information

Bio 111 Study Guide Chapter 17 From Gene to Protein

Bio 111 Study Guide Chapter 17 From Gene to Protein Bio 111 Study Guide Chapter 17 From Gene to Protein BEFORE CLASS: Reading: Read the introduction on p. 333, skip the beginning of Concept 17.1 from p. 334 to the bottom of the first column on p. 336, and

More information

WHEN DO MUTATIONS OCCUR?

WHEN DO MUTATIONS OCCUR? WHEN DO MUTATIONS OCCUR? While most DNA replicates with fairly high accuracy, mistakes do happen. DNA polymerase sometimes inserts the wrong nucleotide or too many or too few nucleotides into a sequence.

More information

Relative activity (%) SC35M

Relative activity (%) SC35M a 125 Bat (H17N) b 125 A/WSN (H1N1) Relative activity (%) 0 75 50 25 Relative activity (%) 0 75 50 25 0 Pos. Neg. PA PB1 Pos. Neg. NP PA PB1 PB2 0 Pos. Neg. NP PA PB1 PB2 SC35M Bat Supplementary Figure

More information

Origins and evolutionary genomics of the novel avian-origin H7N9 influenza A virus in China: Early findings

Origins and evolutionary genomics of the novel avian-origin H7N9 influenza A virus in China: Early findings Origins and evolutionary genomics of the novel 2013 avian-origin H7N9 influenza A virus in : Early findings Jiankui He*, Luwen Ning, Yin Tong Department of Biology, South University of Science and Technology

More information

Chapter 12-4 DNA Mutations Notes

Chapter 12-4 DNA Mutations Notes Chapter 12-4 DNA Mutations Notes I. Mutations Introduction A. Definition: Changes in the DNA sequence that affect genetic information B. Mutagen= physical or chemical agent that interacts with DNA to cause

More information

Building complexity Unit 04 Population Dynamics

Building complexity Unit 04 Population Dynamics Building complexity Unit 04 Population Dynamics HIV and humans From a single cell to a population Single Cells Population of viruses Population of humans Single Cells How matter flows from cells through

More information

6.3 DNA Mutations. SBI4U Ms. Ho-Lau

6.3 DNA Mutations. SBI4U Ms. Ho-Lau 6.3 DNA Mutations SBI4U Ms. Ho-Lau DNA Mutations Gene expression can be affected by errors that occur during DNA replication. Some errors are repaired, but others can become mutations (changes in the nucleotide

More information

VIP: an integrated pipeline for metagenomics of virus

VIP: an integrated pipeline for metagenomics of virus VIP: an integrated pipeline for metagenomics of virus identification and discovery Yang Li 1, Hao Wang 2, Kai Nie 1, Chen Zhang 1, Yi Zhang 1, Ji Wang 1, Peihua Niu 1 and Xuejun Ma 1 * 1. Key Laboratory

More information

Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza

Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza Host Dependent Evolutionary Patterns and the Origin of 2009 H1N1 Pandemic Influenza The origin of H1N1pdm constitutes an unresolved mystery, as its most recently observed ancestors were isolated in pigs

More information

In April 2009, a new strain of

In April 2009, a new strain of managing and reducing Uncertainty in an Emerging Influenza Pandemic 2. Brundage JF, Shanks GD. Deaths from bacterial pneumonia during 1918 19 influenza pandemic. Emerg Infect Dis 2008;14:1193-9. 3. Update:

More information

Ebola Virus. Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017

Ebola Virus. Emerging Diseases. Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017 Ebola Virus Emerging Diseases Biosciences in the 21 st Century Dr. Amber Rice December 4, 2017 Outline Disease emergence: a case study How do pathogens shift hosts? Evolution within hosts: The evolution

More information

STRUCTURAL CHROMOSOMAL ABERRATIONS

STRUCTURAL CHROMOSOMAL ABERRATIONS STRUCTURAL CHROMOSOMAL ABERRATIONS Structural chromosomal aberrations cause structural abnormalities in chromosome structure. They alter the sequence or the kind of genes present in chromosome. These are

More information

LESSON 4.5 WORKBOOK. How do viruses adapt Antigenic shift and drift and the flu pandemic

LESSON 4.5 WORKBOOK. How do viruses adapt Antigenic shift and drift and the flu pandemic DEFINITIONS OF TERMS Gene a particular sequence of DNA or RNA that contains information for the synthesis of a protien or RNA molecule. For a complete list of defined terms, see the Glossary. LESSON 4.5

More information

J. A. Sands, 21 October 2013 Lehigh University

J. A. Sands, 21 October 2013 Lehigh University J. A. Sands, 21 October 2013 Lehigh University Cryptococcus, Candidiasis, Aspergillosis Tuberculosis Cholera Plague Bact. Meningitis Salmonella Listeria Leptospirosis Staph. (MRSA) E. coli Clostridium

More information

Prentice Hall. Biology: Concepts and Connections, 6th Edition (Campbell, et al) High School

Prentice Hall. Biology: Concepts and Connections, 6th Edition (Campbell, et al) High School Prentice Hall Biology: Concepts and Connections, 6th Edition (Campbell, et al) 2009 High School C O R R E L A T E D T O Biology I Students should understand that scientific knowledge is gained from observation

More information

The BLAST search on NCBI ( and GISAID

The BLAST search on NCBI (    and GISAID Supplemental materials and methods The BLAST search on NCBI (http:// www.ncbi.nlm.nih.gov) and GISAID (http://www.platform.gisaid.org) showed that hemagglutinin (HA) gene of North American H5N1, H5N2 and

More information

Modeling the Effects of HIV on the Evolution of Diseases

Modeling the Effects of HIV on the Evolution of Diseases 1/20 the Evolution of Mentor: Nina Fefferman DIMACS REU July 14, 2011 2/20 Motivating Questions How does the presence of HIV in the body changes the evolution of pathogens in the human body? How do different

More information

Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics

Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics Influenza hemagglutinin protein stability correlates with fitness and seasonal evolutionary dynamics Eili Y. Klein, Ph.D. Assistant Professor, Department of Emergency Medicine & Fellow, Center for Disease

More information

Protein Modeling Event

Protein Modeling Event Protein Modeling Event School Name: School Number: Team Member 1: Team Member 2: : Pre-Build Score: On-Site Build Score: Test Score: Tie Breaker: Total: Final Rank: Part I: Pre-Build (40% of total score)

More information

Multiple sequence alignment

Multiple sequence alignment Multiple sequence alignment Bas. Dutilh Systems Biology: Bioinformatic Data Analysis Utrecht University, February 18 th 2016 Protein alignments We have seen how to create a pairwise alignment of two sequences

More information

Project PRACE 1IP, WP7.4

Project PRACE 1IP, WP7.4 Project PRACE 1IP, WP7.4 Plamenka Borovska, Veska Gancheva Computer Systems Department Technical University of Sofia The Team is consists of 5 members: 2 Professors; 1 Assist. Professor; 2 Researchers;

More information

Characterizing intra-host influenza virus populations to predict emergence

Characterizing intra-host influenza virus populations to predict emergence Characterizing intra-host influenza virus populations to predict emergence June 12, 2012 Forum on Microbial Threats Washington, DC Elodie Ghedin Center for Vaccine Research Dept. Computational & Systems

More information

Synthetic Genomics and Its Application to Viral Infectious Diseases. Timothy Stockwell (JCVI) David Wentworth (JCVI)

Synthetic Genomics and Its Application to Viral Infectious Diseases. Timothy Stockwell (JCVI) David Wentworth (JCVI) Synthetic Genomics and Its Application to Viral Infectious Diseases Timothy Stockwell (JCVI) David Wentworth (JCVI) Outline Using informatics to predict drift (strain selection) Synthetic Genomics: Preparedness

More information

This is DUE: Come prepared to share your findings with your group.

This is DUE: Come prepared to share your findings with your group. Biology 160 Reading Guide 10: Population Dynamics, HIV NAME: This is DUE: Come prepared to share your findings with your group. *As before, please turn in only the Critical Thinking questions on a separate

More information

Investigation of the genetic differences between bovine herpesvirus type 1 variants and vaccine strains

Investigation of the genetic differences between bovine herpesvirus type 1 variants and vaccine strains Investigation of the genetic differences between bovine herpesvirus type 1 variants and vaccine strains Name: Claire Ostertag-Hill Mentor: Dr. Ling Jin Bovine herpesvirus Bovine herpesvirus-1 (BHV-1) Pathogen

More information

Hands-On Ten The BRCA1 Gene and Protein

Hands-On Ten The BRCA1 Gene and Protein Hands-On Ten The BRCA1 Gene and Protein Objective: To review transcription, translation, reading frames, mutations, and reading files from GenBank, and to review some of the bioinformatics tools, such

More information

Lecture 11. Immunology and disease: parasite antigenic diversity

Lecture 11. Immunology and disease: parasite antigenic diversity Lecture 11 Immunology and disease: parasite antigenic diversity RNAi interference video and tutorial (you are responsible for this material, so check it out.) http://www.pbs.org/wgbh/nova/sciencenow/3210/02.html

More information

Sebastian Jaenicke. trnascan-se. Improved detection of trna genes in genomic sequences

Sebastian Jaenicke. trnascan-se. Improved detection of trna genes in genomic sequences Sebastian Jaenicke trnascan-se Improved detection of trna genes in genomic sequences trnascan-se Improved detection of trna genes in genomic sequences 1/15 Overview 1. trnas 2. Existing approaches 3. trnascan-se

More information

Palindromes drive the re-assortment in Influenza A

Palindromes drive the re-assortment in Influenza A www.bioinformation.net Hypothesis Volume 7(3) Palindromes drive the re-assortment in Influenza A Abdullah Zubaer 1, 2 * & Simrika Thapa 1, 2 1Swapnojaatra Bioresearch Laboratory, DataSoft Systems, Dhaka-15,

More information

Following virus recombination and evolution

Following virus recombination and evolution Following virus recombination and evolution Coping with the avalanche of sequencing data Dmitry Kusnetsov, Anne Gleizes, Robin Liechti, Ioannis Xenarios, Philippe Le Mercier Vital-IT/Swiss-Prot group SIB

More information

Preparing for the Fall Flu Season. Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP

Preparing for the Fall Flu Season. Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP Preparing for the Fall Flu Season Laboratory Perspective Jonathan Gubbay Medical Microbiologist Public Health Laboratory OAHPP September 21, 2009 Objectives 1. Review the emergence of Novel Influenza A

More information

EVOLUTION. Reading. Research in my Lab. Who am I? The Unifying Concept in Biology. Professor Carol Lee. On your Notecards please write the following:

EVOLUTION. Reading. Research in my Lab. Who am I? The Unifying Concept in Biology. Professor Carol Lee. On your Notecards please write the following: Evolution 410 9/5/18 On your Notecards please write the following: EVOLUTION (1) Name (2) Year (3) Major (4) Courses taken in Biology (4) Career goals (5) Email address (6) Why am I taking this class?

More information

Immune pressure analysis of protease and reverse transcriptase genes of primary HIV-1 subtype C isolates from South Africa

Immune pressure analysis of protease and reverse transcriptase genes of primary HIV-1 subtype C isolates from South Africa African Journal of Biotechnology Vol. 10(24), pp. 4784-4793, 6 June, 2011 Available online at http://www.academicjournals.org/ajb DOI: 10.5897/AJB10.560 ISSN 1684 5315 2011 Academic Journals Full Length

More information

numbe r Done by Corrected by Doctor

numbe r Done by Corrected by Doctor numbe r 5 Done by Mustafa Khader Corrected by Mahdi Sharawi Doctor Ashraf Khasawneh Viral Replication Mechanisms: (Protein Synthesis) 1. Monocistronic Method: All human cells practice the monocistronic

More information

The Molecular Evolution of Gene Birth and Death. Author: Ann Brokaw AP Biology Teacher Rocky River High School Rocky River, Ohio

The Molecular Evolution of Gene Birth and Death. Author: Ann Brokaw AP Biology Teacher Rocky River High School Rocky River, Ohio The Molecular Evolution of Gene Birth and Death Author: Ann Brokaw AP Biology Teacher Rocky River High School Rocky River, Ohio The Birth and Death of Genes To the student: The following slides provide

More information

ON THE EVOLUTION OF MICROBES: THE EVOLUTION OF GENOMES WITH RESPECT TO RNA FOLDING. Rachel Brower-Sinning. Biology BS, Virginia Tech, 2004

ON THE EVOLUTION OF MICROBES: THE EVOLUTION OF GENOMES WITH RESPECT TO RNA FOLDING. Rachel Brower-Sinning. Biology BS, Virginia Tech, 2004 ON THE EVOLUTION OF MICROBES: THE EVOLUTION OF GENOMES WITH RESPECT TO RNA FOLDING by Rachel Brower-Sinning Biology BS, Virginia Tech, 2004 Physics BA, Virginia Tech, 2004 Bioinformatics MS, George Mason

More information

Exploring HIV Evolution: An Opportunity for Research Sam Donovan and Anton E. Weisstein

Exploring HIV Evolution: An Opportunity for Research Sam Donovan and Anton E. Weisstein Microbes Count! 137 Video IV: Reading the Code of Life Human Immunodeficiency Virus (HIV), like other retroviruses, has a much higher mutation rate than is typically found in organisms that do not go through

More information

Cristina Cassetti, Ph.D.

Cristina Cassetti, Ph.D. NIAID Extramural Research Update: Recombinant Influenza Viruses and Biosafety Cristina Cassetti, Ph.D. Influenza Program Officer Division of Microbiology and Infectious Diseases NIAID Influenza virus DMID

More information

Class 34: Computing with Life (and the Chicken Flu)

Class 34: Computing with Life (and the Chicken Flu) Class 34: Computing with Life (and the Chicken Flu) CS150: Computer Science University of Virginia Computer Science David Evans http://www.cs.virginia.edu/evans DNA Sequence of nucleotides: adenine (A),

More information

Production of Avian Influenza H5N1 Virus Using the TideCell Bioreactor System

Production of Avian Influenza H5N1 Virus Using the TideCell Bioreactor System Production of Avian Influenza H5N1 Virus Using the TideCell Bioreactor System www.bioreactorsciences.com A Production Case Study Using MDCK Cell Line Comparison Study Due to significant differences in

More information

Mutations. Any change in DNA sequence is called a mutation.

Mutations. Any change in DNA sequence is called a mutation. Mutations Mutations Any change in DNA sequence is called a mutation. Mutations can be caused by errors in replication, transcription, cell division, or by external agents. Mutations Mutations can be harmful.

More information

7.012 Problem Set 6 Solutions

7.012 Problem Set 6 Solutions Name Section 7.012 Problem Set 6 Solutions Question 1 The viral family Orthomyxoviridae contains the influenza A, B and C viruses. These viruses have a (-)ss RNA genome surrounded by a capsid composed

More information

Mapping the Antigenic and Genetic Evolution of Influenza Virus

Mapping the Antigenic and Genetic Evolution of Influenza Virus Mapping the Antigenic and Genetic Evolution of Influenza Virus Derek J. Smith, Alan S. Lapedes, Jan C. de Jong, Theo M. Bestebroer, Guus F. Rimmelzwaan, Albert D. M. E. Osterhaus, Ron A. M. Fouchier Science

More information

Topic 7 - Commonality

Topic 7 - Commonality II. Organism Topic 7 - Commonality From Viruses to Bacteria to Genetic Engineering Prebiotic Period Refers to before life Early Earth contained little O 2 O 2 prevents complex molecules Complex organic

More information

PROTOCOL FOR INFLUENZA A VIRUS GLOBAL SWINE H1 CLADE CLASSIFICATION

PROTOCOL FOR INFLUENZA A VIRUS GLOBAL SWINE H1 CLADE CLASSIFICATION PROTOCOL FOR INFLUENZA A VIRUS GLOBAL SWINE H1 CLADE CLASSIFICATION January 23, 2017 1. Background Swine H1 viruses have diversified into three major genetic lineages over time. Recently, Anderson et al.

More information

Overview of the Influenza Virus

Overview of the Influenza Virus Overview of the Influenza Virus Victor C. Huber, Ph.D. September 24, 2015 victor.huber@usd.edu General Features of Influenza Virus Infections Clinical Features of Influenza Sudden onset of symptoms Incubation

More information

VIROLOGY OF INFLUENZA. Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks

VIROLOGY OF INFLUENZA. Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks INFLUENZA VIROLOGY OF INFLUENZA Subtypes: A - Causes outbreak B - Causes outbreaks C - Does not cause outbreaks PATHOGENICITY High pathogenicity avian influenza (HPAI) Causes severe disease in poultry

More information

Student Handout Bioinformatics

Student Handout Bioinformatics Student Handout Bioinformatics Introduction HIV-1 mutates very rapidly. Because of its high mutation rate, the virus will continue to change (evolve) after a person is infected. Thus, within an infected

More information

Chapter 1 : Genetics 101

Chapter 1 : Genetics 101 Chapter 1 : Genetics 101 Understanding the underlying concepts of human genetics and the role of genes, behavior, and the environment will be important to appropriately collecting and applying genetic

More information

Structural Variation and Medical Genomics

Structural Variation and Medical Genomics Structural Variation and Medical Genomics Andrew King Department of Biomedical Informatics July 8, 2014 You already know about small scale genetic mutations Single nucleotide polymorphism (SNPs) Deletions,

More information

Review of diagnostic tests for SIV s and pandemic H1N1 in pigs. Ian Brown. Veterinary Laboratories Agency- Weybridge

Review of diagnostic tests for SIV s and pandemic H1N1 in pigs. Ian Brown. Veterinary Laboratories Agency- Weybridge Review of diagnostic tests for SIV s and pandemic H1N1 in pigs Ian Brown Veterinary Laboratories Agency- Weybridge Protocols submitted to OFFLU scientist (BC) VLA Weybridge CDC, Atlanta SEPRL, Athens FLI

More information

EVOLUTION: WHY DOES IT MATTER? What did evolution ever do for me?

EVOLUTION: WHY DOES IT MATTER? What did evolution ever do for me? EVOLUTION: WHY DOES IT MATTER? What did evolution ever do for me? www.christs.cam.ac.uk/darwin200 Evolution is change in living things through descent with modification Evolution is change in living things

More information

TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important?

TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important? TITLE: Influenza A (H7N9) virus evolution: Which genetic mutations are antigenically important? AUTHORS: Joshua G. Petrie 1, Adam S. Lauring 2,3 AFFILIATIONS: 1 Department of Epidemiology, University of

More information

What is influenza virus? 13,000 base RNA genome: 1/ the size of the human genome

What is influenza virus? 13,000 base RNA genome: 1/ the size of the human genome What is influenza virus? 13,000 base RNA genome: 1/246153 the size of the human genome CDC Principles of Virology, 4e Neumann et al. Nature. 2009. Influenza virus is one of the most deadly viral pathogens

More information

Computational Analysis and Visualization of the Evolution of Influenza Virus

Computational Analysis and Visualization of the Evolution of Influenza Virus Computational Analysis and Visualization of the Evolution of Influenza Virus A DISSERTATION SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL OF THE UNIVERSITY OF MINNESOTA BY Ham Ching, Lam IN PARTIAL FULFILLMENT

More information

Nature Medicine: doi: /nm.4322

Nature Medicine: doi: /nm.4322 1 2 3 4 5 6 7 8 9 10 11 Supplementary Figure 1. Predicted RNA structure of 3 UTR and sequence alignment of deleted nucleotides. (a) Predicted RNA secondary structure of ZIKV 3 UTR. The stem-loop structure

More information

GENE EXPRESSION. Amoeba Sisters video 3pk9YVo. Individuality & Mutations

GENE EXPRESSION. Amoeba Sisters video   3pk9YVo. Individuality & Mutations Amoeba Sisters video https://www.youtube.com/watch?v=giez 3pk9YVo GENE EXPRESSION Individuality & Mutations Complete video handout http://www.amoebasisters.com/uploads/ 2/1/9/0/21902384/video_recap_of_muta

More information

Biology 350: Microbial Diversity

Biology 350: Microbial Diversity Biology 350: Microbial Diversity Strange Invaders: Viruses, viroids, and prions. Lecture #27 7 November 2007-1- Notice handouts and announcements for today: Outline and study questions A 1999 paper discussing

More information

7.014 Problem Set 7 Solutions

7.014 Problem Set 7 Solutions MIT Department of Biology 7.014 Introductory Biology, Spring 2005 7.014 Problem Set 7 Solutions Question 1 Part A Antigen binding site Antigen binding site Variable region Light chain Light chain Variable

More information

Viral reproductive cycle

Viral reproductive cycle Lecture 29: Viruses Lecture outline 11/11/05 Types of viruses Bacteriophage Lytic and lysogenic life cycles viruses viruses Influenza Prions Mad cow disease 0.5 µm Figure 18.4 Viral structure of capsid

More information

Influenza Surveillance Animal and Public Health Partnership. Jennifer Koeman Director, Producer and Public Health National Pork Board

Influenza Surveillance Animal and Public Health Partnership. Jennifer Koeman Director, Producer and Public Health National Pork Board Influenza Surveillance Animal and Public Health Partnership Jennifer Koeman Director, Producer and Public Health National Pork Board Outline Background on influenza surveillance in swine Case example animal

More information

Immunogenicity of Avian Influenza H7N9 Virus in Birds

Immunogenicity of Avian Influenza H7N9 Virus in Birds Immunogenicity of Avian Influenza H7N9 Virus in Birds Identification of Viral Epitopes Recognized by the Immune System Following Vaccination and Challenge Darrell R. Kapczynski US DEPARTMENT OF AGRICULTURE,

More information

A secret about creationism

A secret about creationism A secret about creationism Even among ardent creationists, most believe in evolution Why? Natural selection is a provable biological process. Selection causes evolution critical in medicine, agriculture

More information

LACTASE PERSISTENCE: EVIDENCE FOR SELECTION

LACTASE PERSISTENCE: EVIDENCE FOR SELECTION LACTASE PERSISTENCE: EVIDENCE FOR SELECTION INTRODUCTION The ability of some human adults to digest lactose the sugar in milk is evidence of recent human evolution. All mammalian babies can digest lactose,

More information

Avian Influenza: Armageddon or Hype? Bryan E. Bledsoe, DO, FACEP The George Washington University Medical Center

Avian Influenza: Armageddon or Hype? Bryan E. Bledsoe, DO, FACEP The George Washington University Medical Center Avian Influenza: Armageddon or Hype? Bryan E. Bledsoe, DO, FACEP The George Washington University Medical Center Definitions: Epidemic The occurrence of cases of an illness in a community or region which

More information

19 2 Viruses Slide 1 of 34

19 2 Viruses Slide 1 of 34 1 of 34 What Is a Virus? What Is a Virus? Viruses are particles of nucleic acid, protein, and in some cases, lipids. Viruses can reproduce only by infecting living cells. 2 of 34 What Is a Virus? Viruses

More information

Section 9. Junaid Malek, M.D.

Section 9. Junaid Malek, M.D. Section 9 Junaid Malek, M.D. Mutation Objective: Understand how mutations can arise, and how beneficial ones can alter populations Mutation= a randomly produced, heritable change in the nucleotide sequence

More information

Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS

Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS 1 Unit 2: Lesson 2 Case Studies: Influenza and HIV LESSON QUESTIONS What steps are involved in viral infection and replication? Why are some kinds of influenza virus more deadly than others? How do flu

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature14008 Supplementary Figure 1. Sequence alignment of A/little yellow-shouldered bat/guatemala/060/2010 (H17N10) polymerase with that of human strain A/Victoria/3/75(H3N2). The secondary

More information

Reassortment of influenza A virus genes linked to PB1 polymerase gene

Reassortment of influenza A virus genes linked to PB1 polymerase gene International Congress Series 1263 (2004) 714 718 Reassortment of influenza A virus genes linked to PB1 polymerase gene Jean C. Downie* www.ics-elsevier.com Centre for Infectious Diseases and Microbiology,

More information

HS-LS4-4 Construct an explanation based on evidence for how natural selection leads to adaptation of populations.

HS-LS4-4 Construct an explanation based on evidence for how natural selection leads to adaptation of populations. Unit 2, Lesson 2: Teacher s Edition 1 Unit 2: Lesson 2 Influenza and HIV Lesson Questions: o What steps are involved in viral infection and replication? o Why are some kinds of influenza virus more deadly

More information

Austin Public Health Epidemiology and Disease Surveillance Unit. Travis County Influenza Surveillance

Austin Public Health Epidemiology and Disease Surveillance Unit. Travis County Influenza Surveillance Travis County Influenza Surveillance Summary Season 2016-2017 (Data through the week ending March 18, 2017). Travis County influenza and influenza-like illness (ILI) activity: Since March 18 th, influenza

More information

Studying Alternative Splicing

Studying Alternative Splicing Studying Alternative Splicing Meelis Kull PhD student in the University of Tartu supervisor: Jaak Vilo CS Theory Days Rõuge 27 Overview Alternative splicing Its biological function Studying splicing Technology

More information

Section B. Comparative Genomics Analysis of Influenza H5N2 Viruses. Objective

Section B. Comparative Genomics Analysis of Influenza H5N2 Viruses. Objective Section B. Comparative Genomics Analysis of Influenza H5N2 Viruses Objective Upon completion of this exercise, you will be able to use the Influenza Research Database (IRD; http://www.fludb.org/) to: Search

More information

Nanoparticulate Vaccine Design: The VesiVax System

Nanoparticulate Vaccine Design: The VesiVax System Nanoparticulate Vaccine Design: The VesiVax System Gary Fujii, Ph.D. President and CEO Molecular Express, Inc. May 16, 2006 Orlando, Florida Influenza Each year up to 20% of the world's population contracts

More information

http://nmhm.washingtondc.museum/collections/archives/agalleries/1918flu/ncp1603.jpg 1 https://assets-production-webvanta-com.s3-us-west- 2 2.amazonaws.com/000000/47/62/original/images/img_109_influenza/Spanish_flu_death_chart.jpg

More information

Observations on Influenza Viri Phylogony. 02/04/07 Bioinformatics: Hatem Nassrat

Observations on Influenza Viri Phylogony. 02/04/07 Bioinformatics: Hatem Nassrat Observations on Influenza Viri Phylogony Introduction Influenza Viri Mutation Differences: in sequence structure and protein function between different mutations Likelihood Calculation: to determine the

More information

Mutants and HBV vaccination. Dr. Ulus Salih Akarca Ege University, Izmir, Turkey

Mutants and HBV vaccination. Dr. Ulus Salih Akarca Ege University, Izmir, Turkey Mutants and HBV vaccination Dr. Ulus Salih Akarca Ege University, Izmir, Turkey Geographic Distribution of Chronic HBV Infection 400 million people are carrier of HBV Leading cause of cirrhosis and HCC

More information